Id Sequence Length Biological associations
2850 ADTHDEILEGLNFNLTEIPEAQ 22

    Reported structure

    Disease

2247 ADTHDEILEGLNFNLTEIPEAQIH 24

    Reported structure

661 ADTHDEILEGLNFNLTEIPEAQIHE 25

    Reported structure

665 ADTHDEILEGLNFNLTEIPEAQIHEG 26

    Reported structure

370 ADTHDEILEGLNFNLTEIPEAQIHEGF 27

    Reported structure

1282 ADTHDEILEGLNFNLTEIPEAQIHEGFQEL 30

    Reported structure

7649 ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR 32

    Reported structure

    Disease

4287 ADVGGEAAGTAINHSHMLLQR 21

    Reported structure

    Disease

4570 AEAVGETLTLPGLVSADNGTYTCEAANK 28

    Reported structure

    Disease

47 AEAVGETLTLPGLVSADNGTYTCEASNK 28

    Reported structure

4043 AEDRDAGANASILYR 15

    Reported structure

    Disease

4611 AEDSGEYHCVYHFVSAPKANATIEVK 26

    Reported structure

    Disease

4279 AEDYGPVEVISHWHPNITINIVDDHTPWVK 30

    Reported structure

    Disease

4032 AEFAVANDTGFVDIPQQEK 19

    Reported structure

    Disease

454 AEFNITIIHPK 11

    Reported structure

3251 AEFNITLIHPK 11

    Reported structure

870 AEFNLTTYR 9

    Reported structure

4631 AEGDVGPPPSTLINQNETFAK 21

    Reported structure

    Disease

3025 AELSNHTRPVILVPGCLGNQLEAK 24

    Reported structure

4481 AELSNHTRPVILVPGCLGNR 20

    Reported structure

    Disease

1821 AEMNGSK 7

    Reported structure

2458 AENQTAPGEVPALSNLRPPSR 21
600 AENQVNVTCQVR 12

    Reported structure

4386 AEPETHLCIDVEDAMNITR 19

    Reported structure

    Disease

2052 AEPGTHICIDVEDAMNITR 19

    Reported structure

644 AEPPINASASDQGEK 15

    Reported structure

3554 AEPPLNASAGDQEEK 15

    Reported structure

    Disease

3526 AEVANLSAHSASPIQDAVLKR 21

    Reported structure

    Disease

445 AFENVTDLQWLILDHNLLENSK 22

    Protein

  • Lumican / Homo sapiens    P51884

    Reported structure

421 AFGQFFSPGEVIYNK 15

    Protein

  • Mucin-5B / Homo sapiens    Q9HC84

    Reported structure

121 AFGQFFSPGEVIYNKTDR 18

    Protein

  • Mucin-5B / Homo sapiens    Q9HC84

    Reported structure

1433 AFGSNPNLTK 10

    Reported structure

4671 AFHQNDVSAHVDILEYSHNVTVGYYATK 28

    Reported structure

    Disease

2874 AFHYNVSSHGCQLLPWTQHSPHTR 24
3941 AFINGTGLETVISR 14

    Reported structure

    Disease

1862 AFINGTGVETVVSADIPNAHGIAVDWVSR 29

    Reported structure

3899 AFINGTGVETVVSADLPNAHGLAVDWVSR 29

    Reported structure

    Disease

1944 AFITNF 6

    Reported structure

287 AFITNFSMIIDGMTYPGIIK 20

    Reported structure

1529 AFITNFSMNIDGMTYPGIIK 20

    Reported structure

2002 AFLLSLAALRDNHTHSDIQVK 21

    Reported structure

4939 AFNISPNDTSSGSCGINLVTLK 22

    Reported structure

    Disease

965 AFNSTLPTMAQMEK 14

    Reported structure

1002 AFNTSVHAAIR 11

    Reported structure

123 AFNTTK 6

    Reported structure

4576 AFPSESKPSESNYSSVDNLNLLR 23

    Reported structure

    Disease

3161 AFQYDTNCSFR 11

    Protein

  • P-selectin / Homo sapiens    P16109

    Reported structure

353 AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR 34

    Reported structure

2563 AGAFLGLTNVAVMNLSGNCLR 21

    Reported structure

1642 AGAINATYK 9

    Reported structure