Id Sequence Length Biological associations
7657 CDIPIGAGICASYQTQTNSPAR 22
7656 ASTEKSNIIRGW 12
7655 AQEKNFTTAPAICHDGKAHFPREGVF 26
7654 WVSNK 5

    Reported structure

    Disease

7653 TPLPPTSAHGNVAEGETKPDPDVTER 26

    Protein

  • Hemopexin / Homo sapiens    P02790

    Reported structure

    Disease

7652 HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR 38

    Reported structure

    Disease

7651 GVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR 38

    Reported structure

    Disease

7650 APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR 44

    Reported structure

    Disease

7649 ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR 32

    Reported structure

    Disease

7648 KVAYSNDSANWTEYQDPRT 19

    Disease

7647 KSYNVTSVLFRK 12

    Disease

7646 RIYSNHSALESLALIPLQAPLKT 23

    Disease

7645 KSVQEIQATFFYFTPNKT 18

    Disease

7644 KKEDALNETRE 11

    Protein

  • Clusterin / Homo sapiens    P10909

    Disease

7643 KMVSHHNLTTGATLINEQWLLTTAKN 26

    Disease

7642 KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY 32

    Disease

7641 KELHHLQEQNVSNAFLDKG 19

    Disease

7640 KVSNVSCQASVSRM 14

    Disease

7639 KTAHCNESFYFLCKR 15

    Disease

7638 RVYIHPFHLVIHNESTCEQLAKA 23

    Disease

7637 RQSGVNATLPEENQPVVFNHVYNIKL 26

    Protein

  • Tenascin / Homo sapiens    P24821

    Disease

7636 RLHNQLLPNVTTVERN 16

    Disease

7635 KNLFLNHSENATAKD 15

    Disease

7634 DFTAAFPR 8

    Disease

7633 KIIEGEPNLKVPGNVTAVLGETLKV 25

    Disease

7632 KHANWTLTPLKS 12

    Disease

7631 KLGNWSAMPSCKA 13

    Disease

7630 RSHNRSEEFLIAGKL 15

    Disease

7629 RQDQCIYNTTYLNVQRE 17

    Disease

7628 KTKPREEQFNSTFRV 15

    Disease

7627 KNVSCYIQNLLLGQEKK 17

    Disease

7626 RTLHSTFQPNISQGKL 16

    Protein

  • Myoferlin / Homo sapiens    Q9NZM1

    Disease

7625 RTLNQSSDELQLSMGNAMFVKE 22

    Disease

7624 KDTNGSQFFITTVKT 15

    Disease

7623 KYLGNATAIFFLPDEGKL 18

    Disease

7622 KWNNTGCQALPSQDEGPSKA 20

    Disease

7621 KFVEGSHNSTVSLTTKN 17

    Disease

7620 KNMDGTFNVTSCLKL 15

    Disease

7619 RVLSNNSDANLELINTWVAKN 21

    Disease

7618 KDIVEYYNDSNGSHVLQGRF 20

    Disease

7617 KSCQHNGTMYQHGEIFSAHELFPSRL 26

    Disease

7616 RFGCEIENNRS 11

    Disease

7615 KLANNTHQHVFDDLRG 16

    Protein

  • Sortilin / Homo sapiens    Q99523

    Disease

7614 KDTRNESTQNCVVAEPEKM 19

    Disease

7613 KEDALNETRE 10

    Protein

  • Clusterin / Homo sapiens    P10909

    Disease

7612 KYQGICPPVTRNETHFDAGAKF 22

    Disease

7611 RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT 32

    Disease

7610 KDTRNESTQNCVVAEPEKMESSISSSSEEMSLSKC 35

    Disease

7609 RFSDGLESNSSTQFEVKK 18

    Disease

7608 RNGSDCPDKFCLFQSETKN 19

    Disease