Id Sequence Length Biological associations
7679 EEQYNSTYR  10
7678 YNENGTITDAVDCALDPLSE 20
7677 YPNQVYYRPVDQYSNQNNFVHDCVNITVK 29
7676 GENFTETDIK 10
7675 VDLPIGINIT 10
7674 SALEPLVDLPIGINIT 16
7673 VSGTNGTKRF 10
7672 VIRGDEVRQIAPGQTGKI 18
7671 TVEKGIYQTSNF 12
7670 TPCNGVEGFNCY 12
7669 RVQPTESIVR 10
7668 QTQTNSPGSASSVASQSIIAY 21
7667 QTQTNSPGSASSVASQ 16
7666 QTQTNSPARAASVASQSIIAY 21
7665 QTQTNSPARAA 11
7664 NFSQILPDPSKPSKRSF 17
7663 NCTEVPVAIHADQL 14
7662 NATRFASVY 9
7661 HKNNKSWMESEF 12
7660 HAPATVCGPKKSTNL 15
7659 GIYQTSNFRVQPTESIVR 18
7658 GEVFNATRFASVY 13
7657 CDIPIGAGICASYQTQTNSPAR 22
7656 ASTEKSNIIRGW 12
7655 AQEKNFTTAPAICHDGKAHFPREGVF 26
7654 WVSNK 5

    Reported structure

    Disease

7653 TPLPPTSAHGNVAEGETKPDPDVTER 26

    Protein

  • Hemopexin / Homo sapiens    P02790

    Reported structure

    Disease

7652 HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR 38

    Reported structure

    Disease

7651 GVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR 38

    Reported structure

    Disease

7650 APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR 44

    Reported structure

    Disease

7649 ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR 32

    Reported structure

    Disease

7648 KVAYSNDSANWTEYQDPRT 19

    Disease

7647 KSYNVTSVLFRK 12

    Disease

7646 RIYSNHSALESLALIPLQAPLKT 23

    Disease

7645 KSVQEIQATFFYFTPNKT 18

    Disease

7644 KKEDALNETRE 11

    Protein

  • Clusterin / Homo sapiens    P10909

    Disease

7643 KMVSHHNLTTGATLINEQWLLTTAKN 26

    Disease

7642 KYAGRANLTNFPENGTFVVNIAQLSQDDSGRY 32

    Disease

7641 KELHHLQEQNVSNAFLDKG 19

    Disease

7640 KVSNVSCQASVSRM 14

    Disease

7639 KTAHCNESFYFLCKR 15

    Disease

7638 RVYIHPFHLVIHNESTCEQLAKA 23

    Disease

7637 RQSGVNATLPEENQPVVFNHVYNIKL 26

    Protein

  • Tenascin / Homo sapiens    P24821

    Disease

7636 RLHNQLLPNVTTVERN 16

    Disease

7635 KNLFLNHSENATAKD 15

    Disease

7634 DFTAAFPR 8

    Disease

7633 KIIEGEPNLKVPGNVTAVLGETLKV 25

    Disease

7632 KHANWTLTPLKS 12

    Disease

7631 KLGNWSAMPSCKA 13

    Disease

7630 RSHNRSEEFLIAGKL 15

    Disease