Id Sequence Length Biological associations
51 ILNQTADMLQLASK 14

    Reported structure

52 NNISLVK 7

    Reported structure

53 VTQVYAENGTVIQGSTVASVYK 22

    Reported structure

54 WFSAGIASNSSWIR 14

    Reported structure

55 NVTLHVPSK 9

    Reported structure

56 ALSNISLR 8

    Protein

  • Plexin-B2 / Homo sapiens    O15031

    Reported structure

57 VNLTLGSIWDK 11

    Reported structure

58 ELPGVCNETMMALWEECKPCLK 22

    Protein

  • Clusterin / Homo sapiens    P10909

    Reported structure

59 KDVNYTQIVVDR 12

    Reported structure

60 SLGNVNF 7

    Reported structure

61 LPSGMLVISNATEGDGGLYR 20

    Protein

  • Neogenin / Homo sapiens    Q92859

    Reported structure

62 IVQIFPNDTSIK 12

    Reported structure

63 HTVFWNSSNPK 11

    Protein

  • Ephrin-A1 / Homo sapiens    P20827

    Reported structure

64 IGFIGNQSQGCIPAR 15

    Reported structure

65 NYSYVIHAK 9

    Reported structure

66 AIVNFTR 7

    Reported structure

67 MNLTQLK 7

    Reported structure

68 LSDLSINSTECLHVHCR 17

    Reported structure

69 GNTTTIISENGHAADTITATNFR 23

    Reported structure

70 VCSNDNK 7

    Protein

  • Sparc / Homo sapiens    P09486

    Reported structure

71 GDQLILNLNNISSDR 15

    Reported structure

72 ESNITVLIK 9

    Reported structure

73 IQFDDNGTYTCQVK 14

    Reported structure

74 IIDNNKTEK 9

    Protein

  • Prosaposin / Homo sapiens    P07602

    Reported structure

75 YNNTVEIVK 9

    Protein

  • Mucin-2 / Homo sapiens    Q02817

    Reported structure

76 IAVQFGPGFSWIANFTK 17

    Reported structure

77 HMSIAINR 8

    Reported structure

78 IQGEEIVFHDINITAHGISHCPTCR 25

    Reported structure

79 QYNPILSMLTNQTGEAGR 18

    Reported structure

80 HYTNSSQDVTVPCR 14

    Reported structure

81 ADGTVNQIEGEATPVNLTEPA 21

    Reported structure

82 EPGSNVTMSVDAECVPMVR 19

    Reported structure

83 NFTVACQHR 9

    Reported structure

84 CPPAVTENK 9

    Reported structure

85 DMSDGFISNITIQR 14

    Reported structure

86 NGTLVAFR 8

    Reported structure

87 CVSNMLWCNGADDCGDGSDEIPCNK 25

    Reported structure

88 IPCSQPPQIEHGTINSSR 18

    Reported structure

89 HANWTITPIK 10

    Reported structure

90 LLSASAHQNVTYHCYQSVAWQDAATGSYDK 30

    Reported structure

91 CIQANYSLMENGKIK 15

    Reported structure

92 KGTENGVNGTLTSNVADSPR 20

    Reported structure

93 TTEFDTNSTDIALK 14

    Reported structure

94 DPCSNVTCSFGSTCAR 16

    Protein

  • Agrin / Homo sapiens    O00468

    Reported structure

95 ITGSDVNIIAENIISPEDMVIFHNITQPR 29

    Reported structure

96 SWPAVGNCSSAL 12

    Protein

  • Hemopexin / Homo sapiens    P02790

    Reported structure

97 ELISNASDALDK 12

    Reported structure

98 LNNSTGLQSSSVSQTK 16

    Reported structure

99 DTVITNQEEPYQNHSGR 17

    Reported structure

101 IINNITSIK 9

    Reported structure