Id Sequence Length Biological associations
1164 AAALDGDPGAGPGDHNR 17

    Reported structure

2429 AACAVKPQEVQMVNGTITNPINGK 24

    Reported structure

4253 AAEDWTENPEPFNASFYR 18

    Reported structure

    Disease

1835 AAENFTIIVK 10

    Reported structure

4041 AAFHNAVAVVIYNNK 15

    Reported structure

    Disease

704 AAFNAQNNGSNFQLEEISR 19

    Reported structure

2868 AAINKWVSNKTEGR 14

    Reported structure

    Disease

1915 AAIPSAIDTNSSK 13

    Reported structure

1091 AAIPSALDTNSSK 13

    Reported structure

2213 AALAAFNAQNNGSNFQLEEISR 22
1874 AALSWSNGNGTASCR 15

    Reported structure

2107 AANGSLR 7

    Reported structure

7310 AANIVIQTEPPVPVSINSNITR 22

    Disease

2571 AANYTSSLNLPDK 13

    Reported structure

2747 AAPAPQEATATFNSTADR 18

    Reported structure

2192 AAQNLTVPGGLR 12

    Protein

  • Tenascin / Homo sapiens    P24821

    Reported structure

2900 AARLFPNSTMVGTGMAPE 18

    Reported structure

    Disease

2004 AASMNHTK 8

    Reported structure

2559 AASNFTEIK 9

    Reported structure

13 AASPLIVAGYNVSGSVR 17

    Reported structure

387 AASTYSIDSVSFSYNTGDNTTFPDAEDK 28

    Reported structure

3050 AASYTEEDENHTAK 14

    Reported structure

1046 AATCINPINGSVCERPANHSAK 22

    Protein

  • Attractin / Homo sapiens    O75882

    Reported structure

2770 AATCINPLNGSVCER 15

    Protein

  • Attractin / Homo sapiens    O75882

    Reported structure

    Disease

3019 AATCINPLNGSVCERPANHSAK 22

    Reported structure

2749 AATTQYANGTVLSGQTTNIVTHR 23

    Reported structure

    Disease

1072 AAWDDDEPWGPWTGNGTFWLPR 22

    Protein

  • Tapasin / Homo sapiens    O15533

    Reported structure

2615 ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK 42

    Protein

  • Uromodulin / Homo sapiens    P07911

    Reported structure

2636 ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR 47

    Protein

  • Uromodulin / Homo sapiens    P07911

    Reported structure

2630 ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGRWHCQCK 53

    Protein

  • Uromodulin / Homo sapiens    P07911

    Reported structure

2633 ACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR 66

    Protein

  • Uromodulin / Homo sapiens    P07911

    Reported structure

4840 ACDGIGTGSLMSAQTVDSSNIDKFINCTK 29

    Reported structure

    Disease

2151 ACMNETR 7

    Reported structure

1405 ACNATNWIEYMFNK 14

    Reported structure

3155 ACNCSGLGSK 10

    Reported structure

2424 ACPLDPATNK 10

    Reported structure

4648 ACQFNR 6

    Reported structure

    Disease

2813 ACVCENVMDIGLTNEKPNPELSYSGSFQPAPGNK 34

    Reported structure

    Disease

225 ADDCALPYLGAICYCDLFCNR 21

    Reported structure

111 ADEEEVPEEWVLLHVVQGQIGAGNYSYLR 29

    Reported structure

2467 ADFGNHTK 8

    Reported structure

985 ADGSFRLENITTGTYTIHAQK 21

    Reported structure

784 ADGTVNQIEGEATPVNITEPAKIEVK 26

    Reported structure

81 ADGTVNQIEGEATPVNLTEPA 21

    Reported structure

398 ADGTVNQIEGEATPVNLTEPAK 22

    Reported structure

2635 ADGTVNQIEGEATPVNLTEPAKLEVK 26

    Reported structure

3264 ADILDVVGMLYVGGLPINYTTR 22

    Reported structure

7289 ADRPSLEKPEPIHLSVSTPVTQGGTVK 27

    Disease

2102 ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR 32

    Reported structure

2235 ADTHDEILEGLNFNLT 16

    Reported structure

2850 ADTHDEILEGLNFNLTEIPEAQ 22

    Reported structure

    Disease

2247 ADTHDEILEGLNFNLTEIPEAQIH 24

    Reported structure

661 ADTHDEILEGLNFNLTEIPEAQIHE 25

    Reported structure

665 ADTHDEILEGLNFNLTEIPEAQIHEG 26

    Reported structure

370 ADTHDEILEGLNFNLTEIPEAQIHEGF 27

    Reported structure

1282 ADTHDEILEGLNFNLTEIPEAQIHEGFQEL 30

    Reported structure

7649 ADTHDEILEGLNFNLTEIPEAQIHEGFQELLR 32

    Reported structure

    Disease

4287 ADVGGEAAGTAINHSHMLLQR 21

    Reported structure

    Disease

4570 AEAVGETLTLPGLVSADNGTYTCEAANK 28

    Reported structure

    Disease

47 AEAVGETLTLPGLVSADNGTYTCEASNK 28

    Reported structure

4043 AEDRDAGANASILYR 15

    Reported structure

    Disease

4611 AEDSGEYHCVYHFVSAPKANATIEVK 26

    Reported structure

    Disease

4279 AEDYGPVEVISHWHPNITINIVDDHTPWVK 30

    Reported structure

    Disease

4032 AEFAVANDTGFVDIPQQEK 19

    Reported structure

    Disease

454 AEFNITIIHPK 11

    Reported structure

3251 AEFNITLIHPK 11

    Reported structure

870 AEFNLTTYR 9

    Reported structure

4631 AEGDVGPPPSTLINQNETFAK 21

    Reported structure

    Disease

3025 AELSNHTRPVILVPGCLGNQLEAK 24

    Reported structure

4481 AELSNHTRPVILVPGCLGNR 20

    Reported structure

    Disease

1821 AEMNGSK 7

    Reported structure

2458 AENQTAPGEVPALSNLRPPSR 21

    Reported structure

600 AENQVNVTCQVR 12

    Reported structure

4386 AEPETHLCIDVEDAMNITR 19

    Reported structure

    Disease

2052 AEPGTHICIDVEDAMNITR 19

    Reported structure

644 AEPPINASASDQGEK 15

    Reported structure

3554 AEPPLNASAGDQEEK 15

    Reported structure

    Disease