Id Sequence Length Biological associations
1 LAGKPTHVNVSVV 13

    Reported structure

2 NYSEVCK 7

    Reported structure

3 FYIQNFTALPLNTVVPPQR 19

    Reported structure

4 KWGHNITEFQQR 12

    Reported structure

5 LDPQTNSSQIK 11

    Reported structure

6 DASSFIAEWQNITK 14

    Reported structure

7 ENSSEICSNNGECVCGQCVCR 21

    Reported structure

8 VQCSPGHFYNTTTHR 15

    Reported structure

9 CGNCSLTTLK 10

    Reported structure

10 FPQVNVTK 8

    Reported structure

11 LSSNSTK 7
12 NCQDIDECVTGIHNCSINETCFNIQGGFR 29

    Protein

  • Fibulin-1 / Homo sapiens    P23142

    Reported structure

13 AASPLIVAGYNVSGSVR 17

    Reported structure

14 NMSIHTK 7

    Reported structure

15 QQQHLFGSNVTDCSGNF 17

    Reported structure

16 GVSEPIMENGSGAWVR 16

    Reported structure

17 GQPANQSVLLSIYDER 16

    Reported structure

18 AGKPTHVNVSVVMAEVDGTCY 21

    Reported structure

19 NGDAYGFYNNSVK 13

    Reported structure

20 QGIDFCPGQNVSGVTTHNIEDHTK 24

    Reported structure

21 GLLFNQTGSCK 11

    Reported structure

22 KLPPGLLANFTLLR 14

    Reported structure

23 QLAHQSNSTNIFFSPV 16

    Reported structure

24 AVLQLNEEGVDTAGSTGVTLNLTSKPIILR 30

    Reported structure

25 GISPGNYSVR 10

    Reported structure

26 DIYQFLCNASER 12

    Reported structure

27 VYKPSAGNNSLY 12

    Reported structure

28 AVNSSCR 7

    Reported structure

29 ANGTTHLVVTEPTR 14

    Reported structure

30 DLGPTLANSTHHNV 14

    Reported structure

31 DNIGSQYLLNWCVQIAK 17

    Reported structure

32 FCWQLPETDYECTNSTSCMTVSCPR 25

    Reported structure

33 CGIVPVIAENYNK 13

    Reported structure

34 GFCEAPGNR 9

    Reported structure

35 NNMEITWTPMNATSAFGPNLR 21

    Reported structure

36 VVDDVSNQTSCR 12

    Reported structure

37 EQFCPPPPQIPNAQNMTTTVNYQDGEK 27

    Reported structure

38 YNSQNQSNNQFVLYR 15

    Reported structure

39 LSLLEEPGNGTFTVILNQLTSR 22
40 LNLTTDPK 8

    Reported structure

41 CLNGNWTEPPQCK 13

    Reported structure

42 LSSLEYLDLSSNNLSR 16

    Protein

  • Podocan / Homo sapiens    Q7Z5L7

    Reported structure

43 ALGFENATQALGR 13

    Reported structure

44 DINTTAQN 8

    Reported structure

45 NVSYAWK 7

    Reported structure

46 HGVIISSTVDTYENGSSVEYR 21

    Reported structure

47 AEAVGETLTLPGLVSADNGTYTCEASNK 28

    Reported structure

48 VFFNLVNLTELSLVR 15

    Reported structure

49 GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK 39

    Reported structure

50 LLIAGTNSSDLQQILSLLESNK 22

    Reported structure

51 ILNQTADMLQLASK 14

    Reported structure

52 NNISLVK 7

    Reported structure

53 VTQVYAENGTVIQGSTVASVYK 22

    Reported structure

54 WFSAGIASNSSWIR 14

    Reported structure

55 NVTLHVPSK 9

    Reported structure

56 ALSNISLR 8

    Protein

  • Plexin-B2 / Homo sapiens    O15031

    Reported structure

57 VNLTLGSIWDK 11

    Reported structure

58 ELPGVCNETMMALWEECKPCLK 22

    Protein

  • Clusterin / Homo sapiens    P10909

    Reported structure

59 KDVNYTQIVVDR 12

    Reported structure

60 SLGNVNF 7

    Reported structure

61 LPSGMLVISNATEGDGGLYR 20

    Protein

  • Neogenin / Homo sapiens    Q92859

    Reported structure

62 IVQIFPNDTSIK 12

    Reported structure

63 HTVFWNSSNPK 11

    Protein

  • Ephrin-A1 / Homo sapiens    P20827

    Reported structure

64 IGFIGNQSQGCIPAR 15

    Reported structure

65 NYSYVIHAK 9

    Reported structure

66 AIVNFTR 7

    Reported structure

67 MNLTQLK 7

    Reported structure

68 LSDLSINSTECLHVHCR 17

    Reported structure

69 GNTTTIISENGHAADTITATNFR 23

    Reported structure

70 VCSNDNK 7

    Protein

  • Sparc / Homo sapiens    P09486

    Reported structure

71 GDQLILNLNNISSDR 15

    Reported structure

72 ESNITVLIK 9

    Reported structure

73 IQFDDNGTYTCQVK 14

    Reported structure

74 IIDNNKTEK 9

    Protein

  • Prosaposin / Homo sapiens    P07602

    Reported structure

75 YNNTVEIVK 9

    Protein

  • Mucin-2 / Homo sapiens    Q02817

    Reported structure

76 IAVQFGPGFSWIANFTK 17

    Reported structure

77 HMSIAINR 8

    Reported structure

78 IQGEEIVFHDINITAHGISHCPTCR 25

    Reported structure

79 QYNPILSMLTNQTGEAGR 18

    Reported structure

80 HYTNSSQDVTVPCR 14

    Reported structure

81 ADGTVNQIEGEATPVNLTEPA 21