Id Sequence Length Biological associations
3367 YYTCLIYNCSAQPHIAPFSGPIDR 24

    Reported structure

    Disease

3015 YYQNVCTQSYSFVWWDWAR 19

    Reported structure

3185 YYQENFCEQICSK 13

    Reported structure

4614 YYNYTLSINGK 11

    Reported structure

    Disease

1982 YYNYTISINGK 11

    Reported structure

1454 YYNQSEAGSHTIQR 14

    Reported structure

2049 YYNQSEAGSHTIQMMFGCDVGSDGR 25

    Reported structure

587 YYNQSEAGSHIIQVMYGCDVGPDGR 25

    Reported structure

533 YYNQSEAGSHIIQR 14

    Reported structure

3474 YYHGELSYLNVTRK 14

    Reported structure

    Disease

3555 YYHGELSYLNVTR 13

    Reported structure

    Disease

2556 YYDSLAQLEAQFEAGLVNVVLIPDNGTGGSWSLK 34

    Reported structure

4962 YWGIHLQAFVQNGTVSK 17

    Reported structure

    Disease

2118 YVTCAIHNCSEK 12

    Reported structure

634 YVQNGTYTVK 10

    Reported structure

3109 YVQDQVAAPFQLSNHTGR 18

    Reported structure

1284 YVQDQVAAPFQISNHTGR 18

    Reported structure

4397 YVPFNGTK 8

    Reported structure

    Disease

2769 YVNMSNHHR 9

    Reported structure

    Disease

1419 YVHNHNVYTNNENCSSPSWQAMHEPR 26

    Reported structure

1722 YVHNHNTYTNNENCSSPSWQAQHESR 26

    Reported structure

2718 YVHDGSETLTDSFVLMANASEMDR 24

    Reported structure

    Disease

2042 YVAFNGTK 8

    Reported structure

3032 YTVNQCR 7

    Reported structure

2266 YTTFEYPNTINFSCNTGFYLNGADSAK 27

    Reported structure

4744 YTSDPNVTSVGPSK 14

    Protein

  • Plexin-B1 / Mus musculus    Q8CJH3

    Reported structure

    Disease

3727 YTLGGSHNQTIR 12

    Reported structure

    Disease

313 YTLDPNITSAGPTK 14
3007 YTGNPTK 7

    Reported structure

3632 YTGNASALLILPDQGR 16

    Reported structure

    Disease

1749 YTGNASALFILPDQDKMEEVEAMLLPETLK 30

    Reported structure

119 YTGNASALFILPDQDK 16

    Reported structure

839 YTGNASALF 9

    Reported structure

3244 YTCTAQTIVDNSSASADLVVR 21

    Reported structure

1970 YTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK 37

    Reported structure

3831 YSVQHMYFTYNLSDTEHFPNAISK 24

    Reported structure

    Disease

4560 YSVPEETDKGTVVGNISK 18

    Reported structure

    Disease

3708 YSVPEELDKGSFVGNISK 18

    Reported structure

    Disease

2540 YSVLIMAEKPVGDLSSPNETK 21

    Reported structure

2345 YSVANDTGFVDIPKQEK 17

    Reported structure

1409 YSVANDTGFVDIPK 14

    Reported structure

4353 YSSNLSNFNYER 12

    Reported structure

    Disease

7282 YSSLAEAASK 10

    Disease

4369 YSQAANSTKELDDCEQANK 19

    Reported structure

    Disease

6997 YSNNSIAIPT 10

    Reported structure

7013 YSNNSIA 7

    Reported structure

3602 YSINVGQLNGPNCTR 15

    Reported structure

    Disease

4644 YSGNYTIDPDGSGPLKPFVVYCDIR 25

    Reported structure

    Disease

2407 YSENSTTVIR 10

    Reported structure

1371 YRLNYSLPTGQWVGVQLPR 19

    Protein

  • Tenascin / Homo sapiens    P24821

    Reported structure