Id Sequence Length Biological associations
7729 PREEQFNSTYR 11

    Protein

    Disease

    Reported glycosite

7728 LMVVFPTRDGGEEAEVDKEFETWK 24

    Protein

    Source

    Disease

    Reported glycosite

7727 ELNDECHPDPDVELAXCNSTVDVAPWR 27

    Source

    Disease

7726 AQNDSCTQYFVEFNSR 16

    Source

    Disease

7725 AENGSESFTMGINYFSDMTFEEIPK 25

    Protein

    Source

    Disease

    Reported glycosite

7724 GSKNVSSE 8

    Disease

7723 FGSKNVSSE 9

    Disease

7722 TVNITITQGLA 11

    Disease

7721 TVNITITQG 9

    Disease

7720 KCQGAYSPEDNSTQW 15

    Disease

7719 FHNESLISSQASSY 14

    Disease

7718 CRGLVGSKNVSSE 13

    Disease

7717 RCQTNLSTLSDPVQLE 16

    Disease

7716 TVNITITQGL 10

    Disease

7715 SLSSVVTVPSSSLGTQTY 18

    Disease

7714 NSGALTSGVHTFPAVLQSSGLY 22

    Disease

7713 YNLT 4

    Protein

  • Ovalbumin / Gallus gallus    P01012

    Reported structure

    Disease

7712 YCNASVTNSVK 11
7711 VVHAVEVALATFNAESNGSYLQLVEISR 28

    Reported structure

    Disease

7710 RPTGEVYDIEIDTLETTCHVLDPTPLANCSVR 32

    Reported structure

    Disease

7709 NLTKDR 6

    Reported structure

    Disease

7708 LCPDCPLLAPLNDSR 15

    Reported structure

    Disease

7707 NKSVLLGR 8

    Disease

7706 AVCGGVLVHPQWVLTAAHCIRNKSVILLGR 30

    Disease

7705 AVCGGVLVHPQWVLTAAHCIRNK 23

    Disease

7704 YPNAS 5

    Reported structure

7703 TPNNNGT 7

    Reported structure

7702 SPLNTS 6

    Reported structure

7701 SNNSKPVEDKDAVA 14

    Reported structure

7700 SNNSKPVEDKDAV 13

    Reported structure

7699 SNNSKPVEDKDA 12

    Reported structure

7698 SNNSKPV 7

    Reported structure

7697 RPGVNLS 7

    Reported structure

7696 RPGVN 5

    Reported structure

7695 QNTTY 5

    Reported structure

7694 NQSLP 5

    Reported structure

7693 NNSKPVEDKDA 11

    Reported structure

7692 NNSKPV 6

    Reported structure

7691 NNQSLP 6

    Reported structure

7690 NDTAS 5

    Reported structure

7689 IPNIT 5

    Reported structure

7688 GENLN 5

    Reported structure

7687 EAQNT 5

    Reported structure

7686 THTNISE 7
7685 STPPTPSPSCCHPR 14
7684 STGKPTLYNVSLV(MSO)SDTAGTCY 26
7683 SHPNATFSAVGE 12
7682 SCDTPPPCPR 10

    Disease

7681 HYTNPSQDVTVPCPVPSTPPTPSP 24
7680 GLTFQQNASSM(SO)CVPDQDTAIR 25