Id Sequence Length Biological associations
7707 NKSVLLGR 8

    Disease

7706 AVCGGVLVHPQWVLTAAHCIRNKSVILLGR 30

    Disease

7705 AVCGGVLVHPQWVLTAAHCIRNK 23

    Disease

7704 YPNAS 5

    Reported structure

7703 TPNNNGT 7

    Reported structure

7702 SPLNTS 6

    Reported structure

7701 SNNSKPVEDKDAVA 14

    Reported structure

7700 SNNSKPVEDKDAV 13

    Reported structure

7699 SNNSKPVEDKDA 12

    Reported structure

7698 SNNSKPV 7

    Reported structure

7697 RPGVNLS 7

    Reported structure

7696 RPGVN 5

    Reported structure

7695 QNTTY 5

    Reported structure

7694 NQSLP 5

    Reported structure

7693 NNSKPVEDKDA 11

    Reported structure

7692 NNSKPV 6

    Reported structure

7691 NNQSLP 6

    Reported structure

7690 NDTAS 5

    Reported structure

7689 IPNIT 5

    Reported structure

7688 GENLN 5

    Reported structure

7687 EAQNT 5

    Reported structure

7686 THTNISE 7
7685 STPPTPSPSCCHPR 14
7684 STGKPTLYNVSLV(MSO)SDTAGTCY 26
7683 SHPNATFSAVGE 12
7682 SCDTPPPCPR 10

    Disease

7681 HYTNPSQDVTVPCPVPSTPPTPSP 24
7680 GLTFQQNASSM(SO)CVPDQDTAIR 25
7679 EEQYNSTYR  10
7678 YNENGTITDAVDCALDPLSE 20
7677 YPNQVYYRPVDQYSNQNNFVHDCVNITVK 29
7676 GENFTETDIK 10
7675 VDLPIGINIT 10
7674 SALEPLVDLPIGINIT 16
7673 VSGTNGTKRF 10
7672 VIRGDEVRQIAPGQTGKI 18
7671 TVEKGIYQTSNF 12
7670 TPCNGVEGFNCY 12
7669 RVQPTESIVR 10
7668 QTQTNSPGSASSVASQSIIAY 21
7667 QTQTNSPGSASSVASQ 16
7666 QTQTNSPARAASVASQSIIAY 21
7665 QTQTNSPARAA 11
7664 NFSQILPDPSKPSKRSF 17
7663 NCTEVPVAIHADQL 14
7662 NATRFASVY 9
7661 HKNNKSWMESEF 12
7660 HAPATVCGPKKSTNL 15
7659 GIYQTSNFRVQPTESIVR 18
7658 GEVFNATRFASVY 13