FDFQGTCEYLLSAPCHGPPLGAENFTVTVANEHR (34aa)

References (2)

Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018)
Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang
Pubmed : 29741879   DOI : 10.1021/acs.analchem.8b01137
Status : Unreviewed

Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018)
Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang
Pubmed : 29671580   DOI : 10.1021/acs.analchem.8b01051
Status : Unreviewed