YPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPR (40aa)

SNFG, Text, Oxford

    Reported structure

    Disease

References (1)

Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018)
Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang
Pubmed : 29671580   DOI : 10.1021/acs.analchem.8b01051
Status : Unreviewed

GlyConnect Creative Commons License

Supported by SIB ExPASy