CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)

SNFG, Text, Oxford

    Disease

References (1)

Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000)
Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P
Pubmed : 10677208  
Status : Reviewed

GlyConnect Creative Commons License

Supported by SIB ExPASy