Id Sequence Length Biological associations
1 LAGKPTHVNVSVV 13
2 NYSEVCK 7
3 FYIQNFTALPLNTVVPPQR 19
4 KWGHNITEFQQR 12
5 LDPQTNSSQIK 11
6 DASSFIAEWQNITK 14

    Reported structure

7 ENSSEICSNNGECVCGQCVCR 21
8 VQCSPGHFYNTTTHR 15
9 CGNCSLTTLK 10
10 FPQVNVTK 8
11 LSSNSTK 7
12 NCQDIDECVTGIHNCSINETCFNIQGGFR 29
13 AASPLIVAGYNVSGSVR 17
14 NMSIHTK 7
15 QQQHLFGSNVTDCSGNF 17
16 GVSEPIMENGSGAWVR 16
17 GQPANQSVLLSIYDER 16
18 AGKPTHVNVSVVMAEVDGTCY 21
19 NGDAYGFYNNSVK 13
20 QGIDFCPGQNVSGVTTHNIEDHTK 24
21 GLLFNQTGSCK 11
22 KLPPGLLANFTLLR 14
23 QLAHQSNSTNIFFSPV 16
24 AVLQLNEEGVDTAGSTGVTLNLTSKPIILR 30
25 GISPGNYSVR 10
26 DIYQFLCNASER 12
27 VYKPSAGNNSLY 12
28 AVNSSCR 7
29 ANGTTHLVVTEPTR 14
30 DLGPTLANSTHHNV 14
31 DNIGSQYLLNWCVQIAK 17
32 FCWQLPETDYECTNSTSCMTVSCPR 25
33 CGIVPVIAENYNK 13

    Reported structure

34 GFCEAPGNR 9
35 NNMEITWTPMNATSAFGPNLR 21
36 VVDDVSNQTSCR 12
37 EQFCPPPPQIPNAQNMTTTVNYQDGEK 27
38 YNSQNQSNNQFVLYR 15
39 LSLLEEPGNGTFTVILNQLTSR 22

    Reported structure

40 LNLTTDPK 8

    Reported structure

41 CLNGNWTEPPQCK 13
42 LSSLEYLDLSSNNLSR 16
43 ALGFENATQALGR 13
44 DINTTAQN 8
45 NVSYAWK 7
46 HGVIISSTVDTYENGSSVEYR 21
47 AEAVGETLTLPGLVSADNGTYTCEASNK 28
48 VFFNLVNLTELSLVR 15
49 GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK 39
50 LLIAGTNSSDLQQILSLLESNK 22