taxonomy (2)
protein (9)
source (6)
structure (257)
composition (194)
disease (1)
reference (9)
site (108)
peptide (181)
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (Schneider 2) - Receptor-binding domain monomer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- BTI-Tn-5B1-4 (CVCL_C190)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- Schneider 2 (CVCL_Z232)
Source
- N-Linked / Complex / Structure 2843
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1850
- N-Linked / Complex / Structure 9347
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1497
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10031
- N-Linked / Complex / Structure 10054
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 2719
- N-Linked / Complex / Structure 9557
- N-Linked / Complex / Structure 9835
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / Structure 9792
- N-Linked / Complex / Structure 10064
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9716
- N-Linked / Complex / Structure 10021
- N-Linked / Complex / Structure 2708
- N-Linked / Complex / Structure 10018
- N-Linked / Complex / Structure 231
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9558
- N-Linked / Complex / Structure 9958
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9671
- N-Linked / Complex / Structure 10745
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9689
- N-Linked / Complex / Structure 10049
- N-Linked / Complex / Structure 10741
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1147
- N-Linked / Complex / Structure 9726
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / Structure 9713
- N-Linked / Complex / Structure 10754
- N-Linked / Complex / Structure 10015
- N-Linked / Complex / Structure 908
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9469
- N-Linked / Complex / Structure 10022
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 3507
- N-Linked / Complex / Structure 32
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9883
- N-Linked / Complex / Structure 10052
- N-Linked / Complex / Structure 9633
- N-Linked / Complex / Structure 10105
- N-Linked / Complex / Structure 11719
- N-Linked / Complex / Structure 3446
- N-Linked / Complex / Structure 9694
- N-Linked / Complex / Structure 9780
- N-Linked / Complex / Structure 10793
- N-Linked / Complex / Structure 11639
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 10084
- N-Linked / Complex / Structure 9702
- N-Linked / Complex / Structure 10733
- N-Linked / Complex / Structure 10771
- N-Linked / Complex / Structure 10783
- N-Linked / Complex / Structure 10009
- N-Linked / Complex / Structure 10012
- N-Linked / Complex / Structure 1523
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 11633
- N-Linked / Complex / Structure 10097
- N-Linked / Complex / Structure 10034
- N-Linked / Complex / Structure 9607
- N-Linked / Complex / Structure 10020
- N-Linked / Complex / Structure 10110
- N-Linked / Complex / Structure 9778
- N-Linked / Complex / Structure 10041
- N-Linked / Complex / Structure 10107
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-?)[Gal(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9555
- N-Linked / Complex / Structure 10053
- N-Linked / Complex / Structure 10080
- N-Linked / Complex / Structure 11524
- N-Linked / Complex / Structure 9759
- N-Linked / Complex / Structure 9663
- N-Linked / Complex / Structure 9865
- N-Linked / Complex / Structure 10740
- N-Linked / Complex / Structure 10011
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2607
- N-Linked / Complex / Structure 9692
- N-Linked / Complex / Structure 10976
- N-Linked / Complex / Structure 10019
- N-Linked / Complex / Structure 10090
- N-Linked / Complex / Structure 11864
- N-Linked / Complex / Structure 1149
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9734
- N-Linked / Complex / Structure 10083
- N-Linked / Complex / Structure 9565
- N-Linked / Complex / Structure 10039
- N-Linked / Complex / Structure 10077
- N-Linked / Complex / Structure 10002
- N-Linked / Complex / Structure 9698
- N-Linked / Complex / Structure 9973
- N-Linked / Complex / Structure 10058
- N-Linked / Complex / Structure 10087
- N-Linked / Complex / Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Neu?c(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1519
- N-Linked / Complex / Structure 9354
- N-Linked / Complex / Structure 10072
- N-Linked / Complex / Structure 11865
- N-Linked / Complex / Structure 720
- N-Linked / Complex / Structure 9693
- N-Linked / Complex / Structure 10051
- N-Linked / Complex / Structure 10106
- N-Linked / Complex / Structure 10036
- N-Linked / Complex / Structure 9596
- N-Linked / Complex / Structure 10005
- N-Linked / Complex / Structure 9568
- N-Linked / Complex / Structure 9815
- N-Linked / Complex / Structure 10061
- N-Linked / Complex / Structure 10756
- N-Linked / Complex / Structure 10048
- N-Linked / Complex / Structure 2458
- N-Linked / Complex / Structure 10035
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[Gal(b1-4)GlcNAc(b1-2)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 10059
- N-Linked / Complex / Structure 9605
- N-Linked / Complex / Structure 10063
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9821
- N-Linked / Complex / Structure 10038
- N-Linked / Complex / Structure 10103
- N-Linked / Complex / Structure 10044
- N-Linked / Complex / Structure 9732
- N-Linked / Complex / Structure 10057
- N-Linked / Complex / Structure 10687
- N-Linked / Complex / Structure 9997
- N-Linked / Complex / Structure 10043
- N-Linked / Complex / Structure 10099
- N-Linked / Complex / Structure 9840
- N-Linked / Complex / Structure 10040
- N-Linked / Complex / Structure 439
- N-Linked / Complex / Structure 9779
- N-Linked / Complex / Structure 138
- N-Linked / Complex / Structure 9994
- N-Linked / Complex / Structure 9829
- N-Linked / Complex / Structure 9998
- N-Linked / Complex / Structure 9723
- N-Linked / Complex / Structure 829
- N-Linked / Complex / Structure 9797
- N-Linked / Complex / Structure 10060
- N-Linked / Complex / Structure 10095
- N-Linked / Complex / Structure 10790
- N-Linked / Complex / Structure 10108
- N-Linked / Complex / Structure 1342
- N-Linked / Complex / Structure 10717
- N-Linked / Complex / Structure 9894
- N-Linked / Complex / Structure 2404
- N-Linked / Complex / Structure 10071
- N-Linked / Complex / Structure 10042
- N-Linked / Complex / Structure 3656
- N-Linked / Complex / Structure 10787
- N-Linked / High-Mannose / Structure 10033
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 2812
- N-Linked / High-Mannose / Structure 10055
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / High-Mannose / Structure 10030
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 10811
- N-Linked / High-Mannose / Structure 10092
- N-Linked / High-Mannose / Structure 10028
- N-Linked / High-Mannose / Structure 314
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Structure 2636
- N-Linked / High-Mannose / Structure 10715
- N-Linked / High-Mannose / Structure 10029
- N-Linked / Hybrid / Structure 10027
- N-Linked / Hybrid / Structure 10026
- N-Linked / Hybrid / Structure 1713
- N-Linked / Hybrid / Structure 9564
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9730
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 10023
- N-Linked / Hybrid / Structure 10025
- N-Linked / Hybrid / Structure 10003
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 10010
- N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 10032
- N-Linked / Hybrid / Structure 3469
- N-Linked / Hybrid / Structure 10008
- N-Linked / Hybrid / Structure 10812
- N-Linked / Hybrid / Structure 10001
- N-Linked / Pauci-Mannose / Structure 9748
- N-Linked / Pauci-Mannose / Structure 10056
- N-Linked / Pauci-Mannose / Structure 10069
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9617
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10068
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc"
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)][Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 9888
- N-Linked / Pauci-Mannose / Structure 10067
- N-Linked / Pauci-Mannose / Structure 10066
- N-Linked / Truncated / Structure 9993
- N-Linked / Truncated / Structure 9992
- O-Linked / Core 0 / GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 9312
- O-Linked / Core 1 / Fuc(a1-2)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / NeuAc(?2-?)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-6)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 10070
- O-Linked / Core 1 / Neu5Ac(?2-?)Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 10074
- O-Linked / Core 2 / Structure 10101
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Structure 10111
- O-Linked / Core 2 / Structure 10073
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 10079
- O-Linked / Core 2 / Structure 9364
- O-Linked / Core 2 / Structure 10075
- O-Linked / Core 2 / Structure 9504
- O-Linked / Core 2 / Structure 10081
- O-Linked / Core 2 / Structure 10112
- O-Linked / Core 2 / NeuAc(?2-?)Gal(?1-?)GlcNAc(b1-6)[NeuAc(?2-?)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 10098
- O-Linked / Core 2 / Structure 10100
- O-Linked / Core 4 / Structure 10085
- O-Linked / Core 4 / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(b1-3)]GalNAc
- O-Linked / No-core / Gal(b1-4)GlcNAc(b1-2)Man
- O-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man
- O-Linked / O-Fuc / Structure 10727
Reported structure
- HexNAc:1 (avg mass : 221.2103 )
- HexNAc:1 NeuAc:1 (avg mass : 512.4682 )
- HexNAc:1 dHex:1 (avg mass : 367.3533 )
- HexNAc:1 dHex:2 (avg mass : 513.4963 )
- Hex:1 HexNAc:1 (avg mass : 383.3527 )
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
- Hex:1 HexNAc:1 NeuAc:2 (avg mass : 965.8685 )
- Hex:1 HexNAc:1 dHex:1 (avg mass : 529.4957 )
- Hex:1 HexNAc:1 dHex:1 NeuAc:1 (avg mass : 820.7536 )
- Hex:1 HexNAc:2 (avg mass : 586.5477 )
- Hex:1 HexNAc:2 NeuAc:1 (avg mass : 877.8056 )
- Hex:1 HexNAc:2 dHex:1 (avg mass : 732.6907 )
- Hex:1 HexNAc:2 dHex:2 (avg mass : 878.8337 )
- Hex:1 HexNAc:3 (avg mass : 789.7427 )
- Hex:1 HexNAc:3 NeuAc:1 (avg mass : 1081.0006 )
- Hex:1 HexNAc:3 NeuAc:1 Su:1 (avg mass : 1161.0648 )
- Hex:1 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1227.1436 )
- Hex:2 HexNAc:1 (avg mass : 545.4951 )
- Hex:2 HexNAc:1 NeuAc:1 (avg mass : 836.753 )
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
- Hex:2 HexNAc:2 Su:1 (avg mass : 828.7543 )
- Hex:2 HexNAc:2 NeuAc:1 (avg mass : 1039.948 )
- Hex:2 HexNAc:2 NeuAc:2 (avg mass : 1331.2059 )
- Hex:2 HexNAc:2 NeuAc:2 Su:1 (avg mass : 1411.2701 )
- Hex:2 HexNAc:2 dHex:1 (avg mass : 894.8331 )
- Hex:2 HexNAc:2 dHex:1 NeuAc:1 (avg mass : 1186.091 )
- Hex:2 HexNAc:2 dHex:2 (avg mass : 1040.9761 )
- Hex:2 HexNAc:2 dHex:2 NeuAc:1 (avg mass : 1332.234 )
- Hex:2 HexNAc:3 (avg mass : 951.8851 )
- Hex:2 HexNAc:3 dHex:1 (avg mass : 1098.0281 )
- Hex:2 HexNAc:3 dHex:2 (avg mass : 1244.1711 )
- Hex:2 HexNAc:5 (avg mass : 1358.2751 )
- Hex:3 HexNAc:2 (avg mass : 910.8325 )
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
- Hex:3 HexNAc:2 dHex:2 (avg mass : 1203.1185 )
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
- Hex:3 HexNAc:3 dHex:1 (avg mass : 1260.1705 )
- Hex:3 HexNAc:3 dHex:2 (avg mass : 1406.3135 )
- Hex:3 HexNAc:4 (avg mass : 1317.2225 )
- Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
- Hex:3 HexNAc:4 dHex:2 (avg mass : 1609.5085 )
- Hex:3 HexNAc:4 dHex:3 (avg mass : 1755.6515 )
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
- Hex:3 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 1957.8184 )
- Hex:3 HexNAc:6 (avg mass : 1723.6125 )
- Hex:3 HexNAc:6 dHex:1 (avg mass : 1869.7555 )
- Hex:3 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2161.0134 )
- Hex:3 HexNAc:6 dHex:2 (avg mass : 2015.8985 )
- Hex:3 HexNAc:6 dHex:2 NeuAc:1 (avg mass : 2307.1564 )
- Hex:3 HexNAc:6 dHex:3 (avg mass : 2162.0415 )
- Hex:3 HexNAc:7 dHex:1 (avg mass : 2072.9505 )
- Hex:3 HexNAc:8 (avg mass : 2130.0025 )
- Hex:3 HexNAc:8 dHex:1 (avg mass : 2276.1455 )
- Hex:3 HexNAc:9 dHex:1 (avg mass : 2479.3405 )
- Hex:4 HexNAc:2 (avg mass : 1072.9749 )
- Hex:4 HexNAc:2 dHex:1 (avg mass : 1219.1179 )
- Hex:4 HexNAc:2 dHex:2 (avg mass : 1365.2609 )
- Hex:4 HexNAc:3 (avg mass : 1276.1699 )
- Hex:4 HexNAc:3 NeuAc:1 (avg mass : 1567.4278 )
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
- Hex:4 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 1713.5708 )
- Hex:4 HexNAc:3 dHex:2 (avg mass : 1568.4559 )
- Hex:4 HexNAc:3 dHex:3 (avg mass : 1714.5989 )
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
- Hex:4 HexNAc:4 dHex:1 (avg mass : 1625.5079 )
- Hex:4 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 1916.7658 )
- Hex:4 HexNAc:4 dHex:2 (avg mass : 1771.6509 )
- Hex:4 HexNAc:5 (avg mass : 1682.5599 )
- Hex:4 HexNAc:5 NeuAc:1 (avg mass : 1973.8178 )
- Hex:4 HexNAc:5 NeuAc:2 (avg mass : 2265.0757 )
- Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2119.9608 )
- Hex:4 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2411.2187 )
- Hex:4 HexNAc:5 dHex:2 (avg mass : 1974.8459 )
- Hex:4 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2266.1038 )
- Hex:4 HexNAc:6 (avg mass : 1885.7549 )
- Hex:4 HexNAc:6 NeuAc:1 (avg mass : 2177.0128 )
- Hex:4 HexNAc:6 dHex:1 (avg mass : 2031.8979 )
- Hex:4 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2323.1558 )
- Hex:4 HexNAc:6 dHex:2 (avg mass : 2178.0409 )
- Hex:4 HexNAc:6 dHex:4 (avg mass : 2470.3269 )
- Hex:4 HexNAc:7 (avg mass : 2088.9499 )
- Hex:4 HexNAc:7 NeuAc:1 (avg mass : 2380.2078 )
- Hex:4 HexNAc:7 dHex:1 (avg mass : 2235.0929 )
- Hex:4 HexNAc:7 dHex:2 (avg mass : 2381.2359 )
- Hex:4 HexNAc:7 dHex:3 (avg mass : 2527.3789 )
- Hex:5 HexNAc:2 (avg mass : 1235.1173 )
- Hex:5 HexNAc:2 Ph:1 (avg mass : 1315.0972 )
- Hex:5 HexNAc:2 dHex:1 (avg mass : 1381.2603 )
- Hex:5 HexNAc:2 dHex:2 (avg mass : 1527.4033 )
- Hex:5 HexNAc:3 (avg mass : 1438.3123 )
- Hex:5 HexNAc:3 NeuAc:1 (avg mass : 1729.5702 )
- Hex:5 HexNAc:3 dHex:1 (avg mass : 1584.4553 )
- Hex:5 HexNAc:3 dHex:2 (avg mass : 1730.5983 )
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
- Hex:5 HexNAc:4 NeuAc:1 (avg mass : 1932.7652 )
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
- Hex:5 HexNAc:4 dHex:1 (avg mass : 1787.6503 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2078.9082 )
- Hex:5 HexNAc:4 dHex:1 NeuAc:2 (avg mass : 2370.1661 )
- Hex:5 HexNAc:4 dHex:2 (avg mass : 1933.7933 )
- Hex:5 HexNAc:4 dHex:2 NeuAc:1 (avg mass : 2225.0512 )
- Hex:5 HexNAc:4 dHex:3 (avg mass : 2079.9363 )
- Hex:5 HexNAc:4 dHex:3 NeuAc:1 (avg mass : 2371.1942 )
- Hex:5 HexNAc:4 dHex:4 (avg mass : 2226.0793 )
- Hex:5 HexNAc:4 dHex:5 (avg mass : 2372.2223 )
- Hex:5 HexNAc:5 (avg mass : 1844.7023 )
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
- Hex:5 HexNAc:5 NeuAc:2 (avg mass : 2427.2181 )
- Hex:5 HexNAc:5 dHex:1 (avg mass : 1990.8453 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2282.1032 )
- Hex:5 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2573.3611 )
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
- Hex:5 HexNAc:5 dHex:3 (avg mass : 2283.1313 )
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
- Hex:5 HexNAc:6 dHex:1 (avg mass : 2194.0403 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2485.2982 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2776.5561 )
- Hex:5 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3067.814 )
- Hex:5 HexNAc:6 dHex:2 (avg mass : 2340.1833 )
- Hex:6 HexNAc:2 (avg mass : 1397.2597 )
- Hex:6 HexNAc:2 Ph:1 (avg mass : 1477.2396 )
- Hex:6 HexNAc:3 (avg mass : 1600.4547 )
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
- Hex:6 HexNAc:3 dHex:1 (avg mass : 1746.5977 )
- Hex:6 HexNAc:3 dHex:1 NeuAc:1 (avg mass : 2037.8556 )
- Hex:6 HexNAc:4 (avg mass : 1803.6497 )
- Hex:6 HexNAc:4 NeuAc:1 (avg mass : 2094.9076 )
- Hex:6 HexNAc:4 dHex:1 (avg mass : 1949.7927 )
- Hex:6 HexNAc:4 dHex:1 NeuAc:1 (avg mass : 2241.0506 )
- Hex:6 HexNAc:4 dHex:2 (avg mass : 2095.9357 )
- Hex:6 HexNAc:4 dHex:3 (avg mass : 2242.0787 )
- Hex:6 HexNAc:5 (avg mass : 2006.8447 )
- Hex:6 HexNAc:5 NeuAc:1 (avg mass : 2298.1026 )
- Hex:6 HexNAc:5 NeuAc:2 (avg mass : 2589.3605 )
- Hex:6 HexNAc:5 NeuAc:3 (avg mass : 2880.6184 )
- Hex:6 HexNAc:5 dHex:1 (avg mass : 2152.9877 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2444.2456 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:2 (avg mass : 2735.5035 )
- Hex:6 HexNAc:5 dHex:1 NeuAc:3 (avg mass : 3026.7614 )
- Hex:6 HexNAc:5 dHex:2 (avg mass : 2299.1307 )
- Hex:6 HexNAc:5 dHex:2 NeuAc:1 (avg mass : 2590.3886 )
- Hex:6 HexNAc:5 dHex:3 (avg mass : 2445.2737 )
- Hex:6 HexNAc:5 dHex:3 NeuAc:1 (avg mass : 2736.5316 )
- Hex:6 HexNAc:6 (avg mass : 2210.0397 )
- Hex:6 HexNAc:6 NeuAc:1 (avg mass : 2501.2976 )
- Hex:6 HexNAc:6 NeuAc:2 (avg mass : 2792.5555 )
- Hex:6 HexNAc:6 dHex:1 (avg mass : 2356.1827 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2647.4406 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2938.6985 )
- Hex:6 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3229.9564 )
- Hex:6 HexNAc:6 dHex:2 (avg mass : 2502.3257 )
- Hex:6 HexNAc:6 dHex:3 (avg mass : 2648.4687 )
- Hex:6 HexNAc:7 (avg mass : 2413.2347 )
- Hex:6 HexNAc:7 dHex:1 (avg mass : 2559.3777 )
- Hex:6 HexNAc:8 (avg mass : 2616.4297 )
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
- Hex:7 HexNAc:2 Ph:1 (avg mass : 1639.382 )
- Hex:7 HexNAc:3 (avg mass : 1762.5971 )
- Hex:7 HexNAc:4 (avg mass : 1965.7921 )
- Hex:7 HexNAc:4 dHex:3 (avg mass : 2404.2211 )
- Hex:7 HexNAc:5 dHex:1 (avg mass : 2315.1301 )
- Hex:7 HexNAc:5 dHex:1 NeuAc:1 (avg mass : 2606.388 )
- Hex:7 HexNAc:5 dHex:2 (avg mass : 2461.2731 )
- Hex:7 HexNAc:6 (avg mass : 2372.1821 )
- Hex:7 HexNAc:6 NeuAc:1 (avg mass : 2663.44 )
- Hex:7 HexNAc:6 NeuAc:2 (avg mass : 2954.6979 )
- Hex:7 HexNAc:6 NeuAc:3 (avg mass : 3245.9558 )
- Hex:7 HexNAc:6 NeuAc:4 (avg mass : 3537.2137 )
- Hex:7 HexNAc:6 dHex:1 (avg mass : 2518.3251 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 3100.8409 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:3 (avg mass : 3392.0988 )
- Hex:7 HexNAc:6 dHex:1 NeuAc:4 (avg mass : 3683.3567 )
- Hex:7 HexNAc:6 dHex:4 NeuAc:1 (avg mass : 3248.012 )
- Hex:7 HexNAc:7 dHex:1 (avg mass : 2721.5201 )
- Hex:7 HexNAc:7 dHex:1 NeuAc:2 (avg mass : 3304.0359 )
- Hex:7 HexNAc:7 dHex:3 (avg mass : 3013.8061 )
- Hex:7 HexNAc:8 (avg mass : 2778.5721 )
- Hex:8 HexNAc:2 (avg mass : 1721.5445 )
- Hex:8 HexNAc:6 (avg mass : 2534.3245 )
- Hex:8 HexNAc:6 NeuAc:1 (avg mass : 2825.5824 )
- Hex:8 HexNAc:7 NeuAc:1 (avg mass : 3028.7774 )
- Hex:8 HexNAc:7 dHex:1 (avg mass : 2883.6625 )
- Hex:8 HexNAc:8 dHex:1 (avg mass : 3086.8575 )
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
- Hex:9 HexNAc:4 dHex:1 (avg mass : 2436.2199 )
- Hex:9 HexNAc:8 dHex:1 (avg mass : 3248.9999 )
- Hex:10 HexNAc:2 (avg mass : 2045.8293 )
- Hex:10 HexNAc:9 dHex:1 (avg mass : 3614.3373 )
- Hex:11 HexNAc:2 (avg mass : 2207.9717 )
Composition
- COVID-19 (DOID:0080600)
Disease
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Site-specific O-glycosylation analysis of SARS-CoV-2 spike protein produced in insect and human cells (2021 - Ieva Bagdonaite, Andrew J. Thompson, Xiaoning Wang, Max Søgaard, Cyrielle Fougeroux, Martin Frank, Jolene K. Diedrich, John R. Yates 3rd, Ali Salanti, Sergey Y. Vakhrushev, James C. Paulson, Hans H. Wandall) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
Reference
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Thr-730
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (Schneider 2) - Receptor-binding domain monomer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- VNLTTR (6aa)
- QCVNLTTR (8aa)
- SNVTWF (6aa)
- FSNVTWF (7aa)
- P0DTC2 Asn-61 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-61 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-61 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FSNVTW (6aa)
- FSNVTWFHAIHVSGTNGTK (19aa)
- FHAIHVSGTNGTKRF (15aa)
- HAIHVSGTNGTKRFDNPVLPF (21aa)
- FHAIHVSGTNGTK (13aa)
- FHAIHVSGTNGTKR (14aa)
- HAIHVSGTNGTKR (13aa)
- AIHVSGTNGTKRF (13aa)
- HAIHVSGTNGTKRF (14aa)
- P0DTC2 Thr-73 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-74 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-74 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VTWFHAIHVSGTNGTK (16aa)
- P0DTC2 Thr-73 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-63 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- HAIHVSGTNGTK (12aa)
- P0DTC2 Thr-73 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-74 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Ser-71 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-73 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Ser-71 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VSGTNGTKRF (10aa)
- P0DTC2 Thr-73 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-76 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- ASTEKSNIIRGW (12aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- LIVNNATNVVIKVCEF (16aa)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- SLLIVNNATNVVIK (14aa)
- IVNNATNVVIKVCEF (15aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-124 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- HKNNK (5aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- YHKNNKSWMESEF (13aa)
- HKNNKSWMESEF (12aa)
- VYSSANNCTFEY (12aa)
- SSANNCTFEYVSQPF (15aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VYSSANNCTFE (11aa)
- VYSSANNCTF (10aa)
- VYSSANNCTFEYVSQPFLMDLEGK (24aa)
- SALEPLVDLPIGINITRFQTL (21aa)
- SALEPLVDLPIGINITRFQTLL (22aa)
- SALEPLVDLPIGINITRF (18aa)
- GINIT (5aa)
- VDLPIGINITR (11aa)
- PLVDLPIGINITR (13aa)
- SALEPLVDLPIGINITR (17aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- SALEPLVDLPIGINIT (16aa)
- VDLPIGINIT (10aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- NGTITDAVDCALDPLSETK (19aa)
- NGTITDAVDCALDPLSE (17aa)
- YNENGTITDAVDCALDPLSE (20aa)
- TVEKGIYQTSNF (12aa)
- RVQPTESIVR (10aa)
- VQPTESIVR (9aa)
- FPNIT (5aa)
- FPNITNLCPF (10aa)
- RVQPTESIVRFPNITNLCPFGEVF (24aa)
- FPNITNL (7aa)
- VQPTESIVRFPNITN (15aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- RVQPTESIVRFPNITNL (17aa)
- P0DTC2 Thr-333 Recombinant Spike glycoprotein (Schneider 2) - Receptor-binding domain monomer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-323 Recombinant Spike glycoprotein (Schneider 2) - Receptor-binding domain monomer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- RVQPTESIVRFPNITNLCPF (20aa)
- GIYQTSNFRVQPTESIVR (18aa)
- GEVFNATRF (9aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NATRF (5aa)
- CPFGEVFNATR (11aa)
- GEVFNATRFASVY (13aa)
- NATRFASVY (9aa)
- VIRGDEVRQIAPGQTGKI (18aa)
- TPCNGVEGFNCY (12aa)
- HAPATVCGPKKSTNL (15aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- VITPGTNTS (9aa)
- GGVSVITPGTNTSNQVAVL (19aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- YQDVNCTEVPVAIHADQL (18aa)
- QDVNCTEVPVAIHADQL (17aa)
- NCTEVPVAIHADQLTPTWR (19aa)
- NCTEVPVAIHADQL (14aa)
- AGCLIGAEHVNNSY (14aa)
- NNSYECDIPI (10aa)
- AGCLIGAEHVNNSYE (15aa)
- HVNNSYE (7aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSP (35aa)
- CDIPIGAGICASYQTQTNSPAR (22aa)
- QTQTNSPARAA (11aa)
- QTQTNSPARAASVASQSIIAY (21aa)
- QTQTNSPGSASSVASQ (16aa)
- P0DTC2 Thr-678 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- 682:RRAR→GSAS
- P0DTC2 Thr-676 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- 682:RRAR→GSAS
- QTQTNSPGSASSVASQSIIAY (21aa)
- P0DTC2 Thr-678 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- 682:RRAR→GSAS
- P0DTC2 Thr-676 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- 682:RRAR→GSAS
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEIL (36aa)
- YSNNSIAIPT (10aa)
- YSNNSIA (7aa)
- SIIAYTMSLGAENSVAYSN (19aa)
- SNNSIAIPT (9aa)
- AYSNNSIAIPTNFTISVTTEILPVSMTK (28aa)
- SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTK (43aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSN (60aa)
- SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTEC (59aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM (40aa)
- SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGS (68aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIA (80aa)
- SNNSIAIPTNFTISVTTEILPVSMTK (26aa)
- TNFTISVTTEILPVSMTK (18aa)
- NSIAIPTNFTISVTTEILPVSMTK (24aa)
- NFTIS (5aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQL (72aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMT (41aa)
- SNNSIAIPTNF (11aa)
- NFTISVTTEILPVSMTK (17aa)
- IPTNFTISVTTEILPVSMTK (20aa)
- LGIQPTLGPPNQP (13aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- NFNFSQILPDPSKPSKR (17aa)
- NFSQILPDPSKPSK (14aa)
- NFSQILPDPSKPS (13aa)
- DFGGFNFSQILPDPSK (16aa)
- FGGFNFSQILPDPSKPSKR (19aa)
- NFSQILPDPSKPSKR (15aa)
- FGGFNFSQILPDPSKPSK (18aa)
- NFSQILPDPSKPSKRSF (17aa)
- VPAQEKNFTTAPA (13aa)
- NFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQ (33aa)
- VPAQEKNF (8aa)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VTYVPAQEKNFTTAPAICHDGK (22aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAP (6aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDG (40aa)
- PAQEKNFTTAPAICHDGKAHFPR (23aa)
- KNFTTAPAICHDGK (14aa)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1076 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1077 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VVFLHVTYVPAQEKNFTTAPAICHDGKAHFPR (32aa)
- NFTTAPAICHDGKAHFPR (18aa)
- NFTTAPAICHDGKA (14aa)
- VPAQEKNFTTAPAICH (16aa)
- NFTTAPAICHDGK (13aa)
- HVTYVPAQEKNF (12aa)
- VPAQEKNFTTAPAICHDGKAHFPREGVF (28aa)
- AQEKNFTTAPAICHDGKAHFPREGVF (26aa)
- P0DTC2 Thr-1076 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1077 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1076 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1077 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- EGVFVSNGTHW (11aa)
- AHFPREGVFVSNGTHWFVT (19aa)
- EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPE (53aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (55aa)
- EGVFVSNGTHWF (12aa)
- EGVFVSNGTHWFVTQRNFYEPQIITT (26aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVS (37aa)
- AHFPREGVFVSNGTHW (16aa)
- EGVFVSN (7aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (50aa)
- GVFVSNGTHWFVTQR (15aa)
- P0DTC2 Asn-1098 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1098 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Ser-1097 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- EGVFVSNGTHWFVTQRN (17aa)
- AHFPREGVFVSNGT (14aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP (54aa)
- VSNGTHWFVTQR (12aa)
- EGVFVSNGTHWFVTQRNFYEPQIITTDN (28aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- P0DTC2 Thr-1100 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1098 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Ser-1097 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- IGIVNNT (7aa)
- IVNNT (5aa)
- KNH (3aa)
- KYFKNHTS (8aa)
- KNHTSPDVDLGDISGINASVVNIQK (25aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- P0DTC2 Asn-1173 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1158 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1174 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1159 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- GINASVV (7aa)
- GINAS (5aa)
- KNLNE (5aa)
- KNLNES (6aa)
- KNLN (4aa)
- NLNESLIDLQELGK (14aa)
- NLNESLIDLQELGKYEQYIK (20aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1114.0275)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1260.1705)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1315.0972)
- CHO (CVCL_0213)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- KNFTTAPAICHDGK (14aa)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1076 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-1077 Recombinant Spike glycoprotein (Schneider 2) - ectodomain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1074 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1317.2225)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1520.4175)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
-
- N-Linked / Complex
(avg mass : 1568.4559)
- BTI-Tn-5B1-4 (CVCL_C190)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- P0DTC2 Asn-1173 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1158 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1174 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-1159 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1625.5079)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1625.5079)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1625.5079)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1682.5599)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1713.5708)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1723.6125)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1771.6509)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1771.6509)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1787.6503)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1787.6503)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1787.6503)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1828.7029)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1828.7029)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1828.7029)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1828.7029)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1828.7029)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1844.7023)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 1844.7023)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1869.7555)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1885.7549)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1916.7658)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1916.7658)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1932.7652)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1932.7652)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSETK (19aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1933.7933)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-343 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1933.7933)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1933.7933)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1957.8184)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Thr-114 Recombinant Spike glycoprotein (HEK293-F) - ectodomain trimer / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-122 Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- N-Linked / Complex
(avg mass : 1973.8178)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1974.8459)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1974.8459)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1973.8178)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1957.8184)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1933.7933)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1933.7933)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1933.7933)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1932.7652)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1916.7658)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1885.7549)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1869.7555)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1844.7023)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1828.7029)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1787.6503)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1771.6509)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1771.6509)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1723.6125)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1713.5708)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1682.5599)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1625.5079)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1568.4559)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1520.4175)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1317.2225)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1315.0972)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1260.1705)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)