taxonomy (2)
protein (10)
source (3)
structure (1)
composition (1)
disease (3)
reference (3)
site (11)
peptide (10)
- Complement factor h / Homo sapiens P08603
- Decorin / Homo sapiens P07585
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Histidine-rich glycoprotein / Homo sapiens P04196
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Polypeptide N-acetylgalactosaminyltransferase 3 / Homo sapiens Q14435
- Prothrombin / Homo sapiens P00734
- Serotransferrin / Homo sapiens P02787
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Hex:4 HexNAc:9 (avg mass : 2495.3399 )
Composition
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Oral squamous cell carcinoma (DOID:0050866)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
Reference
- Complement factor h / Homo sapiens
- Decorin / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Polypeptide N-acetylgalactosaminyltransferase 3 / Homo sapiens
- Prothrombin / Homo sapiens
- Serotransferrin / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- IADAHIDRVENTTVYYIVIDVQESDCSVISR (31aa)
- AEMNGSK (7aa)
- TTNLSVEEQK (10aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- LNLTTDPK (8aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- PLVDLPIGINITR (13aa)
- IININPNK (8aa)
- ISEENETTCYMGK (13aa)
Mass spectrometry observed peptide
-
- N-Linked / Undefined core (avg mass : 2495.3399)
- Blood Serum (UBERON_0001977)
- Prothrombin / Homo sapiens
-
- Hex:4 HexNAc:9 / N-Linked (avg mass : 2495.3399)
- N-Linked / Undefined core / HexNAc(??-?)HexNAc(??-?)[Hex(??-?)HexNAc(??-?)]Hex(??-?)[HexNAc(??-?)HexNAc(??-?)[HexNAc(??-?)HexNAc(??-?)]Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Complement factor h / Homo sapiens
- Decorin / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Polypeptide N-acetylgalactosaminyltransferase 3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Suggested structure
Reference
Reported glycosite
Source
Reported glycosite
