taxonomy (1)
protein (3)
source (2)
structure (0)
composition (1)
disease (2)
reference (2)
site (3)
peptide (3)
- Homo sapiens (Human)
Taxonomy
- Cathepsin D / Homo sapiens P07339
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Protein AMBP / Homo sapiens P02760
Protein
Reported structure
- Hex:11 HexNAc:11 NeuAc:1 (avg mass : 4327.9846 )
Composition
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Reference
- Cathepsin D / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Protein AMBP / Homo sapiens
Reported glycosite
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- GSISYINVTR (10aa)
- YKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICK (36aa)
Mass spectrometry observed peptide
-
- Hex:11 HexNAc:11 NeuAc:1 / N-Linked
(avg mass : 4327.9846)
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Cathepsin D / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Protein AMBP / Homo sapiens
- YFYNGTSMACETFQYGGCMGNGNNFVTEK (29aa)
- GSISYINVTR (10aa)
- YKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICK (36aa)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:11 HexNAc:11 NeuAc:1 / N-Linked
(avg mass : 4327.9846)