Hex:5 HexNAc:4

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis familiaris (Dog)
• Capra hircus (Goat)
• Cavia porcellus (Domestic guinea pig)
• Desmodus rotundus (Common vampire bat)
• Equus caballus (Domestic horse)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Bothrops moojeni (Brazilian lancehead)
• Friend mink cell focus-forming virus
• Friend murine leukemia virus (F-mulv)
• Friend spleen focus-forming virus
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Influenza a virus (strain a/fowl plague virus/rostock/34)
• Sendai virus (strain hvj)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• ADAMTS-like protein 2 / Homo sapiens    Q86TH1
• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Afamin / Homo sapiens    P43652
• Alkaline phosphatase, intestinal / Homo sapiens    P09923
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-1b-glycoprotein / Homo sapiens    P04217
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-fetoprotein / Homo sapiens    P02771
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Angiotensinogen / Homo sapiens    P01019
• Antithrombin-III / Homo sapiens    P01008
• Apolipoprotein b-100 / Homo sapiens    P04114
• Apolipoprotein d / Homo sapiens    P05090
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Band 4.1-like protein 3 / Homo sapiens    Q9Y2J2
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Bile-salt-activated lipase / Homo sapiens    P19835
• Bone morphogenetic protein receptor type-2 / Homo sapiens    Q13873
• Carboxypeptidase b2 / Homo sapiens    Q96IY4
• Cathepsin D / Homo sapiens    P07339
• CD166 antigen / Homo sapiens    Q13740
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P0DN86    P01215
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• Clusterin / Homo sapiens    P10909
• Coagulation factor x / Homo sapiens    P00742
• Coagulation factor XI / Homo sapiens    P03951
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Complement c4-a / Homo sapiens    P0C0L4
• Complement C4-B / Homo sapiens    P0C0L5
• Complement component C8 alpha chain / Homo sapiens    P07357
• Complement factor h / Homo sapiens    P08603
• Complement factor i / Homo sapiens    P05156
• Decorin / Homo sapiens    P07585
• Dipeptidase 1 / Homo sapiens    P16444
• Dynein heavy chain 11, axonemal / Homo sapiens    Q96DT5
• EGF-containing fibulin-like extracellular matrix protein 2 / Homo sapiens    O95967
• EMILIN-1 / Homo sapiens    Q9Y6C2
• Erythropoietin / Homo sapiens    P01588
• Erythropoietin - bi / Homo sapiens    P01588
• Erythropoietin - tetra / Homo sapiens    P01588
• Fibrillin-1 / Homo sapiens    P35555
• Fibrillin-2 / Homo sapiens    P35556
• Fibrillin-3 / Homo sapiens    Q75N90
• Fibrinogen / Homo sapiens    P02679    P02675    P02671
• Fibrinogen beta chain / Homo sapiens    P02675
• Fibrinogen gamma chain / Homo sapiens    P02679
• Fibronectin / Homo sapiens    P02751
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Histidine-rich glycoprotein / Homo sapiens    P04196
• Holliday junction recognition protein / Homo sapiens    Q8NCD3
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgG-IL2 fusion protein / Homo sapiens    P60568
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01860    P01859    P01861    P01857
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin j chain / Homo sapiens    P01591
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens    P19823
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon gamma / Homo sapiens    P01579
• Interleukin-18-binding protein / Homo sapiens    O95998
• Interstitial collagenase / Homo sapiens    P03956
• Kininogen-1 / Homo sapiens    P01042
• L-selectin / Homo sapiens    P14151
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-1 / Homo sapiens    P25391
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Microtubule-associated protein 10 / Homo sapiens    Q9P2G4
• Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens    O60566
• Neprilysin / Homo sapiens    P08473
• Neural cell adhesion molecule 1 / Homo sapiens    P13591
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens    P04180
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens    P80108
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Plasminogen / Homo sapiens    P00747
• Poliovirus receptor / Homo sapiens    P15151
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen galactosyltransferase 1 / Homo sapiens    Q8NBJ5
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prorenin / Homo sapiens    P00797
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein AMBP / Homo sapiens    P02760
• Prothrombin / Homo sapiens    P00734
• Pseudopodium-enriched atypical kinase 1 / Homo sapiens    Q9H792
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Recombinant plasminogen - [r580e] / Homo sapiens    P00750
• Recombinant plasminogen - [r580s] / Homo sapiens    P00750
• Serotransferrin / Homo sapiens    P02787
• Serum albumin / Homo sapiens    P02768
• Serum amyloid p-component / Homo sapiens    P02743
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sparc / Homo sapiens    P09486
• Sulfatase-modifying factor 2 / Homo sapiens    Q8NBJ7
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thyroxine-binding globulin / Homo sapiens    P05543
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens    P29965
• Uncharacterized protein from Fluid / Homo sapiens
• Uncharacterized protein from Meconium / Homo sapiens
• Uncharacterized protein from Serum / Homo sapiens
• Uromodulin / Homo sapiens    P07911
• Vacuolar protein sorting-associated protein 13A / Homo sapiens    Q96RL7
• Vasorin / Homo sapiens    Q6EMK4
• Vitronectin / Homo sapiens    P04004
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Alpha-1-acid glycoprotein / Bos taurus    Q3SZR3
• Alpha-2-hs-glycoprotein / Bos taurus    P12763
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Immunoglobulin gamma / Bos taurus
• Platelet glycoprotein IV / Bos taurus    P26201
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
• Alpha-1-acid glycoprotein / Canis familiaris    F6Y713
• Immunoglobulin gamma / Canis familiaris
• Immunoglobulin gamma / Capra hircus
• Factor b1 / Cavia porcellus
• Factor b2 / Cavia porcellus
• Immunoglobulin gamma / Cavia porcellus
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Immunoglobulin gamma / Equus caballus
• Uncharacterized protein from Dander / Equus caballus
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus    Q64676
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Brevican core protein / Mus musculus    Q61361
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cadherin-13 / Mus musculus    Q9WTR5
• Cadherin-6 / Mus musculus    P97326
• Carbonic anhydrase-related protein 10 / Mus musculus    P61215
• Carboxypeptidase D / Mus musculus    O89001
• Cell cycle control protein 50A / Mus musculus    Q8VEK0
• Contactin-1 / Mus musculus    P12960
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus    O55026
• Ephrin-A1 / Mus musculus    P52793
• Immunoglobulin gamma / Mus musculus
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Inactive dipeptidyl peptidase 10 / Mus musculus    Q6NXK7
• Integrin alpha-V / Mus musculus    P43406
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Isoform 3 of Neuroplastin / Mus musculus    P97300-3
• Isoform S-MAG of Myelin-associated glycoprotein / Mus musculus    P20917-2
• Laminin subunit gamma-1 / Mus musculus    P02468
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Leukemia inhibitory factor receptor / Mus musculus    P42703
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Lysosome-associated membrane glycoprotein 2 / Mus musculus    P17047
• Major urinary protein / Mus musculus
• Myelin-associated glycoprotein / Mus musculus    P20917
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neurofascin / Mus musculus    Q810U3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuroplastin / Mus musculus    P97300
• Neurotrimin / Mus musculus    Q99PJ0
• Noelin / Mus musculus    O88998
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Plexin-A1 / Mus musculus    P70206
• Plexin-B1 / Mus musculus    Q8CJH3
• Plexin-B2 / Mus musculus    B2RXS4
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prostaglandin-H2 D-isomerase / Mus musculus    O09114
• Protocadherin-9 / Mus musculus    A0A0A6YY09
• Rho-associated protein kinase 2 / Mus musculus    P70336
• Roundabout homolog 2 / Mus musculus    Q7TPD3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• SPARC-like protein 1 / Mus musculus    P70663
• Tenascin-r / Mus musculus    Q8BYI9
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Uncharacterized protein from Ascites / Mus musculus
• Uncharacterized protein from B-Lymphocyte / Mus musculus
• Uncharacterized protein from B-Lymphocyte (Peripheral) / Mus musculus
• Uncharacterized protein from Plasma Membrane / Mus musculus
• Uncharacterized protein from T-Lymphocyte / Mus musculus
• Uncharacterized protein from T-Lymphocyte (Peripheral) / Mus musculus
• Uncharacterized protein from T-Lymphocyte (Stimulated) / Mus musculus
• Zinc transporter ZIP10 / Mus musculus    Q6P5F6
• Brain non dialyzable glycopeptide / Oryctolagus cuniculus
• Immunoglobulin gamma / Oryctolagus cuniculus
• Alpha-1-acid glycoprotein / Ovis aries    W5P7S6
• Immunoglobulin gamma / Ovis aries
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Alpha-1-acid glycoprotein / Rattus norvegicus    P02764
• Immunoglobulin gamma / Rattus norvegicus
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Thy-1 membrane glycoprotein / Rattus norvegicus
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Coagulation factor VIII / Sus scrofa    P12263
• Immunoglobulin gamma / Sus scrofa
• Immunoglobulin y / Coturnix coturnix japonica
• Immunoglobulin y / Gallus gallus
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus
• Acetylcholine receptor protein / Torpedo californica    P02712    P02718    P02710    P02714
• Batroxobin / Bothrops moojeni
• Knob protein gp70 / Friend mink cell focus-forming virus
• Knob protein gp70 / Friend murine leukemia virus    P03395
• Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus    P03393
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459
• Fusion glycoprotein / Sendai virus (strain hvj)    P04855
• Hemagglutinin-neuraminidase / Sendai virus (strain hvj)    P04853
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Allantois (UBERON_0004340)  
• Amnion (UBERON_0000305)   FL (CVCL_1905)  
• Blood (UBERON_0000178)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Body Fluid (UBERON_0006314)   EL4 (CVCL_0255)  
• Body Fluid (UBERON_0006314)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Dander  
• Electric Organ (UBERON_0006869)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK-21A (CVCL_RQ70)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Lung (UBERON_0002048)   Mv1Lu (CVCL_0593)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Milk (UBERON_0001913)   Plasma Membrane (GO_0005886)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO B8-300 (CVCL_VU03)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Ovary (UBERON_0000992)   CHO-K1 (CVCL_0214)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/IV (CVCL_VT64)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/Vh (CVCL_VT65)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)   JEG-3 (CVCL_0363)   Epithelium (CL_0002577)  
• Placenta (UBERON_0001987)  
• Pleura (UBERON_0000977)   K-562 (CVCL_0004)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Skin of Body (UBERON_0002097)   Fibroblast (CL_0000057)  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• BW5147 (CVCL_3896)   T-Lymphocyte (CL_0000084)  
• CE (CVCL_6D96)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• IZD-MB-0503 (CVCL_C411)   Hemocyte (CL_0000387)  
• J558L (CVCL_3949)  
• Jurkat (CVCL_0065)  
• NIH 3T3 (CVCL_0594)   Fibroblast (CL_0000057)  
• P3X63Ag8U.1 (CVCL_3412)  
• Rat1 (CVCL_0492)  
• WEHI-231 (CVCL_0577)   B-Lymphocyte (CL_0000236)  
• B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Fibroblast (CL_0000057)  
• Leukocyte (CL_0000738)  
• Lymphocyte (CL_0000542)  
• T-Lymphocyte (CL_0000084)  
• Cerebrospinal Fluid Secretion (GO_0033326)  
• Low-Density Lipoprotein Particle (GO_0034362)  
• Plasma Membrane (GO_0005886)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(?1-4)GlcNAc(?1-2)Man(a1-3)[Gal(?1-4)GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)Man(a1-3)[Gal(b1-3)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[Gal(b1-3)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Gal(b1-4)GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:5 HexNAc:4 (avg mass : 1641.5073 )

Disease

• Anemia, Aplastic (DOID:12449)
• Arthritis (DOID:848)
• Arthritis, Rheumatoid (DOID:7148)
• Cancer, breast (DOID:1612)
• Carcinoma (DOID:305)
• Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
• Carcinoma, Hepatocellular (DOID:684)
• Choriocarcinoma (DOID:3594)
• Choriocarcinoma, with Hyperthyroidism
• COVID-19 (DOID:0080600)
• Cystic Fibrosis (DOID:1485)
• Diabetes Mellitus (DOID:9351)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Erythroleukemia with associated Polycythemia
• Gangliosidosis GM1 (DOID:3322)
• Gaucher Disease (DOID:1926)
• Healthy
• Heavy Chain Disease (DOID:0060125)
• Hydatidiform Mole (DOID:3590)
• Hydatidiform Mole, Invasive (DOID:3590)
• Hypercholesterolemia, Familial (DOID:13810)
• Hyperimmune condition
• Leukemia, Acute lymphoblastic (DOID:9952)
• Leukemia, Myloid, Chronic (DOID:8552)
• Lymphoma, Lymphoblastic (DOID:0080147)
• Lymphoma, Thymic (DOID:10146)
• Malignant material
• Melanoma (DOID:1909)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)
• Waldenstrom Macroglobulinaemia (DOID:0060901)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
• N-glycosylation potential of maize: the human lactoferrin used as a model. (2001 - Samyn-Petit B, Gruber V, Flahaut C, Wajda-Dubos JP, Farrer S, Pons A, Desmaizieres G, Slomianny MC, Theisen M, Delannoy P) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
• Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
• Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
• Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
• Structural characterization of the N-linked oligosaccharides in bile salt-stimulated lipase originated from human breast milk. (1999 - Mechref Y, Chen P, Novotny M) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
• Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum. (1998 - Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K) / Status : Reviewed
• Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
• Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
• Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
• Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
• Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Reducing-end modification of N-linked oligosaccharides with tyrosine. (1994 - Tamura T, Wadhwa M, Rice K) / Status : Reviewed
• Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Alteration of asparagine-linked glycosylation in serum transferrin of patients with hepatocellular carcinoma. (1994 - Matsumoto K, Maeda Y, Kato S, Yuki H) / Status : Reviewed
• Characterization of a single glycosylated asparagine site on a glycopeptide using solid-phase Edman degradation. (1994 - Gooley A, Pisano A, Packer N, Ball M, Jones A, Alewood P, Redmond J, Williams K) / Status : Reviewed
• Human serum amyloid P component is an invariant constituent of amyloid deposits and has a uniquely homogeneous glycostructure. (1994 - Pepys M, Rademacher T, Amatayakul-Chantler S, Williams P, Noble G, Hutchinson W, Hawkins P, Nelson S, Gallimore J, Herbert J) / Status : Reviewed
• Structural analysis on the sugar chains of human alpha 1-antitrypsin: presence of fucosylated biantennary glycan in hepatocellular carcinoma. (1993 - Saitoh A, Aoyagi Y, Asakura H) / Status : Reviewed
• Identification, quantification, and characterization of glycopeptides in reversed-phase HPLC separations of glycoprotein proteolytic digests. (1993 - Rohrer J, Cooper G, Townsend R) / Status : Reviewed
• Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
• Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
• Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
• Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
• Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
• Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
• Cell type and maturation stage-dependent polymorphism of N-linked oligosaccharides on murine lymphocytes and lymphoma cells. (1991 - Yoshida T, Takahashi N, Nakashima I) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
• Large-scale preparation and characterization of N-linked glycopeptides from bovine fetuin. (1990 - Rice K, Rao N, Lee Y) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharides of guinea-pig factor B of the alternative complement pathway. (1990 - Mizuochi T, Hamako J, Titani K, Matsushita M, Okada H) / Status : Reviewed
• Additional fucosyl residues on membrane glycoproteins but not a secreted glycoprotein from cystic fibrosis fibroblasts. (1990 - Wang YM, Hare TR, Won B, Stowell CP, Scanlin TF, Glick MC, Hård K, van Kuik JA, Vliegenthart JF) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
• Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
• Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
• Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Resolution of some glycopeptides of hen ovalbumin by reverse-phase high-pressure liquid chromatography. (1984 - Dua V, Bush C) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• Carbohydrate structure of human fibrinogen. Use of 300-MHz 1H-NMR to characterize glycosidase-treated glycopeptides. (1982 - Townsend RR, Hilliker E, Li Y-T, Laine RA, Bell WR, Lee YC) / Status : Reviewed
• The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
• Comparative study of the carbohydrate moieties of rat and human plasma alpha 1-acid glycoproteins. (1981 - Yoshima H, Matsumoto A, Mizuochi T, Kawasaki T, Kobata A) / Status : Reviewed
• Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
• The application of 500-MHz H-NMR spectroscopy for the structure elucidation of N-acetyllactosamine type asparagine-bound carbohydrate chains of glycoproteins. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Schmid K, Montreuil J, Fournet B, Hull W) / Status : Reviewed
• Structural studies of the sugar chains of cold-insoluble globulin isolated from human plasma. (1980 - Takasaki S, Yamashita K, Suzuki K, Kobata A) / Status : Reviewed
• Structure of the oligosaccharide of human J chain. (1979 - Baenziger J) / Status : Reviewed
• Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed
• The carbohydrate units of ovalbumin: complete structures of three glycopeptides (1978 - Conchie J, Strachan I) / Status : Reviewed

Reported glycosite

• ADAMTS-like protein 2 / Homo sapiens
  •        Asn-731
• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-922
• Afamin / Homo sapiens
  •        Asn-33
  •        Asn-109
  •        Asn-383
  •        Asn-402
• Alkaline phosphatase, intestinal / Homo sapiens
  •        Undefined site
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-72
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Undefined site
  •        Asn-33
• Alpha-1-antitrypsin / Homo sapiens
  •        Undefined site
  •        Asn-70
  •        Asn-107
  •        Asn-271
• Alpha-1b-glycoprotein / Homo sapiens
  •        Asn-44
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-410
• Alpha-fetoprotein / Homo sapiens
  •        Undefined site
  •        Asn-251
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Angiotensinogen / Homo sapiens
  •        Asn-47
• Antithrombin-III / Homo sapiens
  •        Asn-187
• Apolipoprotein b-100 / Homo sapiens
  •        Undefined site
  •        Asn-1523
  •        Asn-3411
  •        Asn-3465
• Apolipoprotein d / Homo sapiens
  •        Asn-65
  •        Asn-98
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-863
• Band 4.1-like protein 3 / Homo sapiens
  •        Asn-734
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
  •        Asn-253
• Biglycan / Homo sapiens
  •        Asn-270
• Bile-salt-activated lipase / Homo sapiens
  •        Undefined site
  •        Asn-207
• Bone morphogenetic protein receptor type-2 / Homo sapiens
  •        Asn-827
• Carboxypeptidase b2 / Homo sapiens
  •        Asn-108
• Cathepsin D / Homo sapiens
  •        Asn-134
• CD166 antigen / Homo sapiens
  •        Asn-167
• CD59 glycoprotein / Homo sapiens
  •        Undefined site
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-358
  •        Asn-397
  •        Asn-762
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Choriogonadotropin beta chain / Homo sapiens
  •        Undefined site
• Clusterin / Homo sapiens
  •        Asn-374
• Coagulation factor x / Homo sapiens
  •        Asn-221
  •        Asn-231
• Coagulation factor XI / Homo sapiens
  •        Asn-491
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
  •        Asn-785
• Complement c4-a / Homo sapiens
  •        Asn-1391
• Complement C4-B / Homo sapiens
  •        Asn-1391
• Complement component C8 alpha chain / Homo sapiens
  •        Asn-437
• Complement factor h / Homo sapiens
  •        Asn-529
  •        Asn-718
  •        Asn-882
  •        Asn-911
  •        Asn-1029
  •        Asn-1095
• Complement factor i / Homo sapiens
  •        Asn-103
  •        Asn-177
• Decorin / Homo sapiens
  •        Asn-211
• Dipeptidase 1 / Homo sapiens
  •        Asn-332
• Dynein heavy chain 11, axonemal / Homo sapiens
  •        Asn-3201
• EGF-containing fibulin-like extracellular matrix protein 2 / Homo sapiens
  •        Asn-198
• EMILIN-1 / Homo sapiens
  •        Asn-794
• Erythropoietin / Homo sapiens
  •        Undefined site
• Erythropoietin - bi / Homo sapiens
  •        Undefined site
• Erythropoietin - tetra / Homo sapiens
  •        Undefined site
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Fibrillin-2 / Homo sapiens
  •        Asn-1112
• Fibrillin-3 / Homo sapiens
  •        Asn-1025
• Fibrinogen / Homo sapiens
  •        Undefined site
• Fibrinogen beta chain / Homo sapiens
  •        Undefined site
  •        Asn-394
• Fibrinogen gamma chain / Homo sapiens
  •        Undefined site
  •        Asn-78
• Fibronectin / Homo sapiens
  •        Undefined site
  •        Asn-430
  •        Asn-528
  •        Asn-542
  •        Asn-1236
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-187
  •        Asn-453
• Histidine-rich glycoprotein / Homo sapiens
  •        Asn-125
• Holliday junction recognition protein / Homo sapiens
  •        Asn-231
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-931
• IgG-IL2 fusion protein / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-49
  •        Asn-99
  •        Asn-146
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
• Immunoglobulin j chain / Homo sapiens
  •        Asn-49
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
  •        Asn-118
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interleukin-18-binding protein / Homo sapiens
  •        Asn-103
• Interstitial collagenase / Homo sapiens
  •        Undefined site
• Kininogen-1 / Homo sapiens
  •        Asn-48
  •        Asn-169
  •        Asn-205
  •        Asn-294
• L-selectin / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-497
• Laminin subunit alpha-1 / Homo sapiens
  •        Asn-2098
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-2126
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-104
  •        Asn-215
  •        Asn-557
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1022
  •        Asn-1107
  •        Asn-1241
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-378
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-186
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2500
• Microtubule-associated protein 10 / Homo sapiens
  •        Asn-694
• Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
  •        Asn-983
• Neprilysin / Homo sapiens
  •        Asn-145
• Neural cell adhesion molecule 1 / Homo sapiens
  •        Asn-347
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Periostin / Homo sapiens
  •        Asn-599
• Phosphatidylcholine-sterol acyltransferase / Homo sapiens
  •        Undefined site
• Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
  •        Asn-659
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-25
  •        Asn-352
• Plasminogen / Homo sapiens
  •        Asn-308
• Poliovirus receptor / Homo sapiens
  •        Asn-120
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-90
  •        Asn-186
  •        Asn-469
• Procollagen galactosyltransferase 1 / Homo sapiens
  •        Asn-381
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-1645
  •        Asn-4075
• Prorenin / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein AMBP / Homo sapiens
  •        Asn-115
  •        Asn-250
• Prothrombin / Homo sapiens
  •        Asn-121
  •        Asn-143
  •        Asn-416
• Pseudopodium-enriched atypical kinase 1 / Homo sapiens
  •        Asn-589
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
  •        Asn-380
  •        Asn-421
• Recombinant plasminogen - [r580e] / Homo sapiens
  •        Undefined site
• Recombinant plasminogen - [r580s] / Homo sapiens
  •        Undefined site
• Serotransferrin / Homo sapiens
  •        Undefined site
  •        Asn-158
  •        Asn-432
  •        Asn-630
• Serum albumin / Homo sapiens
  •        Asn-518
• Serum amyloid p-component / Homo sapiens
  •        Asn-51
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sparc / Homo sapiens
  •        Asn-116
• Sulfatase-modifying factor 2 / Homo sapiens
  •        Asn-191
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
  •        Asn-296
  •        Asn-325
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
  •        Asn-1069
• Thyroxine-binding globulin / Homo sapiens
  •        Asn-36
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Serum / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-275
• Vacuolar protein sorting-associated protein 13A / Homo sapiens
  •        Asn-1071
• Vasorin / Homo sapiens
  •        Asn-117
• Vitronectin / Homo sapiens
  •        Asn-86
  •        Asn-169
  •        Asn-242
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Alpha-1-acid glycoprotein / Bos taurus
  •        Undefined site
• Alpha-2-hs-glycoprotein / Bos taurus
  •        Undefined site
  •        Asn-99
  •        Asn-156
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
  •        Undefined site
• Alpha-1-acid glycoprotein / Canis familiaris
  •        Undefined site
• Immunoglobulin gamma / Canis familiaris
  •        Undefined site
• Immunoglobulin gamma / Capra hircus
  •        Undefined site
• Factor b1 / Cavia porcellus
  •        Undefined site
• Factor b2 / Cavia porcellus
  •        Undefined site
• Immunoglobulin gamma / Cavia porcellus
  •        Undefined site
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Immunoglobulin gamma / Equus caballus
  •        Undefined site
• Uncharacterized protein from Dander / Equus caballus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
  •        Asn-442
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-95
  •        Asn-241
• Brevican core protein / Mus musculus
  •        Asn-129
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Cadherin-13 / Mus musculus
  •        Asn-638
• Cadherin-6 / Mus musculus
  •        Asn-399
• Carbonic anhydrase-related protein 10 / Mus musculus
  •        Asn-116
• Carboxypeptidase D / Mus musculus
  •        Asn-625
• Cell cycle control protein 50A / Mus musculus
  •        Asn-297
• Contactin-1 / Mus musculus
  •        Asn-494
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-436
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
  •        Asn-129
• Ephrin-A1 / Mus musculus
  •        Asn-26
• Immunoglobulin gamma / Mus musculus
  •        Undefined site
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-325
• Inactive dipeptidyl peptidase 10 / Mus musculus
  •        Asn-343
• Integrin alpha-V / Mus musculus
  •        Asn-74
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-580
• Isoform 3 of Neuroplastin / Mus musculus
  •        Asn-112
• Isoform S-MAG of Myelin-associated glycoprotein / Mus musculus
  •        Asn-99
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1393
• Leucyl-cystinyl aminopeptidase / Mus musculus
  •        Asn-215
• Leukemia inhibitory factor receptor / Mus musculus
  •        Asn-402
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-109
• Lysosome-associated membrane glycoprotein 2 / Mus musculus
  •        Asn-115
• Major urinary protein / Mus musculus
  •        Undefined site
• Myelin-associated glycoprotein / Mus musculus
  •        Asn-99
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
  •        Asn-478
  •        Asn-875
• Neurofascin / Mus musculus
  •        Asn-446
  •        Asn-838
  •        Asn-866
  •        Asn-1026
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
• Neuroplastin / Mus musculus
  •        Asn-196
• Neurotrimin / Mus musculus
  •        Asn-305
• Noelin / Mus musculus
  •        Asn-473
• Oligodendrocyte-myelin glycoprotein / Mus musculus
  •        Asn-234
• Plexin-A1 / Mus musculus
  •        Asn-1041
• Plexin-B1 / Mus musculus
  •        Asn-543
• Plexin-B2 / Mus musculus
  •        Asn-735
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-447
  •        Asn-1512
  •        Asn-3090
  •        Asn-3954
• Prostaglandin-H2 D-isomerase / Mus musculus
  •        Asn-51
• Protocadherin-9 / Mus musculus
  •        Asn-450
• Rho-associated protein kinase 2 / Mus musculus
  •        Asn-791
• Roundabout homolog 2 / Mus musculus
  •        Asn-793
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-54
  •        Asn-92
  •        Asn-110
  •        Asn-168
  •        Asn-246
  •        Asn-271
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-153
• SPARC-like protein 1 / Mus musculus
  •        Asn-462
• Tenascin-r / Mus musculus
  •        Undefined site
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-94
  •        Asn-118
• Uncharacterized protein from Ascites / Mus musculus
  •        Undefined site
• Uncharacterized protein from B-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from B-Lymphocyte (Peripheral) / Mus musculus
  •        Undefined site
• Uncharacterized protein from Plasma Membrane / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte (Peripheral) / Mus musculus
  •        Undefined site
• Uncharacterized protein from T-Lymphocyte (Stimulated) / Mus musculus
  •        Undefined site
• Zinc transporter ZIP10 / Mus musculus
  •        Asn-341
• Brain non dialyzable glycopeptide / Oryctolagus cuniculus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Alpha-1-acid glycoprotein / Ovis aries
  •        Undefined site
• Immunoglobulin gamma / Ovis aries
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Alpha-1-acid glycoprotein / Rattus norvegicus
  •        Undefined site
• Immunoglobulin gamma / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Thy-1 membrane glycoprotein / Rattus norvegicus
  •        Undefined site
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Coagulation factor VIII / Sus scrofa
  •        Undefined site
• Immunoglobulin gamma / Sus scrofa
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site
• Knob protein gp70 / Friend mink cell focus-forming virus
  •        Undefined site
• Knob protein gp70 / Friend murine leukemia virus
  •        Asn-12
• Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
  •        Undefined site
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
  •        Asn-46
  •        Asn-496
• Fusion glycoprotein / Sendai virus (strain hvj)
  •        Undefined site
• Hemagglutinin-neuraminidase / Sendai virus (strain hvj)
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-657

Mass spectrometry observed peptide

• HIVFWNSSNPK (11aa)
  •    P52793    Asn-26
• DIENFNSTQK (10aa)
  •    P43652    Asn-33
• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33
• VTACHSSQPNATLYK (15aa)
  •    P05543    Asn-36
• HLVIHNESTCEQLAK (15aa)
  •    P01019    Asn-47
• VYIHPFHLVIHNESTCEQLAK (21aa)
  •    P01019    Asn-47
• WYSAGLASNSSWFR (14aa)
  •    O09114    Asn-51
• SVSVAAGDSTVLNCTLTSLLPVGPIR (26aa)
  •    P97797    Asn-54
• CSDGWSFDATTLDDNGTMLFFK (22aa)
  •    P02790    Asn-64
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• ANTTQPGIVEGGQVLK (16aa)
  •    P43406    Asn-74
• DLQSLEDILHQVENK (15aa)
  •    P02679    Asn-78
• NNATVHEQVGGPSLTSDLQAQSK (23aa)
  •    P04004    Asn-86
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• IRNVSDTTK (9aa)
  •    P97797    Asn-92
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92
• VLTLANFTTK (10aa)
  •    P01831    Asn-94
• NLTIVDSGLK (10aa)
  •    P15209    Asn-95
• NCTLLLSTLSPELGGK (16aa)
  •    P20917    Asn-99
• LLGDLGLRNCTLLLSTLSPELGGK (24aa)
  •    P20917-2    Asn-99
• NTTGEHCEK (9aa)
  •    Q16363    Asn-104
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109
• DIVEYYNDSNGSHVLQGR (18aa)
  •    P25311    Asn-109
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109
• ISNVTPADAGIYYCVK (16aa)
  •    P97797    Asn-110
• ANATIEVK (8aa)
  •    P97300-3    Asn-112
• EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
  •    P17047    Asn-115
• VCSNDNK (7aa)
  •    P09486    Asn-116
• LDKEHLVNISGGPMTYSHR (19aa)
  •    P61215    Asn-116
• DEGDYFCELQVSGANPMSSNK (21aa)
  •    P01831    Asn-118
• GHVNITR (7aa)
  •    P00734    Asn-121
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• VIDFNCTTSSVSSALANTK (19aa)
  •    P04196    Asn-125
• VIDFNCTTSSVSSAIANTK (19aa)
  •    P04196    Asn-125
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• VALPAYPASLTDVSLVLSELRPNDSGVYR (29aa)
  •    Q61361    Asn-129
• LLNLTSPEATAK (12aa)
  •    O55026    Asn-129
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143
• SCINESAIDSR (11aa)
  •    P08473    Asn-145
• ACQFNR (6aa)
  •    P14231    Asn-153
• RACQFNR (7aa)
  •    P14231    Asn-153
• KVCQDCPLLAPLNDTR (16aa)
  •    P02765    Asn-156
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-158
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• IGDCISEDSYPDGNITWYR (19aa)
  •    Q13740    Asn-167
• GIPDQKVNFTCK (12aa)
  •    P97797    Asn-168
• VNFTCK (6aa)
  •    P97797    Asn-168
• NGSLFAFR (8aa)
  •    P04004    Asn-169
• NAQNNGSNFQLEEISR (16aa)
  •    P02765    Asn-176
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• LSDLSINSTECLHVHCR (17aa)
  •    P05156    Asn-177
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• MVSHHNITTGATIINEQWIITTAK (24aa)
  •    P00738    Asn-184
• MVSHHNLTTGATLINEQWLLTTAK (24aa)
  •    P00738    Asn-184
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187
• GQVYPWGNWFQPNR (14aa)
  •    Q8NBJ7    Asn-191
• NASNMEYR (8aa)
  •    P97300    Asn-196
• CQCEPGFQLGPNNR (14aa)
  •    O95967    Asn-198
• LKGEAEYQEIRNPNGTVTVISR (22aa)
  •    Q9JKF6    Asn-202
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• DIILHSTGHNISR (13aa)
  •    Q8C129    Asn-215
• NTTGFK (6aa)
  •    Q16363    Asn-215
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217
• EEQYNSTFR (9aa)
  •    P01860    Asn-227
• NDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSR (43aa)
  •    Q8NCD3    Asn-231
• QNITYLLK (8aa)
  •    Q63912    Asn-234
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241
• HMNETSHTQGSLR (13aa)
  •    P15209    Asn-241
• VVIHPNYSQVDIGIIK (16aa)
  •    P00738    Asn-241
• GIANLSNFIR (10aa)
  •    P97797    Asn-246
• IGNWSAMPSCK (11aa)
  •    P02749    Asn-253
• LGNWSAMPSCK (11aa)
  •    P02749    Asn-253
• IININPNK (8aa)
  •    P11279    Asn-261
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271
• VTQQSPTSMNQVNLTCR (17aa)
  •    P97797    Asn-271
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• LNAENNATFYFK (12aa)
  •    P01042    Asn-294
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• DDLHPTLPAGQYFLNITYNYPVHSFDGR (28aa)
  •    Q8VEK0    Asn-297
• LGHTNASIMLFEVK (14aa)
  •    Q99PJ0    Asn-305
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307
• SAQTPHTHNR (10aa)
  •    P00747    Asn-308
• IGPGEPLELLCNVSGALPPPGR (22aa)
  •    Q8R366    Asn-325
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330
• FPNITNLCPFGEVFNATR (18aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• RNWTEAEVK (9aa)
  •    P16444    Asn-332
• DQSEDDRQHECLNVTQLLK (19aa)
  •    Q6P5F6    Asn-341
• SAIYSTPSHKDQSEDDRQHECLNVTQLLK (29aa)
  •    Q6P5F6    Asn-341
• WLNRPQNISILTLCESTTGACSR (23aa)
  •    Q6NXK7    Asn-343
• ASGDPIPSITWRTSTRNISSEE (22aa)
  •    P13591    Asn-347
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• FTNASK (6aa)
  •    P08575    Asn-380
• GNTTTLISENGHAADTLTATNFR (23aa)
  •    Q14766    Asn-378
• AMNTSQVEAIGIQMIPGYR (19aa)
  •    Q8NBJ5    Asn-381
• GTAGNAIMDGASQIMGENR (19aa)
  •    P02675    Asn-394
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397
• INTTIGSVAAQDPDAAR (17aa)
  •    P97326    Asn-399
• LGVQMHPGQEIHNFTLTGR (19aa)
  •    P42703    Asn-402
• SINTTNVMGTSLTVR (15aa)
  •    P01023    Asn-410
• SFHNFTLCYIK (11aa)
  •    P08575    Asn-421
• GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
  •    P02751    Asn-430
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• CGIVPVIAENYNK (13aa)
  •    P02787    Asn-432
• CGLVPVLAENYNK (13aa)
  •    P02787    Asn-432
• VGVHINNTQTK (11aa)
  •    Q9CPW0    Asn-436
• GGSSGWSGGLAQNR (14aa)
  •    P07357    Asn-437
• LSEIHKDQPGHPVNR (15aa)
  •    Q64676    Asn-442
• DQPGHPVNR (9aa)
  •    Q64676    Asn-442
• VILYNR (6aa)
  •    Q810U3    Asn-446
• VNRFNSTEYQVVTR (14aa)
  •    Q91ZX7    Asn-447
• IVASDSGKPSLNQTALVR (18aa)
  •    A0A0A6YY09    Asn-450
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453
• ILDQACGTDNQTYASSCHLFATK (23aa)
  •    P70663    Asn-462
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478
• LETTVNYTDSQRPICLPSK (19aa)
  •    P03951    Asn-491
• ANSTGTLVITNPTR (14aa)
  •    P12960    Asn-494
• CEGPGVPTVTVHNTTDKRR (19aa)
  •    Q9Z218    Asn-505
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505
• CEGPGVPTVTVHNTTDKR (18aa)
  •    Q9Z218    Asn-505
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• HEEGHMLNCTCFGQGR (16aa)
  •    P02751    Asn-542
• VVAVSPANISR (11aa)
  •    Q8CJH3    Asn-543
• NASGIYAEIDGAK (13aa)
  •    Q16363    Asn-557
• YIDKGNR (7aa)
  •    O08532-4    Asn-580
• NLSEIK (6aa)
  •    Q96DT5    Asn-3201
• NLSEIK (6aa)
  •    Q9P2G4    Asn-694
• NLSEIK (6aa)
  •    Q96RL7    Asn-1071
• NLSEIK (6aa)
  •    P25391    Asn-2098
• NLSEIK (6aa)
  •    O60566    Asn-983
• NLSEIK (6aa)
  •    Q9H792    Asn-589
• NLSEIK (6aa)
  •    P24043    Asn-2126
• NLSEIK (6aa)
  •    Q9Y2J2    Asn-734
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• NNSNNFDLNR (10aa)
  •    O89001    Asn-625
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630
• QQQHIFGSNVTDCSGNFCIFR (21aa)
  •    P02787    Asn-630
• INNTHALVSLLQNLNK (16aa)
  •    Q9WTR5    Asn-638
• ISKINNTHALVSLLQNLNK (19aa)
  •    Q9WTR5    Asn-638
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• LGTSLSSGHVLMNGTLK (17aa)
  •    P80108    Asn-659
• LCDPNTRPVGEKNCTGPPCDR (21aa)
  •    Q86TH1    Asn-731
• LSHDGNETLPLHLYVK (16aa)
  •    B2RXS4    Asn-735
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785
• NLTLK (5aa)
  •    P70336    Asn-791
• FHINK (5aa)
  •    Q7TPD3    Asn-793
• LGALNSSLQLLEDR (14aa)
  •    Q9Y6C2    Asn-794
• NVTAQICIDK (10aa)
  •    P12109    Asn-804
• AATTQYANGTVLSGQTTNIVTHR (23aa)
  •    Q13873    Asn-827
• VLNSTAISLQWNR (13aa)
  •    Q810U3    Asn-838
• INVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTR (41aa)
  •    O75882    Asn-863
• YVPFNGTK (8aa)
  •    Q810U3    Asn-866
• SHIVVPANTTSAILSGLR (18aa)
  •    P11627    Asn-875
• GVVTDEQGIPIANATISVSGINHGVK (26aa)
  •    Q8IUX7    Asn-922
• AEPPINASASDQGEK (15aa)
  •    Q9Y4L1    Asn-931
• CDQCEENYFYNR (12aa)
  •    P11047    Asn-1022
• NCTDIDECR (9aa)
  •    P35556    Asn-1112
• NCTDIDECR (9aa)
  •    P35555    Asn-1067
• NCTDIDECR (9aa)
  •    Q75N90    Asn-1025
• WANITWK (7aa)
  •    Q810U3    Asn-1026
• YNYTEDPTILR (11aa)
  •    P70206    Asn-1041
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VVNSTTGPGEHL (12aa)
  •    P07996    Asn-1067
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067
• VVNSTTGTGEHIR (13aa)
  •    P35442    Asn-1069
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• VNNTISSQISR (11aa)
  •    P11047    Asn-1107
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• NISQDLEK (8aa)
  •    P11047    Asn-1241
• NTTCQDLQIEVTVK (14aa)
  •    P0C0L4    Asn-1391
• NTTCQDLQIEVTVK (14aa)
  •    P0C0L5    Asn-1391
• RIPAINR (7aa)
  •    P02468    Asn-1393
• WTGHNVTVVQR (11aa)
  •    Q91ZX7    Asn-1512
• FNSSYLQGTNQITGR (15aa)
  •    P04114    Asn-1523
• AFINGTGVETVVSADIPNAHGIAVDWVSR (29aa)
  •    Q07954    Asn-1645
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679
• MHLNGSNVQVLHR (13aa)
  •    Q91ZX7    Asn-3090
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411
• YDFNSSMLYSTAK (13aa)
  •    P04114    Asn-3465
• GVTHLNISGLK (11aa)
  •    Q91ZX7    Asn-3954
• LNGTDPIVAADSK (13aa)
  •    Q07954    Asn-4075