taxonomy (26)
protein (276)
source (81)
structure (28)
composition (1)
disease (43)
reference (155)
site (389)
peptide (238)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Capra hircus (Goat)
- Cavia porcellus (Domestic guinea pig)
- Desmodus rotundus (Common vampire bat)
- Equus caballus (Domestic horse)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Drosophila melanogaster (Fruit fly)
- Bothrops moojeni (Brazilian lancehead)
- Friend mink cell focus-forming virus
- Friend murine leukemia virus (F-mulv)
- Friend spleen focus-forming virus
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Sendai virus (strain hvj)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- ADAMTS-like protein 2 / Homo sapiens Q86TH1
- Adipocyte enhancer-binding protein 1 / Homo sapiens Q8IUX7
- Afamin / Homo sapiens P43652
- Alkaline phosphatase, intestinal / Homo sapiens P09923
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-1b-glycoprotein / Homo sapiens P04217
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Angiotensinogen / Homo sapiens P01019
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Asporin / Homo sapiens Q9BXN1
- Attractin / Homo sapiens O75882
- Band 4.1-like protein 3 / Homo sapiens Q9Y2J2
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Biglycan / Homo sapiens P21810
- Bile-salt-activated lipase / Homo sapiens P19835
- Bone morphogenetic protein receptor type-2 / Homo sapiens Q13873
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- Carboxypeptidase b2 / Homo sapiens Q96IY4
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cathepsin D / Homo sapiens P07339
- CD166 antigen / Homo sapiens Q13740
- CD59 glycoprotein / Homo sapiens P13987
- Ceruloplasmin / Homo sapiens P00450
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor x / Homo sapiens P00742
- Coagulation factor XI / Homo sapiens P03951
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Complement component C8 alpha chain / Homo sapiens P07357
- Complement factor h / Homo sapiens P08603
- Complement factor i / Homo sapiens P05156
- Decorin / Homo sapiens P07585
- Dipeptidase 1 / Homo sapiens P16444
- Dynein heavy chain 11, axonemal / Homo sapiens Q96DT5
- EGF-containing fibulin-like extracellular matrix protein 2 / Homo sapiens O95967
- EMILIN-1 / Homo sapiens Q9Y6C2
- Erythropoietin / Homo sapiens P01588
- Fibrillin-1 / Homo sapiens P35555
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Fibrinogen / Homo sapiens P02679 P02671 P02675
- Fibrinogen beta chain / Homo sapiens P02675
- Fibrinogen gamma chain / Homo sapiens P02679
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Histidine-rich glycoprotein / Homo sapiens P04196
- Holliday junction recognition protein / Homo sapiens Q8NCD3
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- IgG-IL2 fusion protein / Homo sapiens P60568
- IgG1-NK08-V/F genotype / Homo sapiens P01857
- IgG1-NK09-V/F genotype / Homo sapiens P01857
- IgG1-NK11-F/F genotype / Homo sapiens P01857
- IgG1-NK12-V/F genotype / Homo sapiens P01857
- IgG1-NK13-V/F genotype / Homo sapiens P01857
- Immunoglobulin alpha (non secretory) / Homo sapiens P01876 P01877
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01861 P01857 P01860 P01859
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens P19823
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon gamma / Homo sapiens P01579
- Interleukin-18-binding protein / Homo sapiens O95998
- Interstitial collagenase / Homo sapiens P03956
- Kininogen-1 / Homo sapiens P01042
- L-selectin / Homo sapiens P14151
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-1 / Homo sapiens P25391
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Microtubule-associated protein 10 / Homo sapiens Q9P2G4
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens O60566
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Neprilysin / Homo sapiens P08473
- Neural cell adhesion molecule 1 / Homo sapiens P13591
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Periostin / Homo sapiens Q15063
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens P04180
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens P80108
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasminogen / Homo sapiens P00747
- Poliovirus receptor / Homo sapiens P15151
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Protein AMBP / Homo sapiens P02760
- Prothrombin / Homo sapiens P00734
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens Q9H792
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Serotransferrin / Homo sapiens P02787
- Serum albumin / Homo sapiens P02768
- Serum amyloid p-component / Homo sapiens P02743
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sparc / Homo sapiens P09486
- Sulfatase-modifying factor 2 / Homo sapiens Q8NBJ7
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Thyroxine-binding globulin / Homo sapiens P05543
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transferrin receptor protein 1 / Homo sapiens P02786
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Uncharacterized protein from Pleura / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vacuolar protein sorting-associated protein 13A / Homo sapiens Q96RL7
- Vasorin / Homo sapiens Q6EMK4
- Vitronectin / Homo sapiens P04004
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Alpha-1-acid glycoprotein / Bos taurus Q3SZR3
- Alpha-2-hs-glycoprotein / Bos taurus P12763
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Immunoglobulin gamma / Bos taurus
- Platelet glycoprotein IV / Bos taurus P26201
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein from Milk / Bos taurus
- Alpha-1-acid glycoprotein / Canis lupus familiaris F6Y713
- Immunoglobulin gamma / Canis lupus familiaris
- Immunoglobulin gamma / Capra hircus
- Factor b1 / Cavia porcellus
- Factor b2 / Cavia porcellus
- Immunoglobulin gamma / Cavia porcellus
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Immunoglobulin gamma / Equus caballus
- Uncharacterized protein from Dander / Equus caballus
- Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-6 / Mus musculus P97326
- Carbonic anhydrase-related protein 10 / Mus musculus P61215
- Carboxypeptidase D / Mus musculus O89001
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Contactin-1 / Mus musculus P12960
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus O55026
- Ephrin-A1 / Mus musculus P52793
- Immunoglobulin gamma / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Integrin alpha-V / Mus musculus P43406
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Neuroplastin / Mus musculus P97300-3
- Isoform S-MAG of Myelin-associated glycoprotein / Mus musculus P20917-2
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukemia inhibitory factor receptor / Mus musculus P42703
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Major urinary protein / Mus musculus
- Myelin-associated glycoprotein / Mus musculus P20917
- Nectin-1 / Mus musculus Q9JKF6
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuroplastin / Mus musculus P97300
- Neurotrimin / Mus musculus Q99PJ0
- Noelin / Mus musculus O88998
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Plexin-A1 / Mus musculus P70206
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protocadherin-9 / Mus musculus A0A0A6YY09
- Rho-associated protein kinase 2 / Mus musculus P70336
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- SPARC-like protein 1 / Mus musculus P70663
- Tenascin-r / Mus musculus Q8BYI9
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein from Ascitic fluid / Mus musculus
- Zinc transporter ZIP10 / Mus musculus Q6P5F6
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Immunoglobulin gamma / Oryctolagus cuniculus
- Alpha-1-acid glycoprotein / Ovis aries W5P7S6
- Immunoglobulin gamma / Ovis aries
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Alpha-1-acid glycoprotein / Rattus norvegicus P02764
- Immunoglobulin gamma / Rattus norvegicus
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Thy-1 membrane glycoprotein / Rattus norvegicus
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Coagulation factor VIII / Sus scrofa P12263
- Immunoglobulin gamma / Sus scrofa
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin y / Gallus gallus
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Acetylcholine receptor protein / Torpedo californica P02710 P02714 P02718 P02712
- Batroxobin / Bothrops moojeni
- Envelope glycoprotein / Friend mink cell focus-forming virus
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus P03393
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Fusion glycoprotein / Sendai virus (strain hvj) P04855
- Hemagglutinin-neuraminidase / Sendai virus (strain hvj) P04853
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Allantois (UBERON_0004340)
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Ascitic fluid (UBERON_0007795) EL4 (CVCL_0255)
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Dander
- Electric Organ (UBERON_0006869)
- Embryo (UBERON_0000922)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048) Mv1Lu (CVCL_0593)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Milk (UBERON_0001913) Plasma Membrane (GO_0005886)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO B8-300 (CVCL_VU03)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/IV (CVCL_VT64)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/Vh (CVCL_VT65)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Skin of Body (UBERON_0002097) Fibroblast (CL_0000057)
- Spleen (UBERON_0002106)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BW5147 (CVCL_3896) T-Lymphocyte (CL_0000084)
- CE (CVCL_6D96)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- J558L (CVCL_3949)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- P3X63Ag8U.1 (CVCL_3412)
- Rat1 (CVCL_0492)
- WEHI-231 (CVCL_0577) B-Lymphocyte (CL_0000236)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- B-Lymphocyte (CL_0000236)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Fibroblast (CL_0000057)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- T-Lymphocyte (CL_0000084)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Low-Density Lipoprotein Particle (GO_0034362)
- Plasma Membrane (GO_0005886)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Gal(?1-4)GlcNAc(?1-2)Man(a1-3)[Gal(?1-4)GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)Man(a1-3)[Gal(b1-3)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(?1-?)Man(a1-?)[Gal(b1-4)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[Gal(b1-3)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-3)GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Gal(b1-4)GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)Man(a1-3)[Gal(b1-4)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[Gal(b1-?)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9717
- N-Linked / Complex / Structure 10712
- N-Linked / Complex / Structure 10981
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-3)[Man(a1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9667
- N-Linked / Hybrid / Structure 9861
- N-Linked / Hybrid / Structure 10527
- N-Linked / Hybrid / Structure 11197
Reported structure
- Hex:5 HexNAc:4 (avg mass : 1641.5073 )
Composition
- Anemia, Aplastic (DOID:12449)
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Asymptomatic myositis (DOID:633)
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
- Carcinoma, Hepatocellular (DOID:684)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Diabetes Mellitus (DOID:9351)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Erythroleukemia with associated Polycythemia
- Familial hepatic adenoma (DOID:111366)
- Gangliosidosis GM1 (DOID:3322)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Heavy Chain Disease (DOID:0060125)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Hypercholesterolemia, Familial (DOID:13810)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Myloid, Chronic (DOID:8552)
- Lymphoma, Lymphoblastic (DOID:0080147)
- Lymphoma, Thymic (DOID:10146)
- Malignant material
- Melanoma (DOID:1909)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
- Plasmacytoma (Mouse) (DOID:3721)
- Prostate cancer (DOID:10283)
- Sjogren's Syndrome (DOID:12894)
- Systemic lupus erythematosus (DOID:9074)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- N-glycosylation potential of maize: the human lactoferrin used as a model. (2001 - Samyn-Petit B, Gruber V, Flahaut C, Wajda-Dubos JP, Farrer S, Pons A, Desmaizieres G, Slomianny MC, Theisen M, Delannoy P) / Status : Reviewed
- Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
- Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides in bile salt-stimulated lipase originated from human breast milk. (1999 - Mechref Y, Chen P, Novotny M) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
- Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum. (1998 - Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Alteration of asparagine-linked glycosylation in serum transferrin of patients with hepatocellular carcinoma. (1994 - Matsumoto K, Maeda Y, Kato S, Yuki H) / Status : Reviewed
- Characterization of a single glycosylated asparagine site on a glycopeptide using solid-phase Edman degradation. (1994 - Gooley A, Pisano A, Packer N, Ball M, Jones A, Alewood P, Redmond J, Williams K) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Reducing-end modification of N-linked oligosaccharides with tyrosine. (1994 - Tamura T, Wadhwa M, Rice K) / Status : Reviewed
- Human serum amyloid P component is an invariant constituent of amyloid deposits and has a uniquely homogeneous glycostructure. (1994 - Pepys M, Rademacher T, Amatayakul-Chantler S, Williams P, Noble G, Hutchinson W, Hawkins P, Nelson S, Gallimore J, Herbert J) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
- Identification, quantification, and characterization of glycopeptides in reversed-phase HPLC separations of glycoprotein proteolytic digests. (1993 - Rohrer J, Cooper G, Townsend R) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structural analysis on the sugar chains of human alpha 1-antitrypsin: presence of fucosylated biantennary glycan in hepatocellular carcinoma. (1993 - Saitoh A, Aoyagi Y, Asakura H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Cell type and maturation stage-dependent polymorphism of N-linked oligosaccharides on murine lymphocytes and lymphoma cells. (1991 - Yoshida T, Takahashi N, Nakashima I) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of guinea-pig factor B of the alternative complement pathway. (1990 - Mizuochi T, Hamako J, Titani K, Matsushita M, Okada H) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Large-scale preparation and characterization of N-linked glycopeptides from bovine fetuin. (1990 - Rice K, Rao N, Lee Y) / Status : Reviewed
- Additional fucosyl residues on membrane glycoproteins but not a secreted glycoprotein from cystic fibrosis fibroblasts. (1990 - Wang YM, Hare TR, Won B, Stowell CP, Scanlin TF, Glick MC, Hård K, van Kuik JA, Vliegenthart JF) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
- Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Resolution of some glycopeptides of hen ovalbumin by reverse-phase high-pressure liquid chromatography. (1984 - Dua V, Bush C) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- Carbohydrate structure of human fibrinogen. Use of 300-MHz 1H-NMR to characterize glycosidase-treated glycopeptides. (1982 - Townsend RR, Hilliker E, Li Y-T, Laine RA, Bell WR, Lee YC) / Status : Reviewed
- Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
- Comparative study of the carbohydrate moieties of rat and human plasma alpha 1-acid glycoproteins. (1981 - Yoshima H, Matsumoto A, Mizuochi T, Kawasaki T, Kobata A) / Status : Reviewed
- The application of 500-MHz H-NMR spectroscopy for the structure elucidation of N-acetyllactosamine type asparagine-bound carbohydrate chains of glycoproteins. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Schmid K, Montreuil J, Fournet B, Hull W) / Status : Reviewed
- Structural studies of the sugar chains of cold-insoluble globulin isolated from human plasma. (1980 - Takasaki S, Yamashita K, Suzuki K, Kobata A) / Status : Reviewed
- Structure of the oligosaccharide of human J chain. (1979 - Baenziger J) / Status : Reviewed
- Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed
- The carbohydrate units of ovalbumin: complete structures of three glycopeptides (1978 - Conchie J, Strachan I) / Status : Reviewed
Reference
- ADAMTS-like protein 2 / Homo sapiens
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Afamin / Homo sapiens
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
- Alpha-1-acid glycoprotein 1 / Homo sapiens
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
- Asn-33
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-1b-glycoprotein / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
-
Alpha-fetoprotein / Homo sapiens
- Undefined site
- Asn-251
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Angiotensinogen / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Asporin / Homo sapiens
- Attractin / Homo sapiens
- Band 4.1-like protein 3 / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
- Asn-207
- Bone morphogenetic protein receptor type-2 / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cathepsin D / Homo sapiens
- CD166 antigen / Homo sapiens
-
CD59 glycoprotein / Homo sapiens
- Undefined site
- Ceruloplasmin / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor x / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Complement component C8 alpha chain / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor i / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidase 1 / Homo sapiens
- Dynein heavy chain 11, axonemal / Homo sapiens
- EGF-containing fibulin-like extracellular matrix protein 2 / Homo sapiens
- EMILIN-1 / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
-
Fibrinogen / Homo sapiens
- Undefined site
-
Fibrinogen beta chain / Homo sapiens
- Undefined site
- Asn-394
-
Fibrinogen gamma chain / Homo sapiens
- Undefined site
- Asn-78
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Holliday junction recognition protein / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Immunoglobulin J chain / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Interleukin-18-binding protein / Homo sapiens
-
Interstitial collagenase / Homo sapiens
- Undefined site
- Kininogen-1 / Homo sapiens
-
L-selectin / Homo sapiens
- Undefined site
-
Lactotransferrin / Homo sapiens
- Undefined site
- Asn-497
- Laminin subunit alpha-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Microtubule-associated protein 10 / Homo sapiens
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Neprilysin / Homo sapiens
- Neural cell adhesion molecule 1 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
-
Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Undefined site
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Asn-308
- Poliovirus receptor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein AMBP / Homo sapiens
- Prothrombin / Homo sapiens
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum albumin / Homo sapiens
- Serum amyloid p-component / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
- Sparc / Homo sapiens
- Sulfatase-modifying factor 2 / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Thyroxine-binding globulin / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
- Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Vasorin / Homo sapiens
- Vitronectin / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Capra hircus
- Undefined site
-
Factor b1 / Cavia porcellus
- Undefined site
-
Factor b2 / Cavia porcellus
- Undefined site
-
Immunoglobulin gamma / Cavia porcellus
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Uncharacterized protein from Dander / Equus caballus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-6 / Mus musculus
- Carbonic anhydrase-related protein 10 / Mus musculus
- Carboxypeptidase D / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Ephrin-A1 / Mus musculus
-
Immunoglobulin gamma / Mus musculus
- Undefined site
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Integrin alpha-V / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Isoform S-MAG of Myelin-associated glycoprotein / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukemia inhibitory factor receptor / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
-
Major urinary protein / Mus musculus
- Undefined site
- Myelin-associated glycoprotein / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Neurotrimin / Mus musculus
- Noelin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Plexin-A1 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protocadherin-9 / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- SPARC-like protein 1 / Mus musculus
-
Tenascin-r / Mus musculus
- Undefined site
- Thy-1 membrane glycoprotein / Mus musculus
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein from Ascitic fluid / Mus musculus
- Undefined site
- Zinc transporter ZIP10 / Mus musculus
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Alpha-1-acid glycoprotein / Rattus norvegicus
- Undefined site
-
Immunoglobulin gamma / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Thy-1 membrane glycoprotein / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Immunoglobulin gamma / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Batroxobin / Bothrops moojeni
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
-
Fusion glycoprotein / Sendai virus (strain hvj)
- Undefined site
-
Hemagglutinin-neuraminidase / Sendai virus (strain hvj)
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- HIVFWNSSNPK (11aa)
- LELNLTDSENATCLYAK (17aa)
- DIENFNSTQK (10aa)
- LVPVPITNATLDR (13aa)
- VTACHSSQPNATLYK (15aa)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- HLVIHNESTCEQLAK (15aa)
- VYIHPFHLVIHNESTCEQLAK (21aa)
- WYSAGLASNSSWFR (14aa)
- SVSVAAGDSTVLNCTLTSLLPVGPIR (26aa)
- FSNVTWF (7aa)
- CSDGWSFDATTLDDNGTMLFFK (22aa)
- CIQANYSIMENGK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- NK (2aa)
- RNESTQNCVVAEPEKM (16aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- HAIHVSGTNGTKRF (14aa)
- ANTTQPGIVEGGQVLK (16aa)
- FHAIHVSGTNGTKRF (15aa)
- DLQSLEDILHQVENK (15aa)
- NNATVHEQVGGPSLTSDLQAQSK (23aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- VLTLANFTTK (10aa)
- NLTIVDSGLK (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- NCTLLLSTLSPELGGK (16aa)
- LLGDLGLRNCTLLLSTLSPELGGK (24aa)
- NTTGEHCEK (9aa)
- TFYWDFYTNR (10aa)
- DIVEYYNDSNGSHVIQGR (18aa)
- DIVEYYNDSNGSHVLQGR (18aa)
- DAMVGNYTCEVTELSR (16aa)
- ISNVTPADAGIYYCVK (16aa)
- ANATIEVK (8aa)
- EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
- VCSNDNK (7aa)
- LDKEHLVNISGGPMTYSHR (19aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- GHVNITR (7aa)
- TQSLLIVNNATNVVIK (16aa)
- VIDFNCTTSSVSSALANTK (19aa)
- VIDFNCTTSSVSSAIANTK (19aa)
- FGCEIENNR (9aa)
- VALPAYPASLTDVSLVLSELRPNDSGVYR (29aa)
- LLNLTSPEATAK (12aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- EHEGAIYPDNTTDFQR (16aa)
- GTFTDCALANMTEQIR (16aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- SCINESAIDSR (11aa)
- YHKNNKSWMESEF (13aa)
- RLRNVSWATGRS (12aa)
- RNVSWATGRS (10aa)
- KRCPDGFFSNETSSKA (16aa)
- ACQFNR (6aa)
- RACQFNR (7aa)
- KVCQDCPLLAPLNDTR (16aa)
- VCQDCPLLAPLNDTR (15aa)
- IGDCISEDSYPDGNITWYR (19aa)
- GIPDQKVNFTCK (12aa)
- VNFTCK (6aa)
- NGSLFAFR (8aa)
- NAQNNGSNFQLEEISR (16aa)
- LSDLSINSTECLHVHCR (17aa)
- IYVIDGTQNDTAFVFPR (17aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- EEQYNSTY (8aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- MVSHHNITTGATIINEQWIITTAK (24aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- SWPAVGNCSSALR (13aa)
- GQVYPWGNWFQPNR (14aa)
- NASNMEYR (8aa)
- CQCEPGFQLGPNNR (14aa)
- LKGEAEYQEIRNPNGTVTVISR (22aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- KNLFLNHSENATAKD (15aa)
- DIILHSTGHNISR (13aa)
- NTTGFK (6aa)
- KNVSCYIQNLLLGQEKK (17aa)
- FNHTQTIQQK (10aa)
- EEQYNSTFR (9aa)
- EEQFNSTFR (9aa)
- NDSLSLQETSSSSFLSSQPFEDDDICNVTISDLYAGMLHSMSR (43aa)
- QNITYLLK (8aa)
- VVLHPNYSQVDIGLIK (16aa)
- HMNETSHTQGSLR (13aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- VVIHPNYSQVDIGIIK (16aa)
- GIANLSNFIR (10aa)
- IGNWSAMPSCK (11aa)
- LGNWSAMPSCK (11aa)
- IININPNK (8aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- VTQQSPTSMNQVNLTCR (17aa)
- YLGNATAIFFLPDEGK (16aa)
- KYLGNATAIFFLPDEGKL (18aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- ITDIENGSIANIPR (14aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- RHNSTGCLRM (10aa)
- YNLT (4aa)
- VIYQNHNK (8aa)
- LNAENNATFYFK (12aa)
- DDLHPTLPAGQYFLNITYNYPVHSFDGR (28aa)
- LGHTNASIMLFEVK (14aa)
- FFHVNGSAFLPR (12aa)
- SAQTPHTHNR (10aa)
- IGPGEPLELLCNVSGALPPPGR (22aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- RNWTEAEVK (9aa)
- DQSEDDRQHECLNVTQLLK (19aa)
- SAIYSTPSHKDQSEDDRQHECLNVTQLLK (29aa)
- VFNATR (6aa)
- WLNRPQNISILTLCESTTGACSR (23aa)
- ASGDPIPSITWRTSTRNISSEE (22aa)
- VQPFNVTQGK (10aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GNTTTLISENGHAADTLTATNFR (23aa)
- FTNASK (6aa)
- AMNTSQVEAIGIQMIPGYR (19aa)
- GTAGNAIMDGASQIMGENR (19aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- INTTIGSVAAQDPDAAR (17aa)
- LGVQMHPGQEIHNFTLTGR (19aa)
- SINTTNVMGTSLTVR (15aa)
- SFHNFTLCYIK (11aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
- NYTDCTSEGR (10aa)
- CGIVPVIAENYNK (13aa)
- CGLVPVLAENYNK (13aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- KCGLVPVLAENYNKS (15aa)
- VGVHINNTQTK (11aa)
- GGSSGWSGGLAQNR (14aa)
- LSEIHKDQPGHPVNR (15aa)
- DQPGHPVNR (9aa)
- VILYNR (6aa)
- VNRFNSTEYQVVTR (14aa)
- IVASDSGKPSLNQTALVR (18aa)
- ALPQPQNVTSLLGCTH (16aa)
- AIPQPQNVTSIIGCTH (16aa)
- ILDQACGTDNQTYASSCHLFATK (23aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- FFPYANGTLSIR (12aa)
- LETTVNYTDSQRPICLPSK (19aa)
- ANSTGTLVITNPTR (14aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDK (17aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- HEEGHMLNCTCFGQGR (16aa)
- VVAVSPANISR (11aa)
- KAAIPSALDTNSSKS (15aa)
- NASGIYAEIDGAK (13aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NNSNNFDLNR (10aa)
- QQQHLFGSNVTDCSGNFCLFR (21aa)
- QQQHIFGSNVTDCSGNFCIFR (21aa)
- INNTHALVSLLQNLNK (16aa)
- ISKINNTHALVSLLQNLNK (19aa)
- LGTSLSSGHVLMNGTLK (17aa)
- NFTIS (5aa)
- LCDPNTRPVGEKNCTGPPCDR (21aa)
- LSHDGNETLPLHLYVK (16aa)
- ELHHLQEQNVSNAFLDK (17aa)
- NMTLFSDLVAEK (12aa)
- NLTLK (5aa)
- FHINK (5aa)
- LGALNSSLQLLEDR (14aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- AATTQYANGTVLSGQTTNIVTHR (23aa)
- VLNSTAISLQWNR (13aa)
- INVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTR (41aa)
- YVPFNGTK (8aa)
- SHIVVPANTTSAILSGLR (18aa)
- GVVTDEQGIPIANATISVSGINHGVK (26aa)
- AEPPINASASDQGEK (15aa)
- CDQCEENYFYNR (12aa)
- NCTDIDECR (9aa)
- WANITWK (7aa)
- YNYTEDPTILR (11aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGPGEHL (12aa)
- KVVNSTTGPGEHLRN (15aa)
- CDSGFALDSEERNCTDIDECR (21aa)
- VVNSTTGTGEHIR (13aa)
- NLSEIK (6aa)
- Q9Y2J2 Asn-734     Band 4.1-like protein 3 / Homo sapiens
- P25391 Asn-2098     Laminin subunit alpha-1 / Homo sapiens
- Q96DT5 Asn-3201     Dynein heavy chain 11, axonemal / Homo sapiens
- P24043 Asn-2126     Laminin subunit alpha-2 / Homo sapiens
- Q96RL7 Asn-1071     Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Q9H792 Asn-589     Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Q9P2G4 Asn-694     Microtubule-associated protein 10 / Homo sapiens
- O60566 Asn-983     Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VNSSLHSQISR (11aa)
- VNNTISSQISR (11aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NISQDLEK (8aa)
- NTTCQDLQIEVTVK (14aa)
- RIPAINR (7aa)
- WTGHNVTVVQR (11aa)
- FNSSYLQGTNQITGR (15aa)
- RFNSSYLQGTNQITGRY (17aa)
- AFINGTGVETVVSADIPNAHGIAVDWVSR (29aa)
- NLQVYNATSNSLTVK (15aa)
- ITVHGNGSLDIR (12aa)
- MIEAYNITEK (10aa)
- EAGNITTDGYEIIGK (15aa)
- MHLNGSNVQVLHR (13aa)
- FVEGSHNSTVSLTTK (15aa)
- KFVEGSHNSTVSLTTKN (17aa)
- YDFNSSMLYSTAK (13aa)
- GVTHLNISGLK (11aa)
- LNGTDPIVAADSK (13aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1641.5073)
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- HEK293 (CVCL_0045)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Asymptomatic myositis (DOID:633)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Protein and Site Specificity of Fucosylation in Liver-Secreted Glycoproteins (2014 - Pompach P, Ashline DJ, Brnakova Z, Benicky J, Sanda M, Goldman R.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Characterization of a single glycosylated asparagine site on a glycopeptide using solid-phase Edman degradation. (1994 - Gooley A, Pisano A, Packer N, Ball M, Jones A, Alewood P, Redmond J, Williams K) / Status : Reviewed
- Afamin / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-1b-glycoprotein / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Antithrombin-III / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor i / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prothrombin / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum albumin / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
- Thyroxine-binding globulin / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- Vitronectin / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- YKNNSDISSTR (11aa)
- NNSDISSTR (9aa)
- RNESTQNCVVAEPEKM (16aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- TQSLLIVNNATNVVIK (16aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- RNVSWATGRS (10aa)
- RLRNVSWATGRS (12aa)
- KRCPDGFFSNETSSKA (16aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- KNLFLNHSENATAKD (15aa)
- KNVSCYIQNLLLGQEKK (17aa)
- EEQFNSTFR (9aa)
- KVVLHPNYSQVDIGLIKL (18aa)
- KYLGNATAIFFLPDEGKL (18aa)
- RHNSTGCLRM (10aa)
- VFNATR (6aa)
- KCGLVPVLAENYNKS (15aa)
- KVPGNVTAVLGETLKV (16aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KAAIPSALDTNSSKS (15aa)
- KVVNSTTGPGEHLRN (15aa)
- RFNSSYLQGTNQITGRY (17aa)
- KFVEGSHNSTVSLTTKN (17aa)
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977)
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
- Comparative study of the carbohydrate moieties of rat and human plasma alpha 1-acid glycoproteins. (1981 - Yoshima H, Matsumoto A, Mizuochi T, Kawasaki T, Kobata A) / Status : Reviewed
-
Major urinary protein / Mus musculus
- Undefined site
-
Alpha-1-acid glycoprotein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Comparative study of the carbohydrate moieties of rat and human plasma alpha 1-acid glycoproteins. (1981 - Yoshima H, Matsumoto A, Mizuochi T, Kawasaki T, Kobata A) / Status : Reviewed
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Alpha-1-acid glycoprotein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Urine (UBERON_0001088)
-
Major urinary protein / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Seminal Fluid (UBERON_0006530)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Canis lupus familiaris
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Liver (UBERON_0002107)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Urine (UBERON_0001088)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Diabetes Mellitus (DOID:9351)
- Gangliosidosis GM1 (DOID:3322)
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Allantois (UBERON_0004340)
- Amnion (UBERON_0000305) FL (CVCL_1905)
- Ascitic fluid (UBERON_0007795) EL4 (CVCL_0255)
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Dander
- Electric Organ (UBERON_0006869)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048) Mv1Lu (CVCL_0593)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO B8-300 (CVCL_VU03)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/IV (CVCL_VT64)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/Vh (CVCL_VT65)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987) JEG-3 (CVCL_0363) Epithelium (CL_0002577)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Skin of Body (UBERON_0002097) Fibroblast (CL_0000057)
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- BW5147 (CVCL_3896) T-Lymphocyte (CL_0000084)
- CE (CVCL_6D96)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- J558L (CVCL_3949)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- P3X63Ag8U.1 (CVCL_3412)
- Rat1 (CVCL_0492)
- WEHI-231 (CVCL_0577) B-Lymphocyte (CL_0000236)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- B-Lymphocyte (CL_0000236)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- Leukocyte (CL_0000738)
- T-Lymphocyte (CL_0000084)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Plasma Membrane (GO_0005886)
- Yolk (GO_0060417)
- Anemia, Aplastic (DOID:12449)
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Carcinoma, Gallbladder which metastasises to the liver (DOID:4948)
- Carcinoma, Hepatocellular (DOID:684)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Control/Healthy
- Cystic Fibrosis (DOID:1485)
- Diabetes Mellitus (DOID:9351)
- Erythroleukemia with associated Polycythemia
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Heavy Chain Disease (DOID:0060125)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Myloid, Chronic (DOID:8552)
- Lymphoma, Lymphoblastic (DOID:0080147)
- Lymphoma, Thymic (DOID:10146)
- Malignant material
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Sjogren's Syndrome (DOID:12894)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Abnormal biantennary sugar chains are expressed in human chorionic gonadotropin produced in the choriocarcinoma cell line, JEG-3. (2004 - Takamatsu S, Katsumata T, Inoue N, Watanabe T, Fujibayashi Y, Takeuchi M) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
- Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides in bile salt-stimulated lipase originated from human breast milk. (1999 - Mechref Y, Chen P, Novotny M) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
- Characterization of recombinant human plasma lecithin: cholesterol acyltransferase (LCAT): N-linked carbohydrate structures and catalytic properties. (1998 - Lacko A, Reason A, Nuckolls C, Kudchodkar B, Nair M, Sundarrajan G, Pritchard P, Morris H, Dell A) / Status : Reviewed
- Evidence for a site-specific fucosylation of N-linked oligosaccharide of immunoglobulin A1 from normal human serum. (1998 - Tanaka A, Iwase H, Hiki Y, Kokubo T, Ishii-Karakasa I, Toma K, Kobayashi Y, Hotta K) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase. (1996 - Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Identification of the oligosaccharide structures of human coagulation factor X activation peptide at each glycosylation site. (1995 - Nakagawa H, Takahashi N, Fujikawa K, Kawamura Y, Iino M, Takeya H, Ogawa H, Suzuki K) / Status : Reviewed
- Structural study on the glycosyl-phosphatidylinositol anchor and the asparagine-linked sugar chain of a soluble form of CD59 in human urine. (1994 - Nakano Y, Noda K, Endo T, Kobata A, Tomita M) / Status : Reviewed
- Reducing-end modification of N-linked oligosaccharides with tyrosine. (1994 - Tamura T, Wadhwa M, Rice K) / Status : Reviewed
- Human serum amyloid P component is an invariant constituent of amyloid deposits and has a uniquely homogeneous glycostructure. (1994 - Pepys M, Rademacher T, Amatayakul-Chantler S, Williams P, Noble G, Hutchinson W, Hawkins P, Nelson S, Gallimore J, Herbert J) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Alteration of asparagine-linked glycosylation in serum transferrin of patients with hepatocellular carcinoma. (1994 - Matsumoto K, Maeda Y, Kato S, Yuki H) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Carbohydrate structures of human alpha-fetoprotein of patients with hepatocellular carcinoma: presence of fucosylated and non-fucosylated triantennary glycans. (1993 - Aoyagi Y, Suzuki Y, Igarashi K, Saitoh A, Oguro M, Yokota T, Mori S, Suda T, Isemura M, Asakura H) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Identification, quantification, and characterization of glycopeptides in reversed-phase HPLC separations of glycoprotein proteolytic digests. (1993 - Rohrer J, Cooper G, Townsend R) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Comparative studies of asparagine-linked sugar chains of immunoglobulin G from eleven mammalian species. (1993 - Hamako J, Matsui T, Ozeki Y, Mizuochi T, Titani K) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Structural analysis on the sugar chains of human alpha 1-antitrypsin: presence of fucosylated biantennary glycan in hepatocellular carcinoma. (1993 - Saitoh A, Aoyagi Y, Asakura H) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Cell type and maturation stage-dependent polymorphism of N-linked oligosaccharides on murine lymphocytes and lymphoma cells. (1991 - Yoshida T, Takahashi N, Nakashima I) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of guinea-pig factor B of the alternative complement pathway. (1990 - Mizuochi T, Hamako J, Titani K, Matsushita M, Okada H) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Large-scale preparation and characterization of N-linked glycopeptides from bovine fetuin. (1990 - Rice K, Rao N, Lee Y) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Additional fucosyl residues on membrane glycoproteins but not a secreted glycoprotein from cystic fibrosis fibroblasts. (1990 - Wang YM, Hare TR, Won B, Stowell CP, Scanlin TF, Glick MC, Hård K, van Kuik JA, Vliegenthart JF) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of an alkaline phosphatase, kasahara isozyme, purified from FL amnion cells. (1990 - Endo T, Higashino K, Hada T, Imanishi H, Muratani K, Kochibe N, Kobata A) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells. (1989 - Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A) / Status : Reviewed
- Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins. (1988 - Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H) / Status : Reviewed
- Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1988 - Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- Carbohydrate structure of human fibrinogen. Use of 300-MHz 1H-NMR to characterize glycosidase-treated glycopeptides. (1982 - Townsend RR, Hilliker E, Li Y-T, Laine RA, Bell WR, Lee YC) / Status : Reviewed
- Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
- Comparative study of the carbohydrate moieties of rat and human plasma alpha 1-acid glycoproteins. (1981 - Yoshima H, Matsumoto A, Mizuochi T, Kawasaki T, Kobata A) / Status : Reviewed
- Structural studies of the sugar chains of cold-insoluble globulin isolated from human plasma. (1980 - Takasaki S, Yamashita K, Suzuki K, Kobata A) / Status : Reviewed
- The application of 500-MHz H-NMR spectroscopy for the structure elucidation of N-acetyllactosamine type asparagine-bound carbohydrate chains of glycoproteins. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Schmid K, Montreuil J, Fournet B, Hull W) / Status : Reviewed
- Structure of the oligosaccharide of human J chain. (1979 - Baenziger J) / Status : Reviewed
- Determination of the primary structures of 16 asialo-carbohydrate units derived from human plasma alpha 1-acid glycoprotein by 360-MHZ 1H NMR spectroscopy and permethylation analysis. (1978 - Fournet B, Montreuil J, Strecker G, Dorland L, Haverkamp J, Vliegenthart F, Binette J, Schmid K) / Status : Reviewed
-
Alkaline phosphatase, intestinal / Homo sapiens
- Undefined site
-
Alpha-1-acid glycoprotein 2 / Homo sapiens
- Undefined site
-
Alpha-1-antitrypsin / Homo sapiens
- Undefined site
-
Alpha-fetoprotein / Homo sapiens
- Undefined site
- Asn-251
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
- Asn-207
-
CD59 glycoprotein / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
- Coagulation factor x / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
-
Fibrinogen / Homo sapiens
- Undefined site
-
Fibrinogen beta chain / Homo sapiens
- Undefined site
-
Fibrinogen gamma chain / Homo sapiens
- Undefined site
-
Fibronectin / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-367
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Immunoglobulin J chain / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
Interstitial collagenase / Homo sapiens
- Undefined site
-
L-selectin / Homo sapiens
- Undefined site
-
Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Undefined site
-
Plasminogen / Homo sapiens
- Undefined site
- Asn-308
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Serum amyloid p-component / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Capra hircus
- Undefined site
-
Factor b1 / Cavia porcellus
- Undefined site
-
Factor b2 / Cavia porcellus
- Undefined site
-
Immunoglobulin gamma / Cavia porcellus
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Uncharacterized protein from Dander / Equus caballus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma / Mus musculus
- Undefined site
-
Major urinary protein / Mus musculus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein from Ascitic fluid / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Alpha-1-acid glycoprotein / Rattus norvegicus
- Undefined site
-
Immunoglobulin gamma / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Thy-1 membrane glycoprotein / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Immunoglobulin gamma / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
-
Fusion glycoprotein / Sendai virus (strain hvj)
- Undefined site
-
Hemagglutinin-neuraminidase / Sendai virus (strain hvj)
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Lymphocyte (CL_0000542)
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Milk (UBERON_0001913)
-
Lactotransferrin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1641.5073)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Lymphocyte (CL_0000542)
- Low-Density Lipoprotein Particle (GO_0034362)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
Source
Disease
Reference
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1641.5073)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1641.5073)