taxonomy (8)
protein (219)
source (28)
structure (19)
composition (1)
disease (13)
reference (37)
site (283)
peptide (265)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Rana pipiens (Northern leopard frog)
- Gallus gallus (Chicken)
- Friend murine leukemia virus (F-mulv)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Acid ceramidase / Homo sapiens Q13510
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Arylsulfatase D / Homo sapiens P51689
- Attractin / Homo sapiens O75882
- Band 4.1-like protein 3 / Homo sapiens Q9Y2J2
- Basal cell adhesion molecule / Homo sapiens P50895
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- Basigin / Homo sapiens P35613
- Beta-1,4-galactosyltransferase 3 / Homo sapiens O60512
- Beta-galactosidase / Homo sapiens P16278
- Cadherin-5 / Homo sapiens P33151
- Calcium-activated chloride channel regulator 2 / Homo sapiens Q9UQC9
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Cathepsin D / Homo sapiens P07339
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens P20645
- CD109 antigen / Homo sapiens Q6YHK3
- CD166 antigen / Homo sapiens Q13740
- CD16A-NK08-V/F genotype / Homo sapiens P08637
- CD16A-NK09-V/F genotype / Homo sapiens P08637
- CD16A-NK11-F/F genotype / Homo sapiens P08637
- CD16A-NK12-V/F genotype / Homo sapiens P08637
- CD16A-NK13-V/F genotype / Homo sapiens P08637
- CD276 antigen / Homo sapiens Q5ZPR3
- CD63 antigen / Homo sapiens P08962
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Choline transporter-like protein 2 / Homo sapiens Q8IWA5
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens Q11201
- Coagulation factor V / Homo sapiens P12259
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(I) chain / Homo sapiens P08123
- Collagen alpha-2(V) chain / Homo sapiens P05997
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Complement C2 / Homo sapiens P06681
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- CUB domain-containing protein 1 / Homo sapiens Q9H5V8
- Decorin / Homo sapiens P07585
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 4 / Homo sapiens P27487
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens P78536
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens Q13443
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens P46977
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Dynein heavy chain 11, axonemal / Homo sapiens Q96DT5
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ectonucleoside triphosphate diphosphohydrolase 5 / Homo sapiens O75356
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Erlin-1 / Homo sapiens O75477
- Erlin-2 / Homo sapiens O94905
- ERO1-like protein beta / Homo sapiens Q86YB8
- Folate receptor alpha / Homo sapiens P15328
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Glycodelin-a / Homo sapiens P09466
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Hemopexin / Homo sapiens P02790
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens Q68CP4
- Histidine-rich glycoprotein / Homo sapiens P04196
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01860 P01857
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Insulin receptor / Homo sapiens P06213
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Integrin beta-2 / Homo sapiens P05107
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Junctional adhesion molecule A / Homo sapiens Q9Y624
- Kallistatin / Homo sapiens P29622
- Lactadherin / Homo sapiens Q08431
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-1 / Homo sapiens P25391
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit gamma-1 / Homo sapiens P11047
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Lipid phosphate phosphohydrolase 2 / Homo sapiens O43688
- Lumican / Homo sapiens P51884
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal protective protein / Homo sapiens P10619
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Microtubule-associated protein 10 / Homo sapiens Q9P2G4
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens O60566
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myelin protein P0 / Homo sapiens P25189
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- Myelin protein zero-like protein 2 / Homo sapiens O60487
- N-acetylglucosamine-1-phosphotransferase subunits alpha/beta / Homo sapiens Q3T906
- Neurocan core protein / Homo sapiens O14594
- Olfactomedin-like protein 1 / Homo sapiens Q6UWY5
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens Q86WC4
- P2X purinoceptor 4 / Homo sapiens Q99571
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens P55259
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens O95302
- Periostin / Homo sapiens Q15063
- Plexin domain-containing protein 2 / Homo sapiens Q6UX71
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pregnancy zone protein / Homo sapiens P20742
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Probable serine carboxypeptidase CPVL / Homo sapiens Q9H3G5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prostaglandin F2 receptor negative regulator / Homo sapiens Q9P2B2
- Prostaglandin G/H synthase 2 / Homo sapiens P35354
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Protein OS-9 / Homo sapiens Q13438
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens Q9H792
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens P21860
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Rhodopsin / Homo sapiens P08100
- Secreted frizzled-related protein 4 / Homo sapiens Q6FHJ7
- Semaphorin-3F / Homo sapiens Q13275
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens Q5TFQ8
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Soluble calcium-activated nucleotidase 1 / Homo sapiens Q8WVQ1
- Sortilin / Homo sapiens Q99523
- Sparc / Homo sapiens P09486
- Sulfhydryl oxidase 1 / Homo sapiens O00391
- Sushi domain-containing protein 2 / Homo sapiens Q9UGT4
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Tenascin / Homo sapiens P24821
- Tetraspanin-1 / Homo sapiens O60635
- Tetraspanin-3 / Homo sapiens O60637
- Thrombospondin-1 / Homo sapiens P07996
- Tissue factor / Homo sapiens P13726
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transmembrane 9 superfamily member 1 / Homo sapiens O15321
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 87A / Homo sapiens Q8NBN3
- Transmembrane protein 87B / Homo sapiens Q96K49
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tryptase beta-2 / Homo sapiens P20231
- Tumor-associated calcium signal transducer 2 / Homo sapiens P09758
- Tyrosine-protein kinase JAK1 / Homo sapiens P23458
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens P78324
- UPF0577 protein KIAA1324 / Homo sapiens Q6UXG2
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens Q7Z7D3
- V-type proton ATPase 116 kDa subunit a isoform 2 / Homo sapiens Q9Y487
- Vacuolar protein sorting-associated protein 13A / Homo sapiens Q96RL7
- Vitronectin / Homo sapiens P04004
- Zinc fingers and homeoboxes protein 1 / Homo sapiens Q9UKY1
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- 4F2 cell-surface antigen heavy chain / Mus musculus P10852
- Basement membrane-specific heparan sulfate proteoglycan core protein / Mus musculus Q05793
- Carboxypeptidase E / Mus musculus Q00493
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- CD166 antigen / Mus musculus Q61490
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Integrin alpha-6 / Mus musculus Q61739
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-10
- Laminin subunit alpha-2 / Mus musculus Q60675
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Lysosome membrane protein 2 / Mus musculus O35114
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Mucin / Mus musculus
- Myelin-associated glycoprotein / Mus musculus P20917
- Nectin-1 / Mus musculus Q9JKF6
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurocan core protein / Mus musculus P55066
- Neuroplastin / Mus musculus P97300
- Phospholipase D4 / Mus musculus Q8BG07
- Plexin-B2 / Mus musculus B2RXS4
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Ribose-phosphate pyrophosphokinase 1 / Mus musculus Q9D7G0
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Solute carrier family 12 member 9 / Mus musculus Q99MR3
- Synaptophysin-like protein 1 / Mus musculus O09117
- Tetraspanin-3 / Mus musculus Q9QY33
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus Q69ZU6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Rhodopsin / Rana pipiens P31355
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Retina (UBERON_0000966)
- Seminal Fluid (UBERON_0006530)
- Submandibular Gland (UBERON_0001736)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
Source
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-?)"
- N-Linked / Hybrid / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)[Man(a1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 3469
- N-Linked / Hybrid / Structure 3567
- N-Linked / Hybrid / Structure 9526
- N-Linked / Hybrid / Structure 9644
- N-Linked / Hybrid / Structure 10423
- N-Linked / Hybrid / Structure 10485
- N-Linked / Hybrid / Structure 10739
- N-Linked / Hybrid / Structure 10814
- N-Linked / Hybrid / Structure 10886
- N-Linked / Hybrid / Structure 10993
- N-Linked / Hybrid / Structure 11184
Reported structure
- Hex:6 HexNAc:3 NeuAc:1 (avg mass : 1891.7126 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Esophageal cancer (DOID:5041)
- Gastritis (DOID:4029)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena DomÃnguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- Characterization of asparagine-linked oligosaccharides on a mouse submandibular mucin. (1995 - Denny P, Hong-Le N) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Acid ceramidase / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Arylsulfatase D / Homo sapiens
- Attractin / Homo sapiens
- Band 4.1-like protein 3 / Homo sapiens
- Basal cell adhesion molecule / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Basigin / Homo sapiens
- Beta-1,4-galactosyltransferase 3 / Homo sapiens
- Beta-galactosidase / Homo sapiens
-
Cadherin-5 / Homo sapiens
- Undefined site
- Calcium-activated chloride channel regulator 2 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- CD16A-NK08-V/F genotype / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD16A-NK11-F/F genotype / Homo sapiens
- CD16A-NK12-V/F genotype / Homo sapiens
- CD16A-NK13-V/F genotype / Homo sapiens
- CD276 antigen / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Choline transporter-like protein 2 / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(I) chain / Homo sapiens
- Collagen alpha-2(V) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement C2 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- CUB domain-containing protein 1 / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Dynein heavy chain 11, axonemal / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 5 / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Erlin-1 / Homo sapiens
- Erlin-2 / Homo sapiens
- ERO1-like protein beta / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Glycodelin-a / Homo sapiens
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
- Asn-76
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin receptor / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Kallistatin / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lipid phosphate phosphohydrolase 2 / Homo sapiens
- Lumican / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Microtubule-associated protein 10 / Homo sapiens
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myelin protein zero-like protein 2 / Homo sapiens
- N-acetylglucosamine-1-phosphotransferase subunits alpha/beta / Homo sapiens
- Neurocan core protein / Homo sapiens
- Olfactomedin-like protein 1 / Homo sapiens
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens
- P2X purinoceptor 4 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
- Periostin / Homo sapiens
- Plexin domain-containing protein 2 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Prostaglandin G/H synthase 2 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein OS-9 / Homo sapiens
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
-
Rhodopsin / Homo sapiens
- Undefined site
- Secreted frizzled-related protein 4 / Homo sapiens
- Semaphorin-3F / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Soluble calcium-activated nucleotidase 1 / Homo sapiens
- Sortilin / Homo sapiens
- Sparc / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Sushi domain-containing protein 2 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-1 / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue factor / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Transmembrane 9 superfamily member 1 / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
- Transmembrane protein 87B / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- Tumor-associated calcium signal transducer 2 / Homo sapiens
- Tyrosine-protein kinase JAK1 / Homo sapiens
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
- UPF0577 protein KIAA1324 / Homo sapiens
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens
- V-type proton ATPase 116 kDa subunit a isoform 2 / Homo sapiens
- Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Vitronectin / Homo sapiens
- Zinc fingers and homeoboxes protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Uncharacterized protein (gene name abca4) / Bos taurus
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
- 4F2 cell-surface antigen heavy chain / Mus musculus
- Basement membrane-specific heparan sulfate proteoglycan core protein / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Integrin alpha-6 / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
-
Mucin / Mus musculus
- Undefined site
- Myelin-associated glycoprotein / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neuroplastin / Mus musculus
- Phospholipase D4 / Mus musculus
- Plexin-B2 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Ribose-phosphate pyrophosphokinase 1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 9 / Mus musculus
- Synaptophysin-like protein 1 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Rhodopsin / Rana pipiens
- Envelope glycoprotein / Friend murine leukemia virus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NSGALTSGVHTFPAVLQSSGLY (22aa)
- SLSSVVTVPSSSLGTQTY (18aa)
- ESNITVLIK (9aa)
- VIEAVNGTDAR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- WQMNFTVR (8aa)
- EIFVANGTQGK (11aa)
- TGFYGENCSTPEFLTR (16aa)
- DVNCSVMGPQEK (12aa)
- LKPLFNK (7aa)
- YETTNK (6aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- NTTIFLK (7aa)
- FHNESLISSQASSY (14aa)
- P08637 Asn-63     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK12-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK09-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK11-F/F genotype / Homo sapiens
- ATTLDDNGTMLFFKGE (16aa)
- CIQANYSIMENGK (13aa)
- TMFNSTDIK (9aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- NK (2aa)
- NACCSTNTSQEAHK (14aa)
- AIGFENATQAIGR (13aa)
- CPPAVTENK (9aa)
- GQTEIQVNCPPAVTENK (17aa)
- VGVNKNQTVTATFGYPFR (18aa)
- GRDIYTFDGAINK (13aa)
- DIYTFDGAINK (11aa)
- EMITEASFYLFNATK (15aa)
- AEMNGSK (7aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- NQNGTFK (7aa)
- FNQTMQPIITAQNAIIEDDTYR (22aa)
- KAFITNFSMIIDGMTYPGIIK (21aa)
- SYAGFITVNK (10aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- TNHMGNVTFTIPANR (15aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- HMGNVTFTIPANR (13aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- IGQAPANWYNDTYPISPPQR (20aa)
- ALVNFTR (7aa)
- EIIIDFANSSAEITGCIVR (19aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- YCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTK (39aa)
- NCTLLLSTLSPELGGK (16aa)
- GHTITINFTR (10aa)
- GHTLTLNFT (9aa)
- TAIFPDIIAQGNASIR (16aa)
- ANIQFGDNGTTISAVSNK (18aa)
- NYTADYDK (8aa)
- DAMVGNYTCEVTELSR (16aa)
- TAVFADQVIVGNASLR (16aa)
- VCSNDNK (7aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- TQDEIIFSNSTR (12aa)
- QCNQTSVCWCVNSVGVR (17aa)
- HRANATLLLGPLR (13aa)
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- ANATLLLGPLR (11aa)
- NQSVGDPNVDLIR (13aa)
- TQSLLIVNNATNVVIK (16aa)
- VIDFNCTTSSVSSALANTK (19aa)
- VIDFNCTTSSVSSAIANTK (19aa)
- LIQPWNR (7aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- IFQNCSEIFK (10aa)
- FGCEIENNR (9aa)
- LLNLTNPEASTSVLMAVTH (19aa)
- DASINIENMQFIHNGTYICDVK (22aa)
- NNHTASIIDR (10aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- LLFFDNYEHNTSVVKK (16aa)
- VNCSVYVQLEK (11aa)
- GNETIVNLIHSTR (13aa)
- AINSTLSNQSK (11aa)
- GTFTDCALANMTEQIR (16aa)
- DYGSQEDFTQVWNTTMK (17aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- CCGAANYTDWEK (12aa)
- RLRNVSWATGRS (12aa)
- RNVSWATGRS (10aa)
- ACQFNR (6aa)
- CVAFNGSVK (9aa)
- RACQFNR (7aa)
- CCGFTNYTDFEDSPYFK (17aa)
- VNVTVEDER (9aa)
- GWNWTSGFNK (10aa)
- DITDLINNTFIR (12aa)
- FGEFGNYSIIVK (12aa)
- SEIVNETR (8aa)
- NCTIVSPDAGGAK (13aa)
- LNLTTDPK (8aa)
- NQSVPLSCCR (10aa)
- NQSVPISCCR (10aa)
- NRVPDSCCINVTVGCGINFNEK (22aa)
- IVDVNITSEGK (11aa)
- EEQFNSTFR (9aa)
- YHSQTYGNGSK (11aa)
- IIFANVSVR (9aa)
- NPSTNVSVVVFDSTK (15aa)
- CRGLVGSKNVSSE (13aa)
- NNTVWEFANIR (11aa)
- AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- SWPAVGNCSSALR (13aa)
- SWPAVGNCSSAIR (13aa)
- SLTFNETYQDISELVYGAK (19aa)
- DGKPLLNDSR (10aa)
- HMSIAINR (8aa)
- NESLETYPVMK (11aa)
- NYSYVIHAK (9aa)
- KNASNMEYR (9aa)
- NASNMEYR (8aa)
- VINFYAGANQSMNVTCVGKR (20aa)
- VINFYAGANQSMNVTCVGK (19aa)
- NHSIFLADINQER (13aa)
- KNITDIVEGAK (11aa)
- VSVNTANVTIGPQIMEVTVYR (21aa)
- LKGEAEYQEIRNPNGTVTVISR (22aa)
- NFTMNEK (7aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- GINESYKK (8aa)
- GINESYK (7aa)
- VVIGANGTYSCIVR (14aa)
- FSDGIESNSSTQFEVK (16aa)
- EMFNSTYK (8aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- DFQHIINR (8aa)
- NNSIPDK (7aa)
- DFYVDENTTVR (11aa)
- KNNSIPDKQ (9aa)
- QTTAMDFSYANETVCWVHVGDSAAQTQLK (29aa)
- NGSVSRVPVLMESR (14aa)
- HGHFTGFNGSTLR (13aa)
- GTANISETIR (10aa)
- KDNTTVTR (8aa)
- HANWTLTPLK (10aa)
- NIETNYTR (8aa)
- VASVININPNTTHSTGSCR (19aa)
- FPQVNVTK (8aa)
- IININPNK (8aa)
- NLSEDR (6aa)
- GSISYINVTR (10aa)
- AIMNGSESR (9aa)
- VTQQSPTSMNQVNLTCR (17aa)
- LNSSTIK (7aa)
- NFSSHINR (8aa)
- ATVFANGSIIITQVRPR (17aa)
- ANHSGAVVLLKR (12aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- NVSVAEGK (8aa)
- YHYNGTIIDGTIFDSSYSR (19aa)
- NQTHAIYK (8aa)
- VIYQNHNK (8aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- ACPLDPATNK (10aa)
- ITNISAVEMTPIPTCIQFNR (20aa)
- IGPGEPIEIICNVSGAIPPAGR (22aa)
- MDPPCTNTTAASTYINNPYVR (21aa)
- EIGPIYTNITADIGTDPR (18aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- NATRF (5aa)
- YFWYHNDTLLDPSLYK (16aa)
- QAIHVGNQTFNDGTIVEK (18aa)
- IEDNGLKNST (10aa)
- FQTVDSSNIDGFVNCTK (17aa)
- VQPFNVTQGK (10aa)
- KVSCPIMPCSNATVPDGECCPR (22aa)
- VQPFNVTK (8aa)
- NATVVWMK (8aa)
- DASSFIAEWQNITK (14aa)
- NFSSCSAEDFEK (12aa)
- QVVENMTR (8aa)
- ANYTILK (7aa)
- HIYTTTGGETDFTNVTSIR (19aa)
- SINTTNVMGTSLTVR (15aa)
- VGVHINNTQTK (11aa)
- TQNFTIIVQGSPEIK (15aa)
- MFSNCSK (7aa)
- NNVITINITGK (11aa)
- KVPGNVTAVLGETLKV (16aa)
- NGSAAMCHFTTK (12aa)
- IIISPEENVTLTCTAENQLER (21aa)
- IIISPEENVTITCTAENQIER (21aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- WNNTGCQALPSQDEGPSK (18aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- SVYNCSGEACR (11aa)
- MVIWNDSVVR (10aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- LDFIILNETK (10aa)
- NNSWVK (6aa)
- SCVAVTSAQPQNMSR (15aa)
- VMSWWDYGYQITAMANR (17aa)
- YIHQNYTK (8aa)
- NGIYNITVIASDQGGR (16aa)
- AAIPSAIDTNSSK (13aa)
- NLSDSLAR (8aa)
- EVNDTLLVNELK (12aa)
- VMSWWDYGYQIAGMANR (17aa)
- QSVPAHFVAINGSK (14aa)
- TTIVDNNTWNNSHIAIVGK (19aa)
- AINDTAAR (8aa)
- TLNCSGAHVK (10aa)
- QGFYPILNATVTATVEPETGDPVTLR (26aa)
- AMSSNETAAYK (11aa)
- NCSAACPGLQLSNNPVK (17aa)
- IINNITSIK (9aa)
- ADFGNHTK (8aa)
- TPIVQEVHQNFSAWCSQVVR (20aa)
- MSVCTDNVTDLR (12aa)
- NFTIS (5aa)
- LSHDGNETLPLHLYVK (16aa)
- IHVTIYNCSFGR (12aa)
- NLSVAADK (8aa)
- NMTLFSDLVAEK (12aa)
- NDTLQEAK (8aa)
- NVTAQICIDK (10aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGR (32aa)
- SIGNVNFTVSAEAIESQEICGTEVPSVPEHGR (32aa)
- NATLAEQAK (9aa)
- GISPGNYSVR (10aa)
- AEPPINASASDQGEK (15aa)
- ENQNHSYSIK (10aa)
- VLNYLNETQQLTQEIK (16aa)
- INYSIPTGQWVGVQIPR (17aa)
- NTTSYVLR (8aa)
- EAESIQPMTVVGTDYVFHNDTK (22aa)
- GNLSFDWYIK (10aa)
- NLSEIK (6aa)
- P25391 Asn-2098     Laminin subunit alpha-1 / Homo sapiens
- Q9Y2J2 Asn-734     Band 4.1-like protein 3 / Homo sapiens
- P24043 Asn-2126     Laminin subunit alpha-2 / Homo sapiens
- Q9H792 Asn-589     Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Q96RL7 Asn-1071     Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Q96DT5 Asn-3201     Dynein heavy chain 11, axonemal / Homo sapiens
- O60566 Asn-983     Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- Q9P2G4 Asn-694     Microtubule-associated protein 10 / Homo sapiens
- VPAQEKNF (8aa)
- GEYFVNVTTR (10aa)
- CENLTTGK (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VNNTISSQISR (11aa)
- AAQNLTVPGGLR (12aa)
- LLANYASQNITYHCK (15aa)
- NISCVVSDGSAEDFSK (16aa)
- TRNISCVVSDGSAEDFSK (18aa)
- FYFGGSPISAQYANFTGCISNAYFTR (26aa)
- EASQNITYICK (11aa)
- SNQTLSLFFTVLQDVPVR (18aa)
- TGHNVTVVQ (9aa)
- DNTTCYEFK (9aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- ITVHGNGSLDIR (12aa)
- MIEAYNITEK (10aa)
- TCVSNCTASQFVCK (14aa)
- FVEGSHNSTVSLTTK (15aa)
- KFVEGSHNSTVSLTTKN (17aa)
- YDFNSSMLYSTAK (13aa)
- SLTQGSLIVGDLAPVNGTSQGK (22aa)
- LNGTDPIVAADSKR (14aa)
Mass spectrometry observed peptide
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
-
Cadherin-5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Retina (UBERON_0000966)
- Rhodopsin / Rana pipiens
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Bone Marrow (UBERON_0002371)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Urine (UBERON_0001088)
- Eveline (CVCL_A1LI)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
- Asn-76
- T-cell surface glycoprotein cd4 / Homo sapiens
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
-
Mucin / Mus musculus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Blood Plasma (UBERON_0001969)
- Bone Marrow (UBERON_0002371)
- Eveline (CVCL_A1LI)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Amniotic Fluid (UBERON_0000173)
- Glycodelin-a / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Retina (UBERON_0000966)
- HEK293-F (CVCL_6642)
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- NSGALTSGVHTFPAVLQSSGLY (22aa)
- SLSSVVTVPSSSLGTQTY (18aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- HEK293 (CVCL_0045)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- CD16A-NK08-V/F genotype / Homo sapiens
- CD16A-NK09-V/F genotype / Homo sapiens
- CD16A-NK11-F/F genotype / Homo sapiens
- CD16A-NK12-V/F genotype / Homo sapiens
- CD16A-NK13-V/F genotype / Homo sapiens
- Complement c3 / Homo sapiens
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FHNESLISSQASSY (14aa)
- P08637 Asn-63     CD16A-NK13-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK12-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK08-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK09-V/F genotype / Homo sapiens
- P08637 Asn-63     CD16A-NK11-F/F genotype / Homo sapiens
- TQSLLIVNNATNVVIK (16aa)
- CRGLVGSKNVSSE (13aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Blood Plasma (UBERON_0001969)
- Vitronectin / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Milk (UBERON_0001913)
- Apolipoprotein B-100 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- RNVSWATGRS (10aa)
- RLRNVSWATGRS (12aa)
- KNNSIPDKQ (9aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KFVEGSHNSTVSLTTKN (17aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Ascitic fluid (UBERON_0007795)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Ascitic fluid (UBERON_0007795)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Blood Plasma (UBERON_0001969)
- Control/Healthy
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
-
- N-Linked / Hybrid
(avg mass : 1891.7126)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- Hex:6 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1891.7126)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Retina (UBERON_0000966)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- Jurkat (CVCL_0065)
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc(a2-?)"
- N-Linked / Hybrid / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-3)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)[Man(a1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 3469
- N-Linked / Hybrid / Structure 3567
- N-Linked / Hybrid / Structure 9526
- N-Linked / Hybrid / Structure 9644
- N-Linked / Hybrid / Structure 10423
- N-Linked / Hybrid / Structure 10485
- N-Linked / Hybrid / Structure 10739
- N-Linked / Hybrid / Structure 10814
- N-Linked / Hybrid / Structure 10886
- N-Linked / Hybrid / Structure 10993
- N-Linked / Hybrid / Structure 11184
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Acid ceramidase / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Arylsulfatase D / Homo sapiens
- Attractin / Homo sapiens
- Band 4.1-like protein 3 / Homo sapiens
- Basal cell adhesion molecule / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- Basigin / Homo sapiens
- Beta-1,4-galactosyltransferase 3 / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Calcium-activated chloride channel regulator 2 / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- CD276 antigen / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Choline transporter-like protein 2 / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(I) chain / Homo sapiens
- Collagen alpha-2(V) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement C2 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- CUB domain-containing protein 1 / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Dynein heavy chain 11, axonemal / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 5 / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Erlin-1 / Homo sapiens
- Erlin-2 / Homo sapiens
- ERO1-like protein beta / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin receptor / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Kallistatin / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-1 / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lipid phosphate phosphohydrolase 2 / Homo sapiens
- Lumican / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Microtubule-associated protein 10 / Homo sapiens
- Mitotic checkpoint serine/threonine-protein kinase BUB1 beta / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myelin protein zero-like protein 2 / Homo sapiens
- N-acetylglucosamine-1-phosphotransferase subunits alpha/beta / Homo sapiens
- Neurocan core protein / Homo sapiens
- Olfactomedin-like protein 1 / Homo sapiens
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens
- P2X purinoceptor 4 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
- Periostin / Homo sapiens
- Plexin domain-containing protein 2 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin F2 receptor negative regulator / Homo sapiens
- Prostaglandin G/H synthase 2 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein OS-9 / Homo sapiens
- Pseudopodium-enriched atypical kinase 1 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Secreted frizzled-related protein 4 / Homo sapiens
- Semaphorin-3F / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Soluble calcium-activated nucleotidase 1 / Homo sapiens
- Sortilin / Homo sapiens
- Sparc / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Sushi domain-containing protein 2 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-1 / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Tissue factor / Homo sapiens
- Transmembrane 9 superfamily member 1 / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
- Transmembrane protein 87B / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- Tumor-associated calcium signal transducer 2 / Homo sapiens
- Tyrosine-protein kinase JAK1 / Homo sapiens
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
- UPF0577 protein KIAA1324 / Homo sapiens
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens
- V-type proton ATPase 116 kDa subunit a isoform 2 / Homo sapiens
- Vacuolar protein sorting-associated protein 13A / Homo sapiens
- Zinc fingers and homeoboxes protein 1 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Uncharacterized protein (gene name abca4) / Bos taurus
- 4F2 cell-surface antigen heavy chain / Mus musculus
- Basement membrane-specific heparan sulfate proteoglycan core protein / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Integrin alpha-6 / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Nectin-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neuroplastin / Mus musculus
- Phospholipase D4 / Mus musculus
- Plexin-B2 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Ribose-phosphate pyrophosphokinase 1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 9 / Mus musculus
- Synaptophysin-like protein 1 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- ESNITVLIK (9aa)
- VIEAVNGTDAR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- WQMNFTVR (8aa)
- EIFVANGTQGK (11aa)
- TGFYGENCSTPEFLTR (16aa)
- DVNCSVMGPQEK (12aa)
- LKPLFNK (7aa)
- YETTNK (6aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- NTTIFLK (7aa)
- ATTLDDNGTMLFFKGE (16aa)
- CIQANYSIMENGK (13aa)
- TMFNSTDIK (9aa)
- NK (2aa)
- NACCSTNTSQEAHK (14aa)
- AIGFENATQAIGR (13aa)
- CPPAVTENK (9aa)
- GQTEIQVNCPPAVTENK (17aa)
- VGVNKNQTVTATFGYPFR (18aa)
- GRDIYTFDGAINK (13aa)
- DIYTFDGAINK (11aa)
- EMITEASFYLFNATK (15aa)
- AEMNGSK (7aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- NQNGTFK (7aa)
- FNQTMQPIITAQNAIIEDDTYR (22aa)
- KAFITNFSMIIDGMTYPGIIK (21aa)
- SYAGFITVNK (10aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- TNHMGNVTFTIPANR (15aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- HMGNVTFTIPANR (13aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- IGQAPANWYNDTYPISPPQR (20aa)
- ALVNFTR (7aa)
- EIIIDFANSSAEITGCIVR (19aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- YCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTK (39aa)
- NCTLLLSTLSPELGGK (16aa)
- GHTITINFTR (10aa)
- GHTLTLNFT (9aa)
- TAIFPDIIAQGNASIR (16aa)
- ANIQFGDNGTTISAVSNK (18aa)
- NYTADYDK (8aa)
- DAMVGNYTCEVTELSR (16aa)
- TAVFADQVIVGNASLR (16aa)
- VCSNDNK (7aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- TQDEIIFSNSTR (12aa)
- QCNQTSVCWCVNSVGVR (17aa)
- HRANATLLLGPLR (13aa)
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- ANATLLLGPLR (11aa)
- NQSVGDPNVDLIR (13aa)
- TQSLLIVNNATNVVIK (16aa)
- VIDFNCTTSSVSSALANTK (19aa)
- VIDFNCTTSSVSSAIANTK (19aa)
- LIQPWNR (7aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- IFQNCSEIFK (10aa)
- FGCEIENNR (9aa)
- LLNLTNPEASTSVLMAVTH (19aa)
- DASINIENMQFIHNGTYICDVK (22aa)
- NNHTASIIDR (10aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- LLFFDNYEHNTSVVKK (16aa)
- VNCSVYVQLEK (11aa)
- GNETIVNLIHSTR (13aa)
- AINSTLSNQSK (11aa)
- GTFTDCALANMTEQIR (16aa)
- DYGSQEDFTQVWNTTMK (17aa)
- CCGAANYTDWEK (12aa)
- ACQFNR (6aa)
- CVAFNGSVK (9aa)
- RACQFNR (7aa)
- CCGFTNYTDFEDSPYFK (17aa)
- VNVTVEDER (9aa)
- GWNWTSGFNK (10aa)
- DITDLINNTFIR (12aa)
- FGEFGNYSIIVK (12aa)
- SEIVNETR (8aa)
- NCTIVSPDAGGAK (13aa)
- LNLTTDPK (8aa)
- NQSVPLSCCR (10aa)
- NQSVPISCCR (10aa)
- NRVPDSCCINVTVGCGINFNEK (22aa)
- IVDVNITSEGK (11aa)
- EEQFNSTFR (9aa)
- YHSQTYGNGSK (11aa)
- IIFANVSVR (9aa)
- NPSTNVSVVVFDSTK (15aa)
- NNTVWEFANIR (11aa)
- AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- SWPAVGNCSSALR (13aa)
- SWPAVGNCSSAIR (13aa)
- SLTFNETYQDISELVYGAK (19aa)
- DGKPLLNDSR (10aa)
- HMSIAINR (8aa)
- NESLETYPVMK (11aa)
- NYSYVIHAK (9aa)
- KNASNMEYR (9aa)
- NASNMEYR (8aa)
- VINFYAGANQSMNVTCVGKR (20aa)
- VINFYAGANQSMNVTCVGK (19aa)
- NHSIFLADINQER (13aa)
- KNITDIVEGAK (11aa)
- VSVNTANVTIGPQIMEVTVYR (21aa)
- LKGEAEYQEIRNPNGTVTVISR (22aa)
- NFTMNEK (7aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- GINESYKK (8aa)
- GINESYK (7aa)
- VVIGANGTYSCIVR (14aa)
- FSDGIESNSSTQFEVK (16aa)
- EMFNSTYK (8aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:3 NeuAc:1 / N-Linked
(avg mass : 1891.7126)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1891.7126)