Hex:10 HexNAc:6 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• CD59 glycoprotein / Homo sapiens    P13987
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Uncharacterized protein from Plasma Membrane / Bos taurus
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Urine (UBERON_0001088)  
• HEK293 (CVCL_0045)  
• Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-3)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:10 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 3296.0102 )

Disease

• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• The asparagine-linked sugar chains of the glycoproteins in calf thymocyte plasma membrane. Structural studies of acidic oligosaccharides. (1980 - Yoshima H, Takasaki S, Kobata A) / Status : Reviewed

Reported glycosite

• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Uncharacterized protein from Plasma Membrane / Bos taurus
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-615
  •        Asn-1098

Mass spectrometry observed peptide

• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-615
• EGVFVSNGT (9aa)
  •    P0DTC2    Asn-1098