Hex:10 HexNAc:9

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens    P32942
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens    P05026
• Lysosome-associated membrane glycoprotein 1 / Mus musculus    P11438
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• 3Y1-B clone 1 (CVCL_4563)  
• HEK293 (CVCL_0045)  
• T-Lymphocyte (CL_0000084)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)GlcNAc(b1-3)"
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Gal(b1-4)GlcNAc(b1-3)"

Composition

• Hex:10 HexNAc:9 (avg mass : 3468.1943 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50). (2001 - Funatsu O, Sato T, Kotovuori P, Gahmberg CG, Ikekita M, Furukawa K) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-381
• Intercellular adhesion molecule-3 (CD50) / Homo sapiens
  •        Undefined site
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-261
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
  •        Asn-265
• Lysosome-associated membrane glycoprotein 1 / Mus musculus
  •        Asn-78
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-657

Mass spectrometry observed peptide

• ENVSDPSLTITFGR (14aa)
  •    P11438    Asn-78
• SNIIRGWIFGTTLDSKTQSLLIVNNATNVVIK (32aa)
  •    P0DTC2    Asn-122
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• IININPNK (8aa)
  •    P11279    Asn-261
• YIQPIIAVQFTNITMDTEIR (20aa)
  •    P05026    Asn-265
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• IIIAGTNSSDIQQIISIIESNK (22aa)
  •    P08195    Asn-381
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657