taxonomy (12)
protein (47)
source (22)
structure (12)
composition (1)
disease (6)
reference (29)
site (68)
peptide (51)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
- Apis mellifera (Honeybee)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Apolipoprotein d / Homo sapiens P05090
- Calumenin / Homo sapiens O43852
- Carboxypeptidase D / Homo sapiens O75976
- Cathepsin D / Homo sapiens P07339
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-6(VI) chain / Homo sapiens A6NMZ7
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01861 P01859
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin j chain / Homo sapiens P01591
- Interferon gamma / Homo sapiens P01579
- Mucin-2 / Homo sapiens Q02817
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Protein AMBP / Homo sapiens P02760
- Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Reticulocalbin-3 / Homo sapiens Q96D15
- Thrombospondin-1 / Homo sapiens P07996
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Isoform 3 of Neuroplastin / Mus musculus P97300-3
- Neprilysin / Mus musculus Q61391
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Immunoglobulin gamma / Oryctolagus cuniculus
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Uncharacterized protein from Endothelial Cell / Sus scrofa
- Immunoglobulin y / Coturnix coturnix japonica
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Ovotransferrin / Gallus gallus P02789
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein from Egg Cell / Gallus gallus
- Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Aorta (UBERON_0000947) MYP30 (CVCL_Z591) Endothelial Cell (CL_0000115)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colonic Mucosa (UBERON_0000317)
- Glomerular Basement Membrane (UBERON_0005777)
- Mammary Gland (UBERON_0001911)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Pituitary Gland (UBERON_0000007)
- Royal Jelly
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Egg Cell
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-4)]Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-6)]Man(a1-6)[GlcNAc(?1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
- O-Linked / Core 3 / GalNAc(a1-3)Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc
Reported structure
- Hex:3 HexNAc:5 (avg mass : 1520.4175 )
Composition
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Diverticulosis (DOID:7475)
- Gaucher Disease (DOID:1926)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Prostate cancer (DOID:10283)
Disease
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Derivatization and purification of bisecting tyrosinamide-oligosaccharides from ovotransferrin. (1994 - Corradi da Silva M, Tamura T, Rice K) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
Reference
- Apolipoprotein d / Homo sapiens
- Calumenin / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Cathepsin D / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-322
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin j chain / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
-
Mucin-2 / Homo sapiens
- Undefined site
- Prenylcysteine oxidase 1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein AMBP / Homo sapiens
- Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Neprilysin / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Endothelial Cell / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Ovotransferrin / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- NYNTNITEENVQNMNNAGDK (20aa)
- NTNITEENVQNMNNAGDK (18aa)
- FSNVTWF (7aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- FHAIHVSGTNGTKRF (15aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- QQNGSSVLSEDK (12aa)
- QQNGSSVLS (9aa)
- ANATIEVK (8aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIKVCE (19aa)
- IVNNATNVVIKVCEF (15aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- SSANNCTFEYVSQPF (15aa)
- EEQYNSTYR (9aa)
- TPLTANITK (9aa)
- VLINFFVGTDDKNSTQHIIHFDQPR (25aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
- LAYATINDSR (10aa)
- GSLSYLNVTRK (11aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- VIYQNHNK (8aa)
- VSVGLPNMTQGF (12aa)
- VSVGLPNMTQ (10aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- VSVGLPNMTQGFW (13aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- GEINTSIFSSRPIDK (15aa)
- VGVHINNTQTK (11aa)
- CDISNSTEAGQK (12aa)
- LYQDVNCT (8aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NVSDIIPR (8aa)
- GIINATISVAEINHPVTTYK (20aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVS (37aa)
- EGVFVSN (7aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- NLQVYNATSNSLTVK (15aa)
- AEFNLTTYR (9aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex (avg mass : 1520.4175)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
-
Uncharacterized protein from Endothelial Cell / Sus scrofa
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
-
Uncharacterized protein from Endothelial Cell / Sus scrofa
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
-
Uncharacterized protein from Endothelial Cell / Sus scrofa
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
-
Interferon gamma / Homo sapiens
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
- Spleen (UBERON_0002106)
- Egg Cell
- Gaucher Disease (DOID:1926)
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
- Egg Cell
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
- Ovary (UBERON_0000992) IM4/V/IV (CVCL_VT67)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
-
Interferon gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
-
Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
- Blood Serum (UBERON_0001977)
- Glomerular Basement Membrane (UBERON_0005777)
- Royal Jelly
- Spleen (UBERON_0002106)
- Egg Cell
- Microsome (GO_0005792)
- Yolk (GO_0060417)
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Derivatization and purification of bisecting tyrosinamide-oligosaccharides from ovotransferrin. (1994 - Corradi da Silva M, Tamura T, Rice K) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Ovotransferrin / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
- N-Linked / Complex (avg mass : 1520.4175)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- O-Linked / Core 3 (avg mass : 1520.4175)
- Colonic Mucosa (UBERON_0000317)
- Diverticulosis (DOID:7475)
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
-
Mucin-2 / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:5 / N-Linked (avg mass : 1520.4175)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-4)]Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-6)]Man(a1-6)[GlcNAc(?1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Apolipoprotein d / Homo sapiens
- Calumenin / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Cathepsin D / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin j chain / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Isoform 3 of Neuroplastin / Mus musculus
- Neprilysin / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- NYNTNITEENVQNMNNAGDK (20aa)
- NTNITEENVQNMNNAGDK (18aa)
- FSNVTWF (7aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- FHAIHVSGTNGTKRF (15aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- QQNGSSVLSEDK (12aa)
- QQNGSSVLS (9aa)
- ANATIEVK (8aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIKVCE (19aa)
- IVNNATNVVIKVCEF (15aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- VCEFQFCNDPFLGVYYHKNNK (21aa)
- SSANNCTFEYVSQPF (15aa)
- EEQYNSTYR (9aa)
- TPLTANITK (9aa)
- VLINFFVGTDDKNSTQHIIHFDQPR (25aa)
- LAYATINDSR (10aa)
- GSLSYLNVTRK (11aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- VIYQNHNK (8aa)
- VSVGLPNMTQGF (12aa)
- VSVGLPNMTQ (10aa)
- GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
- VSVGLPNMTQGFW (13aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- GEINTSIFSSRPIDK (15aa)
- VGVHINNTQTK (11aa)
- CDISNSTEAGQK (12aa)
- LYQDVNCT (8aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NVSDIIPR (8aa)
- GIINATISVAEINHPVTTYK (20aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVS (37aa)
- EGVFVSN (7aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- NLQVYNATSNSLTVK (15aa)
- AEFNLTTYR (9aa)
-
- Hex:3 HexNAc:5 / O-Linked (avg mass : 1520.4175)
- Urine (UBERON_0001088)
- Prostate cancer (DOID:10283)
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein AMBP / Homo sapiens
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
Source
Disease
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Reference
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
Source
Disease
Reference
Reported glycosite
Disease
Reported glycosite
Disease
Reported glycosite
Disease
Reported glycosite
Source
Disease
Reported glycosite
