Hex:3 HexNAc:5

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Dirofilaria immitus (Canine heartworm nematode)
• Trichinella spiralis
• Apis mellifera (Honeybee)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Apolipoprotein D / Homo sapiens    P05090
• Calumenin / Homo sapiens    O43852
• Carboxypeptidase D / Homo sapiens    O75976
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cathepsin D / Homo sapiens    P07339
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-6(VI) chain / Homo sapiens    A6NMZ7
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01876    P01877
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Interferon gamma / Homo sapiens    P01579
• Mucin-2 / Homo sapiens    Q02817
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein AMBP / Homo sapiens    P02760
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Thrombospondin-1 / Homo sapiens    P07996
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Isoform 3 of Neuroplastin / Mus musculus    P97300-3
• Neprilysin / Mus musculus    Q61391
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Immunoglobulin gamma / Oryctolagus cuniculus    
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Uncharacterized protein from Aorta / Sus scrofa    
• Immunoglobulin y / Coturnix coturnix japonica    
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Ovotransferrin / Gallus gallus    P02789
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Uncharacterized protein / Dirofilaria immitus    
• Tsl-1 antigens / Trichinella spiralis    
• Uncharacterized protein from Royal Jelly / Apis mellifera    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Aorta (UBERON_0000947)   MYP30 (CVCL_Z591)   Endothelial Cell (CL_0000115)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Colonic Mucosa (UBERON_0000317)  
• Colostrum (UBERON_0001914)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Pituitary Gland (UBERON_0000007)  
• Royal Jelly  
• Spleen (UBERON_0002106)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Egg Cell  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-4)]Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-6)]Man(a1-6)[GlcNAc(?1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-4)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
• N-Linked / Complex / Structure 9446
• N-Linked / Complex / Structure 10031
• N-Linked / Complex / Structure 10152
• N-Linked / Complex / Structure 10208
• O-Linked / Core 3 / GalNAc(a1-3)Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc

Composition

• Hex:3 HexNAc:5 (avg mass : 1520.4175 )

Disease

• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diverticulosis (DOID:7475)
• Gastritis (DOID:4029)
• Gaucher Disease (DOID:1926)
• Myeloma, Multiple (DOID:9538)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Prostate cancer (DOID:10283)

Reference

• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Derivatization and purification of bisecting tyrosinamide-oligosaccharides from ovotransferrin. (1994 - Corradi da Silva M, Tamura T, Rice K) / Status : Reviewed
• Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed

Reported glycosite

• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Calumenin / Homo sapiens
  •        Asn-131
• Carboxypeptidase D / Homo sapiens
  •        Asn-811
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cathepsin D / Homo sapiens
  •        Asn-263
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Collagen alpha-6(VI) chain / Homo sapiens
  •        Asn-2034
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-119
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
  •        Asn-144
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Thr-117
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
  •        Asn-322
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Interferon gamma / Homo sapiens
  •        Undefined site
• Mucin-2 / Homo sapiens
  •        Undefined site
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-353
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Ser-67
  •        Asn-78
• Protein AMBP / Homo sapiens
  •        Thr-252
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-436
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
• Isoform 3 of Neuroplastin / Mus musculus
  •        Asn-112
• Neprilysin / Mus musculus
  •        Asn-211
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Aorta / Sus scrofa
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Ovotransferrin / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Dirofilaria immitus
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-1098

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RENISDPTSPLRT (13aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
  •    P41222    Ser-67     Prostaglandin-h2 d-isomerase / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• ANATIEVK (8aa)
  •    P97300-3    Asn-112     Isoform 3 of Neuroplastin / Mus musculus
• HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
  •    P01876    Thr-117     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119     Dipeptidyl peptidase 1 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131     Calumenin / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •    P01876    Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
  •    P01877    Asn-144     Immunoglobulin alpha (non secretory) / Homo sapiens
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• VCEFQFCNDPFLGVYYHKNNK (21aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEYVSQPF (15aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EEQYNSTYR (9aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• KTKPREEQYNSTYRV (15aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• VLINFFVGTDDKNSTQHIIHFDQPR (25aa)
  •    Q61391    Asn-211     Neprilysin / Mus musculus
• YFYNGTSMACETFQYGGCMGNGNNFVTEKECLQTCR (36aa)
  •    P02760    Thr-252     Protein AMBP / Homo sapiens
• LAYATINDSR (10aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• GFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSK (39aa)
  •    P01860    Asn-322     Immunoglobulin heavy constant gamma 3 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GEINTSIFSSRPIDK (15aa)
  •    Q9UHG3    Asn-353     Prenylcysteine oxidase 1 / Homo sapiens
• VGVHINNTQTK (11aa)
  •    Q9CPW0    Asn-436     Contactin-associated protein-like 2 / Mus musculus
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GIINATISVAEINHPVTTYK (20aa)
  •    O75976    Asn-811     Carboxypeptidase D / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVS (37aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSN (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• AEFNLTTYR (9aa)
  •    A6NMZ7    Asn-2034     Collagen alpha-6(VI) chain / Homo sapiens