Hex:3 HexNAc:4 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Physomitrella patens
• Torpedo californica (Pacific electric ray)
• Trichinella spiralis
• Apis mellifera (Honeybee)
• Drosophila melanogaster (Fruit fly)
• Bothrops moojeni (Brazilian lancehead)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens    Q16880
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens    P30533
• Alpha-fetoprotein / Homo sapiens    P02771
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens    Q12797
• Beta-secretase-fc fusion protein / Homo sapiens    P56817
• Biglycan / Homo sapiens    P21810
• Calreticulin / Homo sapiens    P27797
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens
• Cap-gly domain-containinglinker protein 1 / Homo sapiens    P30622
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens    Q96KA5
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Cysteine-rich with EGF-like domain protein 2 / Homo sapiens    Q6UXH1
• Decorin / Homo sapiens    P07585
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Endoplasmin / Homo sapiens    P14625
• Epidermal growth factor receptor / Homo sapiens    P00533
• Erythropoietin / Homo sapiens    P01588
• Fibronectin / Homo sapiens    P02751
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Glucosidase 2 subunit beta / Homo sapiens    P14314
• Glycodelin-a / Homo sapiens    P09466
• Glycoprotein rg / Homo sapiens
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• IgG-IL2 fusion protein / Homo sapiens    P60568
• Immunoglobulin gamma / Homo sapiens    P01857    P01860    P01861    P01859
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon gamma / Homo sapiens    P01579
• Lactotransferrin / Homo sapiens    P02788
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Major prion protein / Homo sapiens    P04156
• Mammaglobin-A / Homo sapiens    Q13296
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Myeloperoxidase / Homo sapiens    P05164
• Neuroserpin / Homo sapiens    Q99574
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Periostin / Homo sapiens    Q15063
• Plasma kallikrein / Homo sapiens    P03952
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Procollagen galactosyltransferase 1 / Homo sapiens    Q8NBJ5
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens    O60568
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Recombinant plasminogen - [r580s] / Homo sapiens    P00750
• Reticulocalbin-1 / Homo sapiens    Q15293
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Serpin h1 / Homo sapiens    P50454
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens    Q9NYZ4
• Signal transducer CD24 / Homo sapiens    P25063
• SUN domain-containing protein 2 / Homo sapiens    Q9UH99
• Thrombospondin-1 / Homo sapiens    P07996
• Thyroglobulin / Homo sapiens    P01266
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane emp24 domain-containing protein 9 / Homo sapiens    Q9BVK6
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens    P29965
• Uncharacterized protein from Serum / Homo sapiens
• Unspecified mucin / Homo sapiens
• Uromodulin / Homo sapiens    P07911
• Vesicular integral-membrane protein VIP36 / Homo sapiens    Q12907
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Immunoglobulin gamma / Bos taurus
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Uncharacterized protein from Zona Pellucida / Bos taurus
• Zona pellucida sperm-binding protein 2 / Bos taurus    Q9BH10
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cyclin-G-associated kinase / Mus musculus    Q99KY4
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Endoplasmin / Mus musculus    P08113
• Fibulin-5 / Mus musculus    Q9WVH9
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
• Hypoxia up-regulated protein 1 / Mus musculus    Q9JKR6
• Immunoglobulin gamma / Mus musculus
• Immunoglobulin gamma-1 / Mus musculus    P01868
• Immunoglobulin gamma-1 heterodimer / Mus musculus    P01868
• Immunoglobulin gamma-1 homodimer / Mus musculus    P01868
• Immunoglobulin gamma-2a heavy chain / Mus musculus
• Immunoglobulin gamma-2b / Mus musculus
• Immunoglobulin gamma-2b heterodimer / Mus musculus
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Laminin subunit beta-2 / Mus musculus    Q61292
• Laminin subunit gamma-1 / Mus musculus    P02468
• Monoclonal antibody okt3 / Mus musculus
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus    Q9Z2L6
• Neurofascin / Mus musculus    Q810U3
• Neuronal pentraxin-1 / Mus musculus    Q62443
• Noelin / Mus musculus    O88998
• Prenylcysteine oxidase / Mus musculus    Q9CQF9
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Prostaglandin-H2 D-isomerase / Mus musculus    O09114
• Protein disulfide-isomerase TMX3 / Mus musculus    Q8BXZ1
• Reticulocalbin-1 / Mus musculus    Q05186
• Reticulocalbin-3 / Mus musculus    Q8BH97
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus    P14094
• SPARC / Mus musculus    P07214
• Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus    Q6GQT6
• Tenascin-r / Mus musculus    Q8BYI9
• Testican-2 / Mus musculus    Q9ER58
• Tetraspanin-2 / Mus musculus    Q922J6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Transmembrane emp24 domain-containing protein 4 / Mus musculus    Q8R1V4
• Transmembrane emp24 domain-containing protein 9 / Mus musculus    Q99KF1
• Uncharacterized protein from Brainstem / Mus musculus
• Uncharacterized protein from Cerebellum / Mus musculus
• Uncharacterized protein from Telencephalon / Mus musculus
• Uncharacterized protein from Telencephalon / Mus musculus
• Vesicular integral-membrane protein VIP36 / Mus musculus    Q9DBH5
• VIP36-like protein / Mus musculus    P59481
• Zona pellucida sperm-binding protein matrix / Mus musculus    P10761    Q62005    P20239
• Immunoglobulin gamma / Oryctolagus cuniculus
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Mrc ox-45 surface antigen / Rattus norvegicus    P10252
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Mucin / Sus scrofa
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Uncharacterized protein from Whole Plant / Physomitrella patens
• Acetylcholine receptor protein / Torpedo californica    P02712    P02714    P02718    P02710
• Tsl-1 antigens / Trichinella spiralis
• Uncharacterized protein from Whole Organism / Trichinella spiralis
• Hyaluronoglucosaminidase / Apis mellifera    Q08169
• Phospholipase a2 / Apis mellifera    P00630
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
• Batroxobin / Bothrops moojeni
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Brainstem (UBERON_0002298)  
• Cerebellum (UBERON_0002037)  
• Electric Organ (UBERON_0006869)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21A (CVCL_RQ70)  
• Kidney (UBERON_0002113)   COS-1 (CVCL_0223)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293T (CVCL_0063)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Mammary Gland (UBERON_0001911)  
• Neurohypophysis (UBERON_0002198)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO Pro-5 (CVCL_4382)  
• Ovary (UBERON_0000992)   CHO-K1 (CVCL_0214)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)   Lec2 (CVCL_3442)  
• Ovary (UBERON_0000992)   Lec8 (CVCL_3443)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Pulmonary Mucosa  
• Seminal Fluid (UBERON_0006530)  
• Spleen (UBERON_0002106)  
• Telencephalon (UBERON_0001893)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• Zona Pellucida (UBERON_0000086)  
• 15B (CVCL_VU59)  
• 26A7 (CVCL_VU60)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Hybrid 27-1 (CVCL_VU61)  
• J558L (CVCL_3949)  
• NS0 (CVCL_3940)  
• P3X63Ag8 (CVCL_3411)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Sp2/HL-BU (CVCL_VT74)  

Reported structure

• N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(b1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / Structure 2643
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ 2 x GlcNAc"
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
• N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)][Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
• N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
• N-Linked / Undefined core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc + " + 2x HexNAc + Fuc "
• O-Linked / Core 2 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 4 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-3)]GalNAc
• O-Linked / Core 4 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)]GalNAc

Composition

• Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )

Disease

• Arthritis (DOID:848)
• Arthritis, Rheumatoid (DOID:7148)
• Bronchiectasis, due to Kartagener's Syndrome
• Cancer, breast (DOID:1612)
• Cancer, Ovarian (Cystic) (DOID:2394)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)
• Esophageal cancer (DOID:5041)
• Gaucher Disease (DOID:1926)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Oral squamous cell carcinoma (DOID:0050866)
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
• Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
• In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
• Carbohydrate release from picomole quantities of glycoprotein and characterisation of glycans by high-performance liquid chromatography and mass spectrometry. (1999 - Charlwood J, Birrell H, Camilleri P) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
• Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
• A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Isolation and structural characterization of novel neutral oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. 1. Structure of 11 oligosaccharides having the GlcNAc beta(1---3)Gal beta(1---4)GlcNAc beta(1---6)GalNAc-ol structural element in commo (1991 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, de Waard P, Vliegenthart J) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• The polypeptide of immunoglobulin G influences its galactosylation in vivo. (1990 - Lee S, Connolly J, Ramirez-Soto D, Poretz R) / Status : Reviewed
• A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
• The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Structures of the oligosaccharide chains in swine trachea mucin glycoproteins. (1984 - Chandrasekaran EV, Rana SS, Davila M, Mendicino J) / Status : Reviewed

Reported glycosite

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
  •        Asn-333
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
  •        Asn-268
• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
  •        Asn-452
• Beta-secretase-fc fusion protein / Homo sapiens
  •        Undefined site
• Biglycan / Homo sapiens
  •        Asn-270
• Calreticulin / Homo sapiens
  •        Asn-344
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Cap-gly domain-containinglinker protein 1 / Homo sapiens
  •        Asn-971
• Ceramide synthase 2 / Homo sapiens
  •        Asn-19
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
  •        Asn-91
• Clusterin / Homo sapiens
  •        Asn-354
  •        Asn-374
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2679
• Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
  •        Asn-251
• Decorin / Homo sapiens
  •        Asn-262
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Endoplasmin / Homo sapiens
  •        Asn-62
  •        Asn-217
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-196
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
  •        Asn-1236
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Glucosidase 2 subunit beta / Homo sapiens
  •        Asn-476
• Glycodelin-a / Homo sapiens
  •        Asn-46
• Glycoprotein rg / Homo sapiens
  •        Undefined site
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-515
  •        Asn-596
  •        Asn-862
  •        Asn-869
  •        Asn-931
• IgG-IL2 fusion protein / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-92
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Asn-97
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-207
  •        Asn-517
  •        Asn-577
• Interferon gamma / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
• Major prion protein / Homo sapiens
  •        Asn-197
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Myeloperoxidase / Homo sapiens
  •        Asn-483
• Neuroserpin / Homo sapiens
  •        Asn-321
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
  •        Asn-70
• Periostin / Homo sapiens
  •        Asn-599
• Plasma kallikrein / Homo sapiens
  •        Asn-396
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
• Procollagen galactosyltransferase 1 / Homo sapiens
  •        Asn-381
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
  •        Asn-548
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-431
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
  •        Asn-53
  •        Asn-90
  •        Asn-103
  •        Asn-322
  •        Asn-432
  •        Asn-690
• Recombinant plasminogen - [r580s] / Homo sapiens
  •        Undefined site
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Serpin h1 / Homo sapiens
  •        Asn-120
  •        Asn-125
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens
  •        Undefined site
• Signal transducer CD24 / Homo sapiens
  •        Asn-52
• SUN domain-containing protein 2 / Homo sapiens
  •        Asn-636
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-104
• Transmembrane emp24 domain-containing protein 9 / Homo sapiens
  •        Asn-125
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Serum / Homo sapiens
  •        Undefined site
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-275
  •        Thr-277
  •        Thr-296
  •        Ser-511
• Vesicular integral-membrane protein VIP36 / Homo sapiens
  •        Asn-183
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Zona Pellucida / Bos taurus
  •        Undefined site
• Zona pellucida sperm-binding protein 2 / Bos taurus
  •        Undefined site
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Cyclin-G-associated kinase / Mus musculus
  •        Asn-452
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-113
• Endoplasmin / Mus musculus
  •        Asn-62
• Fibulin-5 / Mus musculus
  •        Asn-296
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Hypoxia up-regulated protein 1 / Mus musculus
  •        Asn-830
  •        Asn-931
• Immunoglobulin gamma / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 / Mus musculus
  •        Asn-174
• Immunoglobulin gamma-1 heterodimer / Mus musculus
  •        Asn-174
• Immunoglobulin gamma-1 homodimer / Mus musculus
  •        Asn-174
• Immunoglobulin gamma-2a heavy chain / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b heterodimer / Mus musculus
  •        Undefined site
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-137
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-397
• Laminin subunit beta-2 / Mus musculus
  •        Asn-1500
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1221
  •        Asn-1239
  •        Asn-1378
• Monoclonal antibody okt3 / Mus musculus
  •        Undefined site
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus
  •        Asn-236
• Neurofascin / Mus musculus
  •        Asn-881
• Neuronal pentraxin-1 / Mus musculus
  •        Asn-193
• Noelin / Mus musculus
  •        Asn-473
• Prenylcysteine oxidase / Mus musculus
  •        Asn-196
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-2128
  •        Asn-3090
• Prosaposin / Mus musculus
  •        Asn-80
  •        Asn-214
• Prostaglandin-H2 D-isomerase / Mus musculus
  •        Asn-78
• Protein disulfide-isomerase TMX3 / Mus musculus
  •        Asn-261
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Reticulocalbin-3 / Mus musculus
  •        Asn-140
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
  •        Asn-158
• SPARC / Mus musculus
  •        Asn-115
• Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus
  •        Asn-263
• Tenascin-r / Mus musculus
  •        Undefined site
• Testican-2 / Mus musculus
  •        Asn-225
• Tetraspanin-2 / Mus musculus
  •        Asn-139
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Transmembrane emp24 domain-containing protein 4 / Mus musculus
  •        Asn-117
• Transmembrane emp24 domain-containing protein 9 / Mus musculus
  •        Asn-125
• Uncharacterized protein from Brainstem / Mus musculus
  •        Undefined site
• Uncharacterized protein from Cerebellum / Mus musculus
  •        Undefined site
• Uncharacterized protein from Telencephalon / Mus musculus
  •        Undefined site
• Uncharacterized protein from Telencephalon / Mus musculus
  •        Undefined site
• Vesicular integral-membrane protein VIP36 / Mus musculus
  •        Asn-185
• VIP36-like protein / Mus musculus
  •        Asn-180
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Mrc ox-45 surface antigen / Rattus norvegicus
  •        Undefined site
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Mucin / Sus scrofa
  •        Undefined site
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Uncharacterized protein from Whole Plant / Physomitrella patens
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein from Whole Organism / Trichinella spiralis
  •        Undefined site
• Hyaluronoglucosaminidase / Apis mellifera
  •        Undefined site
• Phospholipase a2 / Apis mellifera
  •        Asn-46
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-282
  •        Asn-343
  •        Asn-615
  •        Asn-709
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-331
  •        Asn-343
  •        Asn-602
  •        Asn-615
  •        Asn-657
  •        Asn-709
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1135
  •        Asn-1174
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-657
  •        Asn-801
  •        Asn-1074

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• NNSDISSTR (9aa)
  •    P01871    Asn-46
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q05186    Asn-47
• APNPTNATTK (10aa)
  •    P25063    Asn-52
• NTNITEENVQ (10aa)
  •    Q9BYF1    Asn-53
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53
• NTNITEE (7aa)
  •    Q9BYF1    Asn-53
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
  •    P0DTC2    Asn-61
• TDDEVVQREEEAIQLDGLNASQIR (24aa)
  •    P08113    Asn-62
• TDDEVVQREEEAIQIDGINASQIR (24aa)
  •    P14625    Asn-62
• NAPLVNVTLYYEALCGGCR (19aa)
  •    P13284    Asn-63
• YHYNGTFEDGK (11aa)
  •    Q96AY3    Asn-70
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• TVVAPSTEGGLNLTSTFLR (19aa)
  •    O09114    Asn-78
• TVVTEAGNLLKDNATQEEILHYLEK (25aa)
  •    Q61207    Asn-80
• AQMYPLQEIQNL (12aa)
  •    Q9BYF1    Asn-90
• QEIQNL (6aa)
  •    Q9BYF1    Asn-90
• TVNVSVPK (8aa)
  •    Q96KA5    Asn-91
• HYTNSSQDVTVPCR (14aa)
  •    P01877    Asn-92
• QALQQNGSSVL (11aa)
  •    Q9BYF1    Asn-103
• ALQQNGSSVL (10aa)
  •    Q9BYF1    Asn-103
• QQNGSSVLSEDK (12aa)
  •    Q9BYF1    Asn-103
• ALQQNGSSVLSEDK (14aa)
  •    Q9BYF1    Asn-103
• NGSSVL (6aa)
  •    Q9BYF1    Asn-103
• QQNGSSVL (8aa)
  •    Q9BYF1    Asn-103
• QALQQNGSSVLSEDK (15aa)
  •    Q9BYF1    Asn-103
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104
• SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
  •    P04844    Asn-106
• NVETNNSTVLIEGKKIESLR (20aa)
  •    Q9Z218    Asn-113
• VCSNDNKTFDSSCHFFATK (19aa)
  •    P07214    Asn-115
• FTFTSHTPGDHQICLHSNSTR (21aa)
  •    Q8R1V4    Asn-117
• SISNSTAR (8aa)
  •    P50454    Asn-120
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122
• FTFTSHTPGEHQICIHSNSTK (21aa)
  •    Q9BVK6    Asn-125
• FTFTSHTPGEHQICLHSNSTK (21aa)
  •    Q99KF1    Asn-125
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• NVTYGTYIDDPDPDDGFNYK (20aa)
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136
• LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
  •    Q8R366    Asn-137
• ARGNGTLITFHSAFQCCGK (19aa)
  •    Q922J6    Asn-139
• NATYGHYEPGEEFHDVEDAETYKK (24aa)
  •    Q8BH97    Asn-140
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140
• NATYGHYAPGEEFHDVEDAETYK (23aa)
  •    Q96D15    Asn-140
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149
• FKLDWLGNCSGLNDDSYGYR (20aa)
  •    P14094    Asn-158
• AGPNGTIFVADAYK (14aa)
  •    Q9HDC9    Asn-160
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFEYVSQPFLMDLEGK (24aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• TKPREEQFNSTFR (13aa)
  •    P01859    Asn-176
• EEQFNSTF (8aa)
  •    P01859    Asn-176
• TKPREEQFNSTF (12aa)
  •    P01859    Asn-176
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• TKPREEQFNSTYR (13aa)
  •    P01861    Asn-177
• EEQFNSTY (8aa)
  •    P01861    Asn-177
• EEQFNSTYR (9aa)
  •    P01861    Asn-177
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• VFPYISAMVNNGSLSYDHER (20aa)
  •    P59481    Asn-180
• TKPREEQYNSTY (12aa)
  •    P01857    Asn-180
• TKPREEQYNSTYR (13aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• EEQYNSTYRVVSVLTVLHQDWLNGK (25aa)
  •    P01857    Asn-180
• VFPYISVMVNNGSISYDHSK (20aa)
  •    Q12907    Asn-183
• VFPYISVMVNNGSLSYDHSKDGR (23aa)
  •    Q9DBH5    Asn-185
• VFPYISVMVNNGSLSYDHSK (20aa)
  •    Q9DBH5    Asn-185
• VNTLEEGKGGPKNDTEER (18aa)
  •    Q62443    Asn-193
• LLNQTLRENLKK (12aa)
  •    Q9CQF9    Asn-196
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196
• CDPSCPNGSCWGAGEENCQK (20aa)
  •    P00533    Asn-196
• GENFTETDVK (10aa)
  •    P04156    Asn-197
• TPLTANITK (9aa)
  •    P01877    Asn-205
• TNSSFIQGFVDHVKEDCDR (19aa)
  •    Q61207    Asn-214
• HNNDTQHIWESDSNEFSVIADPR (23aa)
  •    P14625    Asn-217
• ENSKQNGSANSATNPAGLDK (20aa)
  •    Q9ER58    Asn-225
• EEQYNSTFR (9aa)
  •    P01860    Asn-227
• GINIT (5aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITR (23aa)
  •    P0DTC2    Asn-234
• FLTDVERNETALYHVEAFK (19aa)
  •    Q9Z2L6    Asn-236
• FHLANR (6aa)
  •    Q9NRN5    Asn-248
• KDNTTVTR (8aa)
  •    P11279    Asn-249
• NANGSYTCEECDSSCVGCTGEGPGNCK (27aa)
  •    Q6UXH1    Asn-251
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256
• LVAIAVIDEKNTSLEHTR (18aa)
  •    Q8BXZ1    Asn-261
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262
• LMLLHPSPNCSLR (13aa)
  •    Q6GQT6    Asn-263
• VIDLWDLAQSANLTDK (16aa)
  •    P30533    Asn-268
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Thr-296
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Thr-277
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280
• IKIMESHPNGTFSAK (15aa)
  •    P01872    Asn-280
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• TFLLKYNENGTITDAVDCALDPLSE (25aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• SCQDINECEHRNHTCTSLQTCYNLQGGFK (29aa)
  •    Q9WVH9    Asn-296
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307
• DANLTGLSDNK (11aa)
  •    Q99574    Asn-321
• VSVGLPNMTQGFW (13aa)
  •    Q9BYF1    Asn-322
• RVQPTESIVRFPNITNLCPF (20aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
  •    P0DTC2    Asn-343
• FPNITNLCPFGEVFNATR (18aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• NLGNNTK (7aa)
  •    Q16880    Asn-333
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343
• NATRF (5aa)
  •    P0DTC2    Asn-343
• SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
  •    P27797    Asn-344
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• AMNTSQVEAIGIQMIPGYR (19aa)
  •    Q8NBJ5    Asn-381
• GFFCDAALDVDGETLRKNQSSELR (24aa)
  •    Q60625    Asn-397
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• MYSEGSDIVPQSNETAIHYFK (21aa)
  •    Q9UBV2    Asn-431
• SPDFQEDNETEINF (14aa)
  •    Q9BYF1    Asn-432
• LSPDFQEDNETEINF (15aa)
  •    Q9BYF1    Asn-432
• SIGLLSPDFQEDNETEINF (19aa)
  •    Q9BYF1    Asn-432
• MFLDAKHPGHYAVYNLSPR (19aa)
  •    Q99KY4    Asn-452
• IVQIFPNDTSIK (12aa)
  •    Q12797    Asn-452
• SYNDSVDPR (9aa)
  •    P05164    Asn-483
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• YEQGTGCWQGPNR (13aa)
  •    P14314    Asn-476
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497
• FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
  •    P07911    Ser-511
• VFGSQNITTVK (11aa)
  •    Q9Y4L1    Asn-515
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• EQYIHENYSR (10aa)
  •    O60568    Asn-548
• ENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPK (48aa)
  •    Q9Y4L1    Asn-596
• LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
  •    Q9Y4L1    Asn-596
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• IFLKEVNDTLLVNELK (16aa)
  •    Q15063    Asn-599
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615
• AISPNSTISSAPK (13aa)
  •    Q9UH99    Asn-636
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• VTAPKNVS (8aa)
  •    Q9BYF1    Asn-690
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• SNNSIAIPT (9aa)
  •    P0DTC2    Asn-709
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-717
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-709
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSK (24aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• LSALDNLLNHSSIFLK (16aa)
  •    Q9JKR6    Asn-830
• VINETWAWK (9aa)
  •    Q9Y4L1    Asn-862
• NATLAEQAK (9aa)
  •    Q9Y4L1    Asn-869
• LGKQMVENFSPNQTKFSVQR (20aa)
  •    Q810U3    Asn-881
• AEPPINASASDQGEK (15aa)
  •    Q9Y4L1    Asn-931
• AEPPLNASAGDQEEK (15aa)
  •    Q9JKR6    Asn-931
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• VDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (47aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGKA (14aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPAICH (16aa)
  •    P0DTC2    Asn-1074
• GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
  •    P0DTC2    Asn-1074
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• IGIVNNT (7aa)
  •    P0DTC2    Asn-1135
• IVNNT (5aa)
  •    P0DTC2    Asn-1135
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1159
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1174
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1174
• GINASVV (7aa)
  •    P0DTC2    Asn-1174
• VAKNLNE (7aa)
  •    P0DTC2    Asn-1194
• IDRLNEVAKNLNESLIDLQE (20aa)
  •    P0DTC2    Asn-1194
• VAKNLNESLIDLQE (14aa)
  •    P0DTC2    Asn-1194
• TLAGENQTALEIEELNR (17aa)
  •    P02468    Asn-1221
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• KYEQAKNISQDLEK (14aa)
  •    P02468    Asn-1239
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366
• VNDNKTAAEEALR (13aa)
  •    P02468    Asn-1378
• AQAALDKANASR (12aa)
  •    Q61292    Asn-1500
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• GCKDNATDSVPLR (13aa)
  •    Q91ZX7    Asn-2128
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679
• MHLNGSNVQVLHR (13aa)
  •    Q91ZX7    Asn-3090