taxonomy (21)
protein (208)
source (61)
structure (31)
composition (1)
disease (26)
reference (103)
site (267)
peptide (169)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Equus caballus (Domestic horse)
- Felis catus (Cat)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Physomitrella patens
- Torpedo californica (Pacific electric ray)
- Trichinella spiralis
- Apis mellifera (Honeybee)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Bothrops moojeni (Brazilian lancehead)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Beta-secretase-fc fusion protein / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- Calreticulin / Homo sapiens P27797
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens P30622
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Ceramide synthase 2 / Homo sapiens Q96G23
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Coagulation factor VIII / Homo sapiens P00451
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens Q6UXH1
- Decorin / Homo sapiens P07585
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Endoplasmin / Homo sapiens P14625
- Epidermal growth factor receptor / Homo sapiens P00533
- Erythropoietin / Homo sapiens P01588
- Fibronectin / Homo sapiens P02751
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glycodelin-a / Homo sapiens P09466
- Glycoprotein rg / Homo sapiens
- High affinity immunoglobulin gamma Fc receptor I / Homo sapiens P12314-2
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- IgG-IL2 fusion protein / Homo sapiens P60568
- IgG1-NK08-V/F genotype / Homo sapiens P01857
- IgG1-NK09-V/F genotype / Homo sapiens P01857
- IgG1-NK11-F/F genotype / Homo sapiens P01857
- IgG1-NK12-V/F genotype / Homo sapiens P01857
- IgG1-NK13-V/F genotype / Homo sapiens P01857
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01860 P01857
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L115N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin kappa light chain (Trastuzumab) mutant Q160N / Homo sapiens P0DOX7
- Integrin beta-1 / Homo sapiens P05556
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon gamma / Homo sapiens P01579
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens P12318-1
- Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens P31994-3
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens O75015
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Major prion protein / Homo sapiens P04156
- Mammaglobin-A / Homo sapiens Q13296
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Myeloperoxidase / Homo sapiens P05164
- Neuroserpin / Homo sapiens Q99574
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Periostin / Homo sapiens Q15063
- Plasma kallikrein / Homo sapiens P03952
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Recombinant IgG / Homo sapiens P01857
- Reticulocalbin-1 / Homo sapiens Q15293
- Reticulocalbin-3 / Homo sapiens Q96D15
- Serpin h1 / Homo sapiens P50454
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- Signal transducer CD24 / Homo sapiens P25063
- SUN domain-containing protein 2 / Homo sapiens Q9UH99
- Thrombospondin-1 / Homo sapiens P07996
- Thyroglobulin / Homo sapiens P01266
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane emp24 domain-containing protein 9 / Homo sapiens Q9BVK6
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Uncharacterized protein from Blood Serum / Homo sapiens
- Unspecified mucin / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vesicular integral-membrane protein VIP36 / Homo sapiens Q12907
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Corticotropin - lipotropin, npp peptide / Bos taurus P01190
- Immunoglobulin gamma / Bos taurus
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein from Zona Pellucida / Bos taurus
- Zona pellucida sperm-binding protein 2 / Bos taurus Q9BH10
- Immunoglobulin gamma / Canis lupus familiaris
- Immunoglobulin gamma / Equus caballus
- Immunoglobulin gamma / Felis catus
- Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cyclin-G-associated kinase / Mus musculus Q99KY4
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Endoplasmin / Mus musculus P08113
- Fibulin-5 / Mus musculus Q9WVH9
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin gamma / Mus musculus
- Immunoglobulin gamma-1 / Mus musculus P01868
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Immunoglobulin gamma-2b / Mus musculus
- Immunoglobulin gamma-2b heterodimer / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus P01872
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Monoclonal antibody okt3 / Mus musculus
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus Q9Z2L6
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal pentraxin-1 / Mus musculus Q62443
- Noelin / Mus musculus O88998
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Reticulocalbin-1 / Mus musculus Q05186
- Reticulocalbin-3 / Mus musculus Q8BH97
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- SPARC / Mus musculus P07214
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus Q6GQT6
- Tenascin-r / Mus musculus Q8BYI9
- Testican-2 / Mus musculus Q9ER58
- Tetraspanin-2 / Mus musculus Q922J6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Transmembrane emp24 domain-containing protein 4 / Mus musculus Q8R1V4
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Uncharacterized protein from Brainstem / Mus musculus
- Uncharacterized protein from Cerebellum / Mus musculus
- Uncharacterized protein from Telencephalon / Mus musculus
- Uncharacterized protein from Telencephalon / Mus musculus
- Vesicular integral-membrane protein VIP36 / Mus musculus Q9DBH5
- VIP36-like protein / Mus musculus P59481
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 Q62005 P10761
- Immunoglobulin gamma / Oryctolagus cuniculus
- Immunoglobulin gamma / Ovis aries
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Mucin / Sus scrofa
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Uncharacterized protein / Physomitrella patens
- Acetylcholine receptor protein / Torpedo californica P02714 P02718 P02712 P02710
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Uncharacterized protein / Drosophila melanogaster
- Batroxobin / Bothrops moojeni
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Brainstem (UBERON_0002298)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Embryo (UBERON_0000922)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) COS-1 (CVCL_0223)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Neurohypophysis (UBERON_0002198)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO Pro-5 (CVCL_4382)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992) Lec2 (CVCL_3442)
- Ovary (UBERON_0000992) Lec8 (CVCL_3443)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Pulmonary Mucosa
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Telencephalon (UBERON_0001893)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- 15B (CVCL_VU59)
- 26A7 (CVCL_VU60)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- Hybrid 27-1 (CVCL_VU61)
- J558L (CVCL_3949)
- LS174T (CVCL_1384)
- NS0 (CVCL_3940)
- P3X63Ag8 (CVCL_3411)
- P3X63Ag8U.1 (CVCL_3412)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- Sp2/HL-BU (CVCL_VT74)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
Source
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(b1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ 2 x GlcNAc"
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / Structure 9756
- N-Linked / Complex / Structure 9812
- N-Linked / Complex / Structure 10525
- N-Linked / Complex / Structure 10738
- N-Linked / Complex / Structure 10991
- N-Linked / Complex / Structure 11405
- N-Linked / Hybrid / Structure 9622
- N-Linked / Hybrid / Structure 9711
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)][Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- O-Linked / Core 2 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 4 / Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-4)GlcNAc(b1-3)]GalNAc
- O-Linked / Core 4 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Fuc(a1-2)Gal(b1-3)GlcNAc(b1-3)]GalNAc
Reported structure
- Hex:3 HexNAc:4 dHex:1 (avg mass : 1463.3655 )
Composition
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Asymptomatic myositis (DOID:633)
- Atopic dermatitis (DOID:3310)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Esophageal cancer (DOID:5041)
- Familial hepatic adenoma (DOID:111366)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Hyper IgE syndrome (DOID:0080545)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
- Oral squamous cell carcinoma (DOID:0050866)
- Plasmacytoma (Mouse) (DOID:3721)
- Prostate cancer (DOID:10283)
- Sjogren's Syndrome (DOID:12894)
- Systemic lupus erythematosus (DOID:9074)
Disease
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Aberrant sialylation in a patient with a HNF1α variant and liver adenomatosis (2021 - Luisa Sturiale, Marie-Cécile Nassogne, Angelo Palmigiano, Angela Messina, Immacolata Speciale, Rosangela Artuso, Gaetano Bertino, Nicole Revencu, Xavier Stephénne, Cristina De Castro, Gert Matthijs, Rita Barone, Jaak Jaeken, Domenico Garozzo) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Carbohydrate release from picomole quantities of glycoprotein and characterisation of glycans by high-performance liquid chromatography and mass spectrometry. (1999 - Charlwood J, Birrell H, Camilleri P) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
- Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. 1. Structure of 11 oligosaccharides having the GlcNAc beta(1---3)Gal beta(1---4)GlcNAc beta(1---6)GalNAc-ol structural element in commo (1991 - Klein A, Carnoy C, Lamblin G, Roussel P, van Kuik J, de Waard P, Vliegenthart J) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
- The polypeptide of immunoglobulin G influences its galactosylation in vivo. (1990 - Lee S, Connolly J, Ramirez-Soto D, Poretz R) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Characterization of the oligosaccharide alditols from ovarian cyst mucin glycoproteins of blood group A using high pressure liquid chromatography (HPLC) and high field 1H NMR spectroscopy. (1986 - Dua VK, Rao BN, Wu SS, Dube VE, Bush CA) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharide chains in swine trachea mucin glycoproteins. (1984 - Chandrasekaran EV, Rana SS, Davila M, Mendicino J) / Status : Reviewed
Reference
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Ceramide synthase 2 / Homo sapiens
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Collagen alpha-1(XII) chain / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Decorin / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glycodelin-a / Homo sapiens
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
High affinity immunoglobulin gamma Fc receptor I / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L115N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
-
Immunoglobulin kappa light chain (Trastuzumab) mutant Q160N / Homo sapiens
- Undefined site
- Integrin beta-1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major prion protein / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Neuroserpin / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Periostin / Homo sapiens
- Plasma kallikrein / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Recombinant IgG / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Serpin h1 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Signal transducer CD24 / Homo sapiens
- SUN domain-containing protein 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane emp24 domain-containing protein 9 / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
- Vesicular integral-membrane protein VIP36 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cyclin-G-associated kinase / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Endoplasmin / Mus musculus
- Fibulin-5 / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Hypoxia up-regulated protein 1 / Mus musculus
-
Immunoglobulin gamma / Mus musculus
- Undefined site
- Immunoglobulin gamma-1 / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2b / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2b heterodimer / Mus musculus
- Undefined site
- Immunoglobulin mu chain C region / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Noelin / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Reticulocalbin-3 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- SPARC / Mus musculus
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus
-
Tenascin-r / Mus musculus
- Undefined site
- Testican-2 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Transmembrane emp24 domain-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
-
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
-
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
- Vesicular integral-membrane protein VIP36 / Mus musculus
- VIP36-like protein / Mus musculus
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Mucin / Sus scrofa
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Batroxobin / Bothrops moojeni
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NSGALTSGVHTFPAVLQSSGLY (22aa)
- P01857     Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- 182:L→N
- P01857     Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
- 178:Q→N
- P01857     Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- 177:L→N
- SLSSVVTVPSSSLGTQTY (18aa)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- HENNTKDNSIQHEFSLTR (18aa)
- KNNSDISSTRG (11aa)
- NNSDISSTR (9aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- APNPTNATTK (10aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FSNVTWF (7aa)
- TDDEVVQREEEAIQLDGLNASQIR (24aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- NKSVLLGR (8aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- NK (2aa)
- YHYNGTFEDGK (11aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- TVVAPSTEGGLNLTSTFLR (19aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- TVNVSVPK (8aa)
- HYTNSSQDVTVPCR (14aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- NVETNNSTVLIEGKKIESLR (20aa)
- VCSNDNKTFDSSCHFFATK (19aa)
- FTFTSHTPGDHQICLHSNSTR (21aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- FTFTSHTPGEHQICIHSNSTK (21aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYEPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYK (23aa)
- YHKNNKSWMESEF (13aa)
- FKLDWLGNCSGLNDDSYGYR (20aa)
- AGPNGTIFVADAYK (14aa)
- SSANNCTF (8aa)
- VYSSANNCTFE (11aa)
- TKPREEQFNSTFR (13aa)
- REEQFNSTFRV (11aa)
- EEQFNSTF (8aa)
- TKPREEQFNSTF (12aa)
- EEQFNSTFR (9aa)
- KTKPREEQFNSTFRV (15aa)
- TKPREEQFNSTYR (13aa)
- EEQFNSTY (8aa)
- EEQFNSTYR (9aa)
- IYVIDGTQNDTAFVFPR (17aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- VFPYISAMVNNGSLSYDHER (20aa)
- TKPREEQYNSTY (12aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- EEQYNSTY (8aa)
- EEQYNSTYRVVSVLTVLHQDWLNGK (25aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- VFPYISVMVNNGSISYDHSK (20aa)
- VFPYISVMVNNGSLSYDHSKDGR (23aa)
- VFPYISVMVNNGSLSYDHSK (20aa)
- VNTLEEGKGGPKNDTEER (18aa)
- LLNQTLRENLKK (12aa)
- IIHAIGGDDFIGMINR (16aa)
- CDPSCPNGSCWGAGEENCQK (20aa)
- GENFTETDVK (10aa)
- KTPLTANITKS (11aa)
- TPLTANITK (9aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- ENSKQNGSANSATNPAGLDK (20aa)
- EEQYNSTFR (9aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- FLTDVERNETALYHVEAFK (19aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- NANGSYTCEECDSSCVGCTGEGPGNCK (27aa)
- YQYVDCGRNTT (11aa)
- LVAIAVIDEKNTSLEHTR (18aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- LMLLHPSPNCSLR (13aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- IMESHPNGTFSAK (13aa)
- IKIMESHPNGTFSAK (15aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- SCQDINECEHRNHTCTSLQTCYNLQGGFK (29aa)
- FFHVNGSAFLPR (12aa)
- DANLTGLSDNK (11aa)
- FPNIT (5aa)
- RVQPTESIVRFPNITNLCPF (20aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- NLGNNTK (7aa)
- GEVFNATRF (9aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- NATRF (5aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- AMNTSQVEAIGIQMIPGYR (19aa)
- GFFCDAALDVDGETLRKNQSSELR (24aa)
- NYTDCTSEGR (10aa)
- MYSEGSDIVPQSNETAIHYFK (21aa)
- MFLDAKHPGHYAVYNLSPR (19aa)
- IVQIFPNDTSIK (12aa)
- VPGNVTAVIGETIK (14aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- YEQGTGCWQGPNR (13aa)
- SYNDSVDPR (9aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- FALLMTNCYATPSSNATDPLKYFIIQDR (28aa)
- VFGSQNITTVK (11aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- EQYIHENYSR (10aa)
- ENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPK (48aa)
- LGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSK (37aa)
- EVNDTLLVNELK (12aa)
- IFLKEVNDTLLVNELK (16aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- AISPNSTISSAPK (13aa)
- NNSYECDIPI (10aa)
- SNNSIAIPT (9aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- LSALDNLLNHSSIFLK (16aa)
- VINETWAWK (9aa)
- NATLAEQAK (9aa)
- LGKQMVENFSPNQTKFSVQR (20aa)
- AEPPINASASDQGEK (15aa)
- AEPPLNASAGDQEEK (15aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGKA (14aa)
- VPAQEKNFTTAPAICH (16aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VNSSLHSQISR (11aa)
- IGIVNNT (7aa)
- IVNNT (5aa)
- GINASVV (7aa)
- TLAGENQTALEIEELNR (17aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- KYEQAKNISQDLEK (14aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- VNDNKTAAEEALR (13aa)
- AQAALDKANASR (12aa)
- NLQVYNATSNSLTVK (15aa)
- GCKDNATDSVPLR (13aa)
- EAGNITTDGYEIIGK (15aa)
- MHLNGSNVQVLHR (13aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Venom (UBERON_0007113)
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977)
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Zona Pellucida (UBERON_0000086)
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1463.3655)
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) COS-1 (CVCL_0223)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO Pro-5 (CVCL_4382)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992) Lec2 (CVCL_3442)
- Ovary (UBERON_0000992) Lec8 (CVCL_3443)
- Pancreas (UBERON_0001264)
- Spleen (UBERON_0002106)
- Zona Pellucida (UBERON_0000086)
- 15B (CVCL_VU59)
- 26A7 (CVCL_VU60)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- Hybrid 27-1 (CVCL_VU61)
- J558L (CVCL_3949)
- LS174T (CVCL_1384)
- NS0 (CVCL_3940)
- P3X63Ag8 (CVCL_3411)
- P3X63Ag8U.1 (CVCL_3412)
- Sp2/HL-BU (CVCL_VT74)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gaucher Disease (DOID:1926)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Sjogren's Syndrome (DOID:12894)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- A simple method for the release of asparagine-linked oligosaccharides from a glycoprotein purified by SDS-polyacrylamide gel electrophoresis. (1992 - Kawashima H, Murata T, Yamamoto K, Tateishi A, Irimura T, Osawa T) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- The polypeptide of immunoglobulin G influences its galactosylation in vivo. (1990 - Lee S, Connolly J, Ramirez-Soto D, Poretz R) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- A protein structural change in aglycosylated IgG3 correlates with loss of huFc gamma R1 and huFc gamma R111 binding and/or activation. (1990 - Lund J, Tanaka T, Takahashi N, Sarmay G, Arata Y, Jefferis R) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Glycodelin-a / Homo sapiens
-
High affinity immunoglobulin gamma Fc receptor I / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[da265] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa241] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ra301] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[va264] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L115N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Immunoglobulin kappa light chain (Trastuzumab) mutant Q160N / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
-
Plasminogen / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Mus musculus
- Undefined site
- Immunoglobulin gamma-1 / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2b / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2b heterodimer / Mus musculus
- Undefined site
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
- NSGALTSGVHTFPAVLQSSGLY (22aa)
- P01857     Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- 182:L→N
- P01857     Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
- 178:Q→N
- P01857     Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
- 177:L→N
- SLSSVVTVPSSSLGTQTY (18aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Brainstem (UBERON_0002298)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Telencephalon (UBERON_0001893)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
-
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Neurohypophysis (UBERON_0002198)
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Milk (UBERON_0001913)
- CHO (CVCL_0213)
- HEK293 (CVCL_0045)
- Asymptomatic myositis (DOID:633)
- Atopic dermatitis (DOID:3310)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Esophageal cancer (DOID:5041)
- Gastritis (DOID:4029)
- Hyper IgE syndrome (DOID:0080545)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- KNNSDISSTRG (11aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- REEQFNSTFRV (11aa)
- EEQFNSTFR (9aa)
- KTKPREEQFNSTFRV (15aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- KTPLTANITKS (11aa)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Embryo (UBERON_0000922)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / Complex
(avg mass : 1463.3655)
- HEK293 (CVCL_0045)
-
High affinity immunoglobulin gamma Fc receptor I / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1463.3655)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1463.3655)
- Embryo (UBERON_0000922)
-
- N-Linked / Undefined core
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- TKPREEQFNSTFR (13aa)
-
- N-Linked / Undefined core
(avg mass : 1463.3655)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- TKPREEQFNSTFR (13aa)
- TKPREEQFNSTYR (13aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
-
- O-Linked / Core 2
(avg mass : 1463.3655)
- Ovary (UBERON_0000992)
- Cancer, Ovarian (Cystic) (DOID:2394)
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1463.3655)
- Pulmonary Mucosa
-
Mucin / Sus scrofa
- Undefined site
-
- O-Linked / Core 4
(avg mass : 1463.3655)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 4
(avg mass : 1463.3655)
- Pulmonary Mucosa
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
- CHO (CVCL_0213)
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(b1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ 2 x GlcNAc"
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / Structure 9756
- N-Linked / Complex / Structure 9812
- N-Linked / Complex / Structure 10525
- N-Linked / Complex / Structure 10738
- N-Linked / Complex / Structure 10991
- N-Linked / Complex / Structure 11405
- N-Linked / Hybrid / Structure 9622
- N-Linked / Hybrid / Structure 9711
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)][Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- Recombinant IgG / Homo sapiens
- EEQYNSTYR (9aa)
-
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(b1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)][Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-3)[GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ 2 x GlcNAc"
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
- N-Linked / Complex / Structure 2643
- N-Linked / Complex / Structure 9756
- N-Linked / Complex / Structure 9812
- N-Linked / Complex / Structure 10525
- N-Linked / Complex / Structure 10738
- N-Linked / Complex / Structure 10991
- N-Linked / Complex / Structure 11405
- N-Linked / Hybrid / Structure 9622
- N-Linked / Hybrid / Structure 9711
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)][Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Biglycan / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Cap-gly domain-containinglinker protein 1 / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Decorin / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major prion protein / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Neuroserpin / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Serpin h1 / Homo sapiens
- Signal transducer CD24 / Homo sapiens
- SUN domain-containing protein 2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane emp24 domain-containing protein 9 / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Uromodulin / Homo sapiens
- Vesicular integral-membrane protein VIP36 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cyclin-G-associated kinase / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Endoplasmin / Mus musculus
- Fibulin-5 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Noelin / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Reticulocalbin-3 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- SPARC / Mus musculus
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus
- Testican-2 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Transmembrane emp24 domain-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Vesicular integral-membrane protein VIP36 / Mus musculus
- VIP36-like protein / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- HENNTKDNSIQHEFSLTR (18aa)
- NNSDISSTR (9aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- APNPTNATTK (10aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FSNVTWF (7aa)
- TDDEVVQREEEAIQLDGLNASQIR (24aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- YHYNGTFEDGK (11aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- TVVAPSTEGGLNLTSTFLR (19aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- TVNVSVPK (8aa)
- HYTNSSQDVTVPCR (14aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- NVETNNSTVLIEGKKIESLR (20aa)
- VCSNDNKTFDSSCHFFATK (19aa)
- FTFTSHTPGDHQICLHSNSTR (21aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- FTFTSHTPGEHQICIHSNSTK (21aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYEPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYK (23aa)
- YHKNNKSWMESEF (13aa)
- FKLDWLGNCSGLNDDSYGYR (20aa)
- AGPNGTIFVADAYK (14aa)
- SSANNCTF (8aa)
- TKPREEQFNSTFR (13aa)
- EEQFNSTF (8aa)
- TKPREEQFNSTF (12aa)
- EEQFNSTFR (9aa)
- EEQFNSTY (8aa)
- EEQFNSTYR (9aa)
- IYVIDGTQNDTAFVFPR (17aa)
- EEQYNSTYR (9aa)
- VFPYISAMVNNGSLSYDHER (20aa)
- TKPREEQYNSTY (12aa)
- TKPREEQYNSTYR (13aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
Source
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 dHex:1 / N-Linked
(avg mass : 1463.3655)
Source
Reported glycosite
- O-Linked / Core 4
(avg mass : 1463.3655)
Source
Reported glycosite
- O-Linked / Core 4
(avg mass : 1463.3655)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1463.3655)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1463.3655)