taxonomy (31)
protein (274)
source (38)
structure (22)
composition (1)
disease (9)
reference (66)
site (411)
peptide (414)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Capra hircus (Goat)
- Equus caballus (Domestic horse)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Rana clamitans (Green frog)
- Rana ridibunda (Laughing frog)
- Physomitrella patens
- Caenorhabditis elegans
- Autographa californica nucleopolyhedrovirus
- Trichinella spiralis
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Cynodon dactylon (Bermuda grass)
- Human immunodeficiency virus (Hiv)
- Armoracia rusticana (Horseradish)
- Juglans regia (English walnut)
- Lupinus luteus (Yellow lupine)
- Prunus dulcis var. sativa (Sweet almond)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Acid sphingomyelinase-like phosphodiesterase 3a / Homo sapiens Q92484
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-L-iduronidase / Homo sapiens P35475
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Angiopoietin-2 / Homo sapiens O15123
- Apolipoprotein d / Homo sapiens P05090
- Arylsulfatase a / Homo sapiens P15289
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Beta-galactosidase / Homo sapiens P16278
- Beta-glucuronidase / Homo sapiens P08236
- Beta-hexosaminidase subunit beta / Homo sapiens P07686
- Beta-klotho / Homo sapiens Q86Z14
- Calreticulin / Homo sapiens P27797
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Cathepsin D / Homo sapiens P07339
- Cathepsin Z / Homo sapiens Q9UBR2
- CD109 antigen / Homo sapiens Q6YHK3
- CD59 glycoprotein / Homo sapiens P13987
- CD63 antigen / Homo sapiens P08962
- Ceramide synthase 2 / Homo sapiens Q96G23
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Clusterin / Homo sapiens P10909
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens Q6UXH1
- Di-N-acetylchitobiase / Homo sapiens Q01459
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 2 / Homo sapiens Q9UHL4
- Dipeptidyl peptidase 4 / Homo sapiens P27487
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Endoplasmin / Homo sapiens P14625
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glucosylceramidase / Homo sapiens P04062
- Golgin subfamily a member 4 / Homo sapiens Q13439
- Group XV phospholipase A2 / Homo sapiens Q8NCC3
- Haptoglobin / Homo sapiens P00738
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens P04440
- HLA class II histocompatibility antigen, DR beta 5 chain / Homo sapiens Q30154
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-4 beta chain / Homo sapiens P13760
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon omega-1 / Homo sapiens P05000
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal acid phosphatase / Homo sapiens P11117
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mammaglobin-A / Homo sapiens Q13296
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Myeloperoxidase / Homo sapiens P05164
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- N-sulphoglucosamine sulphohydrolase / Homo sapiens P51688
- Neutrophil gelatinase-associated lipocalin / Homo sapiens P80188
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Phospholipase D3 / Homo sapiens Q8IV08
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Protein canopy homolog 3 / Homo sapiens Q9BT09
- Protein CREG1 / Homo sapiens O75629
- Putative phospholipase B-like 2 / Homo sapiens Q8NHP8
- Reticulocalbin-3 / Homo sapiens Q96D15
- Ribonuclease T2 / Homo sapiens O00584
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Tenascin / Homo sapiens P24821
- Tetraspanin-3 / Homo sapiens O60637
- Thyroglobulin / Homo sapiens P01266
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Tripeptidyl-peptidase 1 / Homo sapiens O14773
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tryptase beta-2 / Homo sapiens P20231
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized protein from Ovary / Homo sapiens
- Unspecified mucin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Lactotransferrin / Bos taurus P24627
- Mucin / Capra hircus
- Mucin / Equus caballus
- 4F2 cell-surface antigen heavy chain / Mus musculus P10852
- Acid ceramidase / Mus musculus Q9WV54
- Alkaline phosphatase, tissue-nonspecific isozyme / Mus musculus P09242
- Alpha-N-acetylglucosaminidase / Mus musculus O88325
- Angiotensin-converting enzyme / Mus musculus P09470
- Arylsulfatase G / Mus musculus Q3TYD4
- ATP-binding cassette sub-family A member 3 / Mus musculus Q8R420
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Beta-hexosaminidase subunit beta / Mus musculus P20060
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Carboxypeptidase M / Mus musculus Q80V42
- Carboxypeptidase Q / Mus musculus Q9WVJ3
- Cathepsin D / Mus musculus P18242
- Cathepsin F / Mus musculus Q9R013
- Cathepsin L1 / Mus musculus P06797
- Cathepsin Z / Mus musculus Q9WUU7
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Cell adhesion molecule 1 / Mus musculus Q8R5M8
- Cerebellin-2 / Mus musculus Q8BGU2
- Cerebellin-4 / Mus musculus Q8BME9
- Chondroadherin-like protein / Mus musculus E9Q7T7
- Chondroitin sulfate proteoglycan 4 / Mus musculus Q8VHY0
- Chondroitin sulfate proteoglycan 5 / Mus musculus Q71M36
- Collectin-12 / Mus musculus Q8K4Q8
- Complement C1q subcomponent subunit A / Mus musculus P98086
- Contactin-1 / Mus musculus P12960
- Contactin-4 / Mus musculus Q69Z26
- Contactin-6 / Mus musculus Q9JMB8
- Cystatin-C / Mus musculus P21460
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus Q8BGN3
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Ferric-chelate reductase 1 / Mus musculus Q8K385
- Galectin-3-binding protein / Mus musculus Q07797
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus Q80T41
- Gamma-glutamyl hydrolase / Mus musculus Q9Z0L8
- Glucosylceramidase / Mus musculus P17439
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Heparan N-sulfatase / Mus musculus Q9EQ08
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Hyaluronan and proteoglycan link protein 1 / Mus musculus Q9QUP5
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Iduronate 2-sulfatase / Mus musculus Q08890
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Inactive phospholipase C-like protein 2 / Mus musculus Q8K394
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Interferon beta / Mus musculus P01575
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus Q8BLQ9-2
- Isoform 2 of Receptor-type tyrosine-protein phosphatase U / Mus musculus B1AUH1-2
- Isoform 2 of Tomoregulin-1 / Mus musculus Q6PFE7-2
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 5 of Neogenin / Mus musculus P97798-5
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Lipase / Mus musculus D3Z608
- LisH domain and HEAT repeat-containing protein KIAA1468 / Mus musculus Q148V7
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal alpha-mannosidase / Mus musculus O09159
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Major prion protein / Mus musculus P04925
- Mammalian ependymin-related protein 1 / Mus musculus Q99M71
- Metabotropic glutamate receptor 2 / Mus musculus Q14BI2
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Metabotropic glutamate receptor 5 / Mus musculus Q3UVX5
- Mucolipin-1 / Mus musculus Q99J21
- Multiple epidermal growth factor-like domains protein 9 / Mus musculus Q8BH27
- Myelin-oligodendrocyte glycoprotein / Mus musculus Q61885
- Myeloperoxidase / Mus musculus P11247
- N-acetylglucosamine-6-sulfatase / Mus musculus Q8BFR4
- Neural cell adhesion molecule 1 / Mus musculus P13595
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurexin-3 / Mus musculus Q6P9K9
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal pentraxin-1 / Mus musculus Q62443
- Neuroplastin / Mus musculus P97300
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus Q8BGT0
- P2X purinoceptor 4 / Mus musculus Q9JJX6
- Palmitoyl-protein thioesterase 1 / Mus musculus O88531
- Phospholipase D3 / Mus musculus O35405
- Phospholipase D4 / Mus musculus Q8BG07
- Plexin-B1 / Mus musculus Q8CJH3
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Probable G-protein coupled receptor 158 / Mus musculus Q8C419
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein sidekick-2 / Mus musculus Q6V4S5
- Protocadherin-1 / Mus musculus F7BJK1
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Reelin / Mus musculus Q60841
- Reticulocalbin-1 / Mus musculus Q05186
- Seizure 6-like protein / Mus musculus Q6P1D5
- Semaphorin-4B / Mus musculus Q62179
- Semaphorin-4D / Mus musculus O09126
- Semaphorin-4G / Mus musculus Q9WUH7
- Sialate O-acetylesterase / Mus musculus P70665
- SID1 transmembrane family member 1 / Mus musculus Q6AXF6
- Signal-regulatory protein alpha / Mus musculus P97797
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus Q4VA53
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus P97370
- Sortilin-related receptor / Mus musculus O88307
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- Tenascin / Mus musculus Q80YX1
- Tenascin-r / Mus musculus Q8BYI9
- Testican-2 / Mus musculus Q9ER58
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus Q69ZU6
- Transferrin receptor protein 1 / Mus musculus Q62351
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane protein 2 / Mus musculus Q5FWI3
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Tyrosine-protein kinase receptor / Mus musculus Q6VNS1
- Vascular cell adhesion protein 1 / Mus musculus P29533
- Vasopressin-neurophysin 2-copeptin / Mus musculus P35455
- Versican core protein / Mus musculus Q62059
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus Q9Z1L5
- VPS10 domain-containing receptor SorCS2 / Mus musculus Q9EPR5
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Asgp-1 / Rattus norvegicus
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Mucin / Bufo bufo
- Mucin / Rana clamitans
- Mucin / Rana ridibunda
- Uncharacterized protein / Physomitrella patens
- Uncharacterized protein / Caenorhabditis elegans
- Fg / Autographa californica nucleopolyhedrovirus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Interleukin-2 [mu33] / Spodoptera frugiperda P60568
- Membrane glycoproteins / Spodoptera frugiperda
- Bg60 / Cynodon dactylon
- Surface protein gp120 / Human immunodeficiency virus
- Peroxidase c1a / Armoracia rusticana P00433
- Uncharacterized protein / Juglans regia
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Uncharacterized protein / Prunus dulcis var. sativa
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Mucosa of Stomach (UBERON_0001199)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Semen (UBERON_0001968)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Submandibular Gland (UBERON_0001736)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell Jelly Coat
- Pollen (BTO_0001097)
- Seed (BTO_0001226)
Source
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / Gal(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10068
- N-Linked / Undefined core / Structure 9559
- N-Linked / Undefined core / Structure 9740
- O-Linked / Core 1 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(a1-3)Gal(a1-4)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-2)Gal(a1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 9 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-6)]GalNAc
- O-Linked / Undefined core / Man(?1-6)Glc(?1-4)GlcNAc(?1-4)[Fuc(?1-2)]Gal(?1-3)GalNAc
Reported structure
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
Composition
- Adenocarcinoma (DOID:299)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- COVID-19 (DOID:0080600)
- Fucosidosis (DOID:14500)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Ovarian cyst (DOID:5119)
- Prostate cancer (DOID:10283)
Disease
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Diversity of O-linked glycosylation patterns between species. Characterization of 25 carbohydrate chains from oviducal mucins of Rana ridibunda. (2001 - Mourad R, Morelle W, Neveu A, Strecker G) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- The carbohydrate moiety of the bermuda grass antigen BG60. New oligosaccharides of plant origin. (1996 - Ohsuga H, Su S, Takahashi N, Yang S, Nakagawa H, Shimada I, Arata Y, Lee Y) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
- Structures of carbohydrate chains of glycoprotein isolated from goat submaxillary mucin. (1982 - Dutta B, Rao C) / Status : Reviewed
- Urinary oligosaccharides of fucosidosis. Evidence of the occurrence of X-antigenic determinant in serum-type sugar chains of glycoproteins. (1978 - Nishigaki M, Yamashita K, Matsuda I, Arashima S, Kobata A) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Acid sphingomyelinase-like phosphodiesterase 3a / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-L-iduronidase / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Angiopoietin-2 / Homo sapiens
- Apolipoprotein d / Homo sapiens
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Beta-hexosaminidase subunit beta / Homo sapiens
- Beta-klotho / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin Z / Homo sapiens
- CD109 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgin subfamily a member 4 / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- Haptoglobin / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
- HLA class II histocompatibility antigen, DR beta 5 chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-4 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Interferon omega-1 / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- N-sulphoglucosamine sulphohydrolase / Homo sapiens
- Neutrophil gelatinase-associated lipocalin / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase D3 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolyl 3-hydroxylase 1 / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein canopy homolog 3 / Homo sapiens
- Protein CREG1 / Homo sapiens
- Putative phospholipase B-like 2 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Ribonuclease T2 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Sialate O-acetylesterase / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Mucin / Capra hircus
- Undefined site
-
Mucin / Equus caballus
- Undefined site
- 4F2 cell-surface antigen heavy chain / Mus musculus
- Acid ceramidase / Mus musculus
- Alkaline phosphatase, tissue-nonspecific isozyme / Mus musculus
- Alpha-N-acetylglucosaminidase / Mus musculus
- Angiotensin-converting enzyme / Mus musculus
- Arylsulfatase G / Mus musculus
- ATP-binding cassette sub-family A member 3 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Beta-hexosaminidase subunit beta / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Carboxypeptidase M / Mus musculus
- Carboxypeptidase Q / Mus musculus
- Cathepsin D / Mus musculus
- Cathepsin F / Mus musculus
- Cathepsin L1 / Mus musculus
- Cathepsin Z / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell adhesion molecule 1 / Mus musculus
- Cerebellin-2 / Mus musculus
- Cerebellin-4 / Mus musculus
- Chondroadherin-like protein / Mus musculus
- Chondroitin sulfate proteoglycan 4 / Mus musculus
- Chondroitin sulfate proteoglycan 5 / Mus musculus
- Collectin-12 / Mus musculus
- Complement C1q subcomponent subunit A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-4 / Mus musculus
- Contactin-6 / Mus musculus
- Cystatin-C / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Ferric-chelate reductase 1 / Mus musculus
- Galectin-3-binding protein / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus
- Gamma-glutamyl hydrolase / Mus musculus
- Glucosylceramidase / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Heparan N-sulfatase / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hyaluronan and proteoglycan link protein 1 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Iduronate 2-sulfatase / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive phospholipase C-like protein 2 / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
-
Interferon beta / Mus musculus
- Undefined site
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Isoform 2 of Receptor-type tyrosine-protein phosphatase U / Mus musculus
- Isoform 2 of Tomoregulin-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 5 of Neogenin / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Lipase / Mus musculus
- LisH domain and HEAT repeat-containing protein KIAA1468 / Mus musculus
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal alpha-mannosidase / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Major prion protein / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 2 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metabotropic glutamate receptor 5 / Mus musculus
- Mucolipin-1 / Mus musculus
- Multiple epidermal growth factor-like domains protein 9 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Myeloperoxidase / Mus musculus
- N-acetylglucosamine-6-sulfatase / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurexin-3 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Neuroplastin / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus
- P2X purinoceptor 4 / Mus musculus
- Palmitoyl-protein thioesterase 1 / Mus musculus
- Phospholipase D3 / Mus musculus
- Phospholipase D4 / Mus musculus
- Plexin-B1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Probable G-protein coupled receptor 158 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Reelin / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Seizure 6-like protein / Mus musculus
- Semaphorin-4B / Mus musculus
- Semaphorin-4D / Mus musculus
- Semaphorin-4G / Mus musculus
- Sialate O-acetylesterase / Mus musculus
- SID1 transmembrane family member 1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- Tenascin / Mus musculus
- Tenascin-r / Mus musculus
- Testican-2 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Transferrin receptor protein 1 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane protein 2 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Tyrosine-protein kinase receptor / Mus musculus
- Vascular cell adhesion protein 1 / Mus musculus
- Vasopressin-neurophysin 2-copeptin / Mus musculus
- Versican core protein / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- VPS10 domain-containing receptor SorCS2 / Mus musculus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana clamitans
- Undefined site
-
Mucin / Rana ridibunda
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Bg60 / Cynodon dactylon
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- VNLTTR (6aa)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- SVAQNYSSITHLHSIGK (17aa)
- NVLLIVADDGGFESGVYNNTAIATPHLDALSR (32aa)
- NAIIIIADDGGFESGAYNNSAIATPHIDAIAR (32aa)
- KNYSVLYFQQK (11aa)
- NYSVIYFQQK (10aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- HECHFFNGTER (11aa)
- FECHFFNGTER (11aa)
- QECYAFNGTQR (11aa)
- YECHFFNGTER (11aa)
- WQMNFTVR (8aa)
- HQNLTEVPNTIPELTQR (17aa)
- WYSAGLASNSSWFR (14aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- GKSNCSELNLR (11aa)
- QTVEEEGGASSYNTSSK (17aa)
- GGNVTLPCK (9aa)
- YETTNK (6aa)
- ISPGKNATGMEVGWYR (16aa)
- VDQNDNTSLQWSNPAQQTLYFDDKK (25aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- SNVTWF (6aa)
- QGNASDVILR (10aa)
- EEEAIQLDGLNASQIR (16aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- APLVNVTLYYEALCGGCR (18aa)
- CIQANYSIMENGK (13aa)
- VYSGVVSLSTENIYSFNHTSHPGQVTAVR (29aa)
- LEPNSVDPENITEILIANQK (20aa)
- AIGFENATQAIGR (13aa)
- DVTVIEGEVATISCQVNK (18aa)
- FHAIHVSGTNGTKR (14aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTK (13aa)
- HAIHVSGTNGTKR (13aa)
- HAIHVSGTNGTK (12aa)
- TVTISDHGTVTYNGSICGDDQNGPK (25aa)
- GVAVTNTSQLGFR (13aa)
- NYTLWR (6aa)
- RMELSVGAIQANR (13aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- DNATEEEILVYLEK (14aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- MTPNIIHIAPENFYISHSPNSTAGPSCTIIEEAFRR (36aa)
- MTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFR (35aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- STNHEPSEMSNK (12aa)
- SYNVTSVIFR (10aa)
- YHGFINTSYHR (11aa)
- IRNVSDTTKR (10aa)
- YHGFLNTSYHR (11aa)
- YHGFLNTSYH (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- SQTNLTDCPFHDQPHLMR (18aa)
- LVYNR (5aa)
- ELLSNQSEVMLR (12aa)
- TCDWIPKPNMSASCK (15aa)
- TYPNHYTLVTGLFAENHGIVANDMFDPILNK (31aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- DLCNFNEQLENGGTSLSEK (19aa)
- TFYWDFYTNR (10aa)
- AYWPDVIHSFPNR (13aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- LSYNFTHLDGYLDLLR (16aa)
- GISYNFTHIDGYIDIIR (17aa)
- ISNVTPADAGIYYCVK (16aa)
- STNHEPSEMSNR (12aa)
- GKNNQTECFNHVR (13aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- NVETNNSTVLIEGK (14aa)
- IFYNLSIQ (8aa)
- IFYNLSIQS (9aa)
- VHSGNFSTIPQYFK (14aa)
- KDDEPLETTGDFNTTK (16aa)
- SISNSTAR (8aa)
- IVNNATNVVIK (11aa)
- LIVNNATNVVIK (12aa)
- TQSLLIVNNATNVVIK (16aa)
- LVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYR (37aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- DAGVVCTNET (10aa)
- DAGVVCTNETR (11aa)
- FGCEIENNR (9aa)
- LKFNSTIK (8aa)
- NNHTASIIDR (10aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- FNPNISWQPIPVHTVPITEDR (21aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- AREPSNATQLDGPAR (15aa)
- LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
- VELVPLPSWQPVGENFTLSCR (21aa)
- IGIYADVGNK (10aa)
- NIGNTSEGPR (10aa)
- LENLSSTESGYTATLTR (17aa)
- IENISSSEMGYTATITR (17aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- ANDSDQGANAEIDYTFHQAPEVVR (24aa)
- VLTNQESPYQNHTGR (15aa)
- CCGAANYTDWEK (12aa)
- VVMDIPYEIWNETSAEVADIKK (22aa)
- CNSVLTYNLTPVVQK (15aa)
- IHDSFPTYYLPYNESVSFEDR (21aa)
- VYMKNVTVVLR (11aa)
- AGPNGTIFVADAYK (14aa)
- YDIPASINFIINK (13aa)
- KLPLNFTEGAR (11aa)
- NFTGGQLHSR (10aa)
- LEQNFFNCSCDIR (13aa)
- VYTYADTPNDFQLSNFSLPEEDTK (24aa)
- VYSSANNCTFEY (12aa)
- VYSSANNCTF (10aa)
- VYTYADTPNDFQLSNFSLPEEDTKLK (26aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VYSSANNCTFE (11aa)
- NQKDEINETDLK (12aa)
- NQSVPISCCR (10aa)
- NISVVVATHSPTLAK (15aa)
- YYNYTLSINGK (11aa)
- YWGIHLQAFVQNGTVSK (17aa)
- QTPEYQNR (8aa)
- SSPDTQDLYCLNESSK (16aa)
- QTPEYQNESSR (11aa)
- IVVYNQPYINYSR (13aa)
- GHVDPANDTFDIDPR (15aa)
- NYTVVMSTR (9aa)
- DCYPVQETFIRNYTVVMSTR (20aa)
- YYNYTISINGK (11aa)
- ECHAIRNYTLW (11aa)
- ECHAIRNYTIWR (12aa)
- TYTYADTPDDFQIHNFSIPEEDTK (24aa)
- ECHTIQNYTLWR (12aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- DGKPLLNDSR (10aa)
- VNTLEEGKGGPKNDTEER (18aa)
- VEPSDVGNYTCFVTNK (16aa)
- INITNIWVIDYFGGPK (16aa)
- QHTVTTTTKGENFTETDVK (19aa)
- EDVYRNHSIFIADINQER (18aa)
- IVQAEYWHDPIKEDVYRNHSIFIADINQER (30aa)
- NHSIFLADINQER (13aa)
- LVQAQYWHDPIKESVYRNYSIFLADINQER (30aa)
- NFTMNEK (7aa)
- TGEANITQIYIQEAIDFIKR (20aa)
- TPLTANITK (9aa)
- VLVAPPSEEANTTK (14aa)
- LAAPNLTVEEGK (12aa)
- GNYSCFVSSPSITK (14aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- KNLFLNHSENATAKD (15aa)
- GINESYKK (8aa)
- QDQQLQNCTEPG (12aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- TNSTFVQALVEHVKEECDR (19aa)
- TNSSFIQGFVDHVK (14aa)
- ILLQDLSSSAHHLANATLETEWFHGLR (27aa)
- TNSTFVQAIVEHVKEECDR (19aa)
- TNSTFVQALVEHVK (14aa)
- SIVYSCEWPIYMWPFQKPNYTEIR (24aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- SFNATAER (8aa)
- DEDAENLGHFVMFPANGSIDLMYFPYYGKK (30aa)
- DEDAENLGHFVMFPANGSIDLMYFPYYGK (29aa)
- AEFAVANDTGFVDIPQQEK (19aa)
- ANLTK (5aa)
- NTTISVHPSTR (11aa)
- ENSKQNGSANSATNPAGLDK (20aa)
- YHANTSAQQLFQK (13aa)
- NRTDVEYELDEK (12aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa)
- VDLPIGINITR (11aa)
- ELGVVMYNCSCLAR (14aa)
- EIGVVMYNCSCIAR (14aa)
- HMNETSHTQGSLR (13aa)
- LLFPTNSSSR (10aa)
- DRNSSDETFLK (11aa)
- KDNTTVTR (8aa)
- NSSDETFLK (9aa)
- NDRNSSDETFIK (12aa)
- DNTTVTR (7aa)
- FLNVTPNVEVNVECR (15aa)
- NANGSYTCEECDSSCVGCTGEGPGNCK (27aa)
- YQYVDCGRNTT (11aa)
- VASVININPNTTHSTGSCR (19aa)
- SVLENTTSYEEAK (13aa)
- VFPQVNVTK (9aa)
- YYHGELSYLNVTRK (14aa)
- YYHGELSYLNVTR (13aa)
- IININPNK (8aa)
- VYIIAHVPVGYLPSSQNITAMR (22aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- WGQNCSCHHGGYYNCEDK (18aa)
- GTEVNTTVIGENDPIDEVQGFIFGK (25aa)
- ERPPTFLTPEGNESHKEELR (20aa)
- VVANGTGTQGQIK (13aa)
- SAVSTSWLLPYNHTWSHEK (19aa)
- SAVSTSWIIPYNYTWSPEK (19aa)
- LNPNVTLDGDSLVATATATASAEQEGTK (28aa)
- LNSSTIK (7aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- GQCANGTCLCQEGYAGEDCSQR (22aa)
- KKENGVFEEISNSSGR (16aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- DLGPALANSSHDVK (14aa)
- VLENEKFDTHEYHNESR (17aa)
- DYGNYTCVATNK (12aa)
- VIYQNHNK (8aa)
- QINSSISGNIWDK (13aa)
- ACPLDPATNK (10aa)
- TGCLPCQCNNR (11aa)
- TQVFGPVDPTVNTTYAFFNTFFK (23aa)
- ALIYQFSPIYTGNISSFQQCYIFD (24aa)
- FFHVNGSAFLPR (12aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- EDGMLPANR (9aa)
- RNITLPEAK (9aa)
- DLGPTLANSTHHNV (14aa)
- DIGPTIANSTHHNVR (15aa)
- ETQENLTVYSFPTPLLTLSEPEAPEGK (27aa)
- NYFHYNQSYPPTYNVK (16aa)
- KMSNITFR (8aa)
- YYTCLIYNCSAQPHIAPFSGPIDR (24aa)
- VQPIVAVADEGWYILQNK (18aa)
- FENQTCFPLPDSR (13aa)
- FPNITNLCPF (10aa)
- FPNITNL (7aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- IIDNNKTEK (9aa)
- LIDNNK (6aa)
- TLFLFPNQTGFPSK (14aa)
- VPYNVGPGFAGNFSTQK (17aa)
- EMLPFWMNSTGK (12aa)
- CLNHTTQK (8aa)
- GEVFNATRF (9aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- VFNATR (6aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- NLGGLETEDDYGYQGHVQTCNFSAQMAK (28aa)
- NISSEEK (7aa)
- QGNNHTCTWK (10aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- PGDPGKDLASGENGTECR (18aa)
- DLASGENGTECR (12aa)
- PRPGDPGKDLASGENGTECR (20aa)
- VQPFNVTQGK (10aa)
- VYINDSVELSR (11aa)
- IHNLTYLK (8aa)
- KNFTK (5aa)
- GPGIKPNQTSK (11aa)
- ALVTLEGIPAAVPGQPAELQLNVTK (25aa)
- IANITQGEDQYYIR (14aa)
- LEGFAQENSKYNK (13aa)
- AANYTSSLNLPDK (13aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- HTDDLTSLNNTLVNIR (16aa)
- MIVANIDIGPTIIDIAGYDINK (22aa)
- NIDLGPTILDIAGYDLNK (18aa)
- DNHTHSDIQVK (11aa)
- AFLLSLAALRDNHTHSDIQVK (21aa)
- IQDFNYTDHTLGR (13aa)
- QVVENMTR (8aa)
- MGQNVSLNLR (10aa)
- EVMNLLQPLNVTK (13aa)
- KINSSLQLPDR (11aa)
- GFFCDAALDVDGETLRKNQSSELR (24aa)
- YKGLNLTEDTYKPR (14aa)
- NLTFEGPLPEK (11aa)
- ALCPNTTR (8aa)
- VFIVPVGNHSNIPFSR (16aa)
- NSTKQEIIAAIEK (13aa)
- AVAYGEKNLTFQGPLPK (17aa)
- NLSASVIAVTIQGGAHHLDLR (21aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
- YTLGGSHNQTIR (12aa)
- INFTAPFNPNK (11aa)
- ANQTALCGGGVQTR (14aa)
- RANQTALCGGGVQTR (15aa)
- SSSHLPPSSYFNASGR (16aa)
- FLSSSPHLPPSSYFNASG (18aa)
- FISSSPHIPPSSYFNASGR (19aa)
- HIPGIIHNMTAR (12aa)
- EKLLLPAKNTTHLK (14aa)
- LLLPAKNTTHLK (12aa)
- EETLLYDNATSSVADRK (17aa)
- DGQLLPSSNYSNIK (14aa)
- IVQIFPNDTSIK (12aa)
- TNTSALLYDSLR (12aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- NSTKEEILAALEK (13aa)
- GETASLLCNISVR (13aa)
- NNVITINITGK (11aa)
- IINVTK (6aa)
- IINGSQR (7aa)
- VPGNVTAVIGETIK (14aa)
- NNEGGVIAQLPSDVTSFNQTGLKPGEEYIVNVVALK (36aa)
- YEQGTGCWQGPNR (13aa)
- IIISPEENVTLTCTAENQLER (21aa)
- SYNDSVDPR (9aa)
- CTSQHLLNR (9aa)
- LSHYKQNFSFCR (12aa)
- ANSTGTLVITNPTR (14aa)
- GKANSTGTLVITNPTR (16aa)
- ALADVLQDIADDNSSR (16aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- SDVPNTSPNSTSQHVAEFETER (22aa)
- TPASDPHGDNLTYSVFYTK (19aa)
- SDINPANGSYPFQAIR (16aa)
- RHEEGHMINCTCFGQGR (17aa)
- LLLTAAPNLTTSPAFR (16aa)
- AAIPSAIDTNSSK (13aa)
- LVNSTFLHNK (10aa)
- TVIRPFYLTNSS (12aa)
- TVIRPFYLTNS (11aa)
- GTNESEASSTQFTTEIDAPK (20aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- YQDVNCTEVPVAIHADQL (18aa)
- QDVNCTEVPVAIHADQL (17aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- GNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHR (35aa)
- GVPLVGADVCGFLGNTSEELCVR (23aa)
- AGCLIGAEHVNNSY (14aa)
- VPGNQTSTTLK (11aa)
- NSTVMSR (7aa)
- STEVSNHTLK (10aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- QKNITAFNETLFR (13aa)
- IETILLNGTDRK (12aa)
- DAGVGFPEYQEEDNSTYNFR (20aa)
- INCNSSKGPETLYAGQK (17aa)
- INQTEPVAGNYYPVNTR (17aa)
- RDDYRPTWTLNQTEPVAGNYYPVNTR (26aa)
- EQTVSDPFLVVSNTSTFVPYEIK (23aa)
- ETWNNVTVWGSR (12aa)
- QTGLAPGQEYEISLHIVKNNTR (22aa)
- QKDGDDEWTSVVVANVSK (18aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- VSVVNSTLAEVHWDPVPPK (19aa)
- VINETWAWK (9aa)
- FKVLASNR (8aa)
- QMVENFSPNQTK (12aa)
- NNTIVNEIVR (10aa)
- VTVIGVATAPQQVISNGVPVSNFTYSPDTK (30aa)
- EVTVLGVATAPTQVLSNGIPVSNFTYSPDNK (31aa)
- AEPPLNASAGDQEEK (15aa)
- AEPPINASASDQGEK (15aa)
- NTTSYVLR (8aa)
- AVESFTWNITILKGQADLLK (20aa)
- KNNTCVKEENTCLR (14aa)
- VPAQEKNF (8aa)
- HVTYVPAQEKNF (12aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- GVFVSNGTHWFVTQR (15aa)
- NFSNTK (6aa)
- VNSSLHSQISR (11aa)
- SDEFNCSSGMCIR (13aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NCYHYDYNVTDWSTCQLSEK (20aa)
- TLAGENQTALEIEELNRK (18aa)
- TLAGENQTALEIEELNR (17aa)
- KYEQAKNISQDLEK (14aa)
- YEQAKNISQDLEK (13aa)
- KCNGFHCPNGTCIPSSK (17aa)
- YTSDPNVTSVGPSK (14aa)
- IGSYNGTAGDSLSYHQGRPFSTEDR (25aa)
- IGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYK (39aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- RIPAINR (7aa)
- SLSPHAGTEPCPPEAAVCLLNGSKPVNLGK (30aa)
- WALHSASVSHNASAFTVDR (19aa)
- AQAALDKANASR (12aa)
- WTGHNVTVVQR (11aa)
- GPCSHLCLINYNR (13aa)
- LDPTVLDASELANR (14aa)
- THANGSIKR (9aa)
- DNATDSVPLR (10aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- VETGENCTSPAPK (13aa)
- CRDGSCIGNSSR (12aa)
- IGSENNMTSCHRPVCR (16aa)
- KLNLDGSNYTLLK (13aa)
- RMHLNGSNVQVLHR (14aa)
- MHLNGSNVQVLHR (13aa)
- VWVCDRDNDCVDGSDEPANCTQMTCGVDEFR (31aa)
- TCPLDEFQCNNTLCKPLAWK (20aa)
- LTSCATNASMCGDEAR (16aa)
- GVTHLNISGLK (11aa)
- QTGDVTCNCTDGR (13aa)
Mass spectrometry observed peptide
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- N-Linked / No-core
(avg mass : 1056.9755)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / No-core
(avg mass : 1056.9755)
- Hemolymph (UBERON_0001011)
-
Interferon beta / Mus musculus
- Undefined site
-
- N-Linked / No-core
(avg mass : 1056.9755)
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Venom (UBERON_0007113)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Pollen (BTO_0001097)
- Seed (BTO_0001226)
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- The carbohydrate moiety of the bermuda grass antigen BG60. New oligosaccharides of plant origin. (1996 - Ohsuga H, Su S, Takahashi N, Yang S, Nakagawa H, Shimada I, Arata Y, Lee Y) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Bg60 / Cynodon dactylon
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Detected as released in some experiments - Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Semen (UBERON_0001968)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
- Carcinoma, Hepatocellular (DOID:684)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Haptoglobin / Homo sapiens
- Interferon omega-1 / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KNLFLNHSENATAKD (15aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- BTI-Tn-5B1-4 (CVCL_C190)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VNLTTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
-
- N-Linked / Undefined core
(avg mass : 1056.9755)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Undefined core
(avg mass : 1056.9755)
Released - Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
-
- O-Linked / Core 1
(avg mass : 1056.9755)
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Bufo bufo
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Rana clamitans
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
-
Mucin / Equus caballus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Mucin / Equus caballus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Rana clamitans
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Rana ridibunda
- Undefined site
-
- O-Linked / Core 9
(avg mass : 1056.9755)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1056.9755)
-
Mucin / Capra hircus
- Undefined site
-
- Hex:3 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1056.9755)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / No-core / Gal(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10068
- N-Linked / Undefined core / Structure 9559
- N-Linked / Undefined core / Structure 9740
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Acid ceramidase / Homo sapiens
- Acid sphingomyelinase-like phosphodiesterase 3a / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-L-iduronidase / Homo sapiens
- Alpha-n-acetylgalactosaminidase / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Angiopoietin-2 / Homo sapiens
- Apolipoprotein d / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Beta-hexosaminidase subunit beta / Homo sapiens
- Beta-klotho / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin Z / Homo sapiens
- CD109 antigen / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgin subfamily a member 4 / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
-
HLA class II histocompatibility antigen, DR beta 5 chain / Homo sapiens
Source
Suggested structure
Reference
Reported glycosite
- Hex:3 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1056.9755)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1056.9755)
Reported glycosite
- O-Linked / Core 9
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)