taxonomy (31)
protein (279)
source (45)
structure (24)
composition (1)
disease (14)
reference (73)
site (418)
peptide (416)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Capra hircus (Goat)
- Equus caballus (Domestic horse)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Bufo bufo (European toad)
- Rana clamitans (Green frog)
- Rana ridibunda (Laughing frog)
- Physomitrella patens
- Caenorhabditis elegans
- Autographa californica nucleopolyhedrovirus
- Trichinella spiralis
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Cynodon dactylon (Bermuda grass)
- Human immunodeficiency virus (Hiv)
- Armoracia rusticana (Horseradish)
- Juglans regia (English walnut)
- Lupinus luteus (Yellow lupine)
- Prunus dulcis var. sativa (Sweet almond)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Acid ceramidase / Homo sapiens Q13510
- Acid sphingomyelinase-like phosphodiesterase 3a / Homo sapiens Q92484
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-L-iduronidase / Homo sapiens P35475
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Angiopoietin-2 / Homo sapiens O15123
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein D / Homo sapiens P05090
- Arylsulfatase a / Homo sapiens P15289
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Beta-galactosidase / Homo sapiens P16278
- Beta-glucuronidase / Homo sapiens P08236
- Beta-hexosaminidase subunit beta / Homo sapiens P07686
- Beta-klotho / Homo sapiens Q86Z14
- Calreticulin / Homo sapiens P27797
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cathepsin D / Homo sapiens P07339
- Cathepsin Z / Homo sapiens Q9UBR2
- CD109 antigen / Homo sapiens Q6YHK3
- CD59 glycoprotein / Homo sapiens P13987
- CD63 antigen / Homo sapiens P08962
- Ceramide synthase 2 / Homo sapiens Q96G23
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Clusterin / Homo sapiens P10909
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens Q6UXH1
- Di-N-acetylchitobiase / Homo sapiens Q01459
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 2 / Homo sapiens Q9UHL4
- Dipeptidyl peptidase 4 / Homo sapiens P27487
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Endoplasmin / Homo sapiens P14625
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glucosylceramidase / Homo sapiens P04062
- Golgin subfamily a member 4 / Homo sapiens Q13439
- Group XV phospholipase A2 / Homo sapiens Q8NCC3
- Haptoglobin / Homo sapiens P00738
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens P04440
- HLA class II histocompatibility antigen, DR beta 5 chain / Homo sapiens Q30154
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-4 beta chain / Homo sapiens P13760
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon omega-1 / Homo sapiens P05000
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal acid phosphatase / Homo sapiens P11117
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mammaglobin-A / Homo sapiens Q13296
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Myeloperoxidase / Homo sapiens P05164
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- N-sulphoglucosamine sulphohydrolase / Homo sapiens P51688
- Neutrophil gelatinase-associated lipocalin / Homo sapiens P80188
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Phospholipase D3 / Homo sapiens Q8IV08
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Protein canopy homolog 3 / Homo sapiens Q9BT09
- Protein CREG1 / Homo sapiens O75629
- Putative phospholipase B-like 2 / Homo sapiens Q8NHP8
- Reticulocalbin-3 / Homo sapiens Q96D15
- Ribonuclease T2 / Homo sapiens O00584
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Tenascin / Homo sapiens P24821
- Tetraspanin-3 / Homo sapiens O60637
- Thyroglobulin / Homo sapiens P01266
- Tissue alpha-L-fucosidase / Homo sapiens P04066
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Tripeptidyl-peptidase 1 / Homo sapiens O14773
- Tryptase alpha/beta-1 / Homo sapiens Q15661
- Tryptase beta-2 / Homo sapiens P20231
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized protein from Ovary / Homo sapiens
- Unspecified mucin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Lactotransferrin / Bos taurus P24627
- Mucin / Capra hircus
- Mucin / Equus caballus
- 4F2 cell-surface antigen heavy chain / Mus musculus P10852
- Acid ceramidase / Mus musculus Q9WV54
- Alkaline phosphatase, tissue-nonspecific isozyme / Mus musculus P09242
- Alpha-N-acetylglucosaminidase / Mus musculus O88325
- Angiotensin-converting enzyme / Mus musculus P09470
- Arylsulfatase G / Mus musculus Q3TYD4
- ATP-binding cassette sub-family A member 3 / Mus musculus Q8R420
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Beta-hexosaminidase subunit beta / Mus musculus P20060
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Carboxypeptidase M / Mus musculus Q80V42
- Carboxypeptidase Q / Mus musculus Q9WVJ3
- Cathepsin D / Mus musculus P18242
- Cathepsin F / Mus musculus Q9R013
- Cathepsin L1 / Mus musculus P06797
- Cathepsin Z / Mus musculus Q9WUU7
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Cell adhesion molecule 1 / Mus musculus Q8R5M8
- Cerebellin-2 / Mus musculus Q8BGU2
- Cerebellin-4 / Mus musculus Q8BME9
- Chondroadherin-like protein / Mus musculus E9Q7T7
- Chondroitin sulfate proteoglycan 4 / Mus musculus Q8VHY0
- Chondroitin sulfate proteoglycan 5 / Mus musculus Q71M36
- Collectin-12 / Mus musculus Q8K4Q8
- Complement C1q subcomponent subunit A / Mus musculus P98086
- Contactin-1 / Mus musculus P12960
- Contactin-4 / Mus musculus Q69Z26
- Contactin-6 / Mus musculus Q9JMB8
- Cystatin-C / Mus musculus P21460
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus Q8BGN3
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Ferric-chelate reductase 1 / Mus musculus Q8K385
- Galectin-3-binding protein / Mus musculus Q07797
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus Q80T41
- Gamma-glutamyl hydrolase / Mus musculus Q9Z0L8
- Glucosylceramidase / Mus musculus P17439
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Heparan N-sulfatase / Mus musculus Q9EQ08
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Hyaluronan and proteoglycan link protein 1 / Mus musculus Q9QUP5
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Iduronate 2-sulfatase / Mus musculus Q08890
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Inactive phospholipase C-like protein 2 / Mus musculus Q8K394
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Interferon beta / Mus musculus P01575
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus Q8BLQ9-2
- Isoform 2 of Receptor-type tyrosine-protein phosphatase U / Mus musculus B1AUH1-2
- Isoform 2 of Tomoregulin-1 / Mus musculus Q6PFE7-2
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 5 of Neogenin / Mus musculus P97798-5
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Lipase / Mus musculus Q3UT41
- LisH domain and HEAT repeat-containing protein KIAA1468 / Mus musculus Q148V7
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal alpha-mannosidase / Mus musculus O09159
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Major prion protein / Mus musculus P04925
- Mammalian ependymin-related protein 1 / Mus musculus Q99M71
- Metabotropic glutamate receptor 2 / Mus musculus Q14BI2
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Metabotropic glutamate receptor 5 / Mus musculus Q3UVX5
- Mucolipin-1 / Mus musculus Q99J21
- Multiple epidermal growth factor-like domains protein 9 / Mus musculus Q8BH27
- Myelin-oligodendrocyte glycoprotein / Mus musculus Q61885
- Myeloperoxidase / Mus musculus P11247
- N-acetylglucosamine-6-sulfatase / Mus musculus Q8BFR4
- Neural cell adhesion molecule 1 / Mus musculus P13595
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurexin-3 / Mus musculus Q6P9K9
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal pentraxin-1 / Mus musculus Q62443
- Neuroplastin / Mus musculus P97300
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus Q8BGT0
- P2X purinoceptor 4 / Mus musculus Q9JJX6
- Palmitoyl-protein thioesterase 1 / Mus musculus O88531
- Phospholipase D3 / Mus musculus O35405
- Phospholipase D4 / Mus musculus Q8BG07
- Plexin-B1 / Mus musculus Q8CJH3
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Probable G-protein coupled receptor 158 / Mus musculus Q8C419
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein sidekick-2 / Mus musculus Q6V4S5
- Protocadherin-1 / Mus musculus F7BJK1
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Reelin / Mus musculus Q60841
- Reticulocalbin-1 / Mus musculus Q05186
- Seizure 6-like protein / Mus musculus Q6P1D5
- Semaphorin-4B / Mus musculus Q62179
- Semaphorin-4D / Mus musculus O09126
- Semaphorin-4G / Mus musculus Q9WUH7
- Sialate O-acetylesterase / Mus musculus P70665
- SID1 transmembrane family member 1 / Mus musculus Q6AXF6
- Signal-regulatory protein alpha / Mus musculus P97797
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus Q4VA53
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus P97370
- Sortilin-related receptor / Mus musculus O88307
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- Tenascin / Mus musculus Q80YX1
- Tenascin-r / Mus musculus Q8BYI9
- Testican-2 / Mus musculus Q9ER58
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus Q69ZU6
- Transferrin receptor protein 1 / Mus musculus Q62351
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane protein 2 / Mus musculus Q5FWI3
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Tyrosine-protein kinase receptor / Mus musculus Q6VNS1
- Vascular cell adhesion protein 1 / Mus musculus P29533
- Vasopressin-neurophysin 2-copeptin / Mus musculus P35455
- Versican core protein / Mus musculus Q62059
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus Q9Z1L5
- VPS10 domain-containing receptor SorCS2 / Mus musculus Q9EPR5
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Asgp-1 / Rattus norvegicus
- Mrc ox-45 surface antigen / Rattus norvegicus P10252
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Mucin / Bufo bufo
- Mucin / Rana clamitans
- Mucin / Rana ridibunda
- Uncharacterized protein / Physomitrella patens
- Uncharacterized protein / Caenorhabditis elegans
- Fg / Autographa californica nucleopolyhedrovirus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Interleukin-2 [mu33] / Spodoptera frugiperda P60568
- Membrane glycoproteins / Spodoptera frugiperda
- Bg60 / Cynodon dactylon
- Surface protein gp120 / Human immunodeficiency virus
- Peroxidase c1a / Armoracia rusticana P00433
- Uncharacterized protein / Juglans regia
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Uncharacterized protein / Prunus dulcis var. sativa
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Mucosa of Stomach (UBERON_0001199)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Submandibular Gland (UBERON_0001736)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LOVO (CVCL_0399)
- LS174T (CVCL_1384)
- SPC-Mb-92-C6 (CVCL_VT62)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell Jelly Coat
- Pollen (BTO_0001097)
- Seed (BTO_0001226)
Source
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-3)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-3)Man(b1-4)GlcNAc
- Free / No-core / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-4)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / Complex / Structure 10984
- N-Linked / No-core / Gal(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10068
- N-Linked / Pauci-Mannose / Structure 10536
- N-Linked / Undefined core / Structure 9559
- O-Linked / Core 1 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(a1-3)GalNAc(a1-3)[Fuc(a1-2)]Gal(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)[Fuc(a1-3)]GlcNAc(b1-6)[Gal(b1-3)]Gal(b1-3)GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(a1-3)Gal(a1-4)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-2)Gal(a1-3)[Fuc(a1-2)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Structure 11038
- O-Linked / Core 9 / Fuc(a1-2)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-6)]GalNAc
- O-Linked / Undefined core / Man(?1-6)Glc(?1-4)GlcNAc(?1-4)[Fuc(?1-2)]Gal(?1-3)GalNAc
Reported structure
- Hex:3 HexNAc:2 dHex:1 (avg mass : 1056.9755 )
Composition
- Adenocarcinoma (DOID:299)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Fucosidosis (DOID:14500)
- Gangliosidosis GM1 (DOID:3322)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Mixed phenotype acute leukemia (DOID:9953)
- Myeloma, Multiple (DOID:9538)
- Ovarian cyst (DOID:5119)
- Prostate cancer (DOID:10283)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena DomÃnguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Species specificity of O-linked carbohydrate chains of the oviducal mucins in amphibians: structural analysis of neutral oligosaccharide alditols released by reductive beta-elimination from the egg-jelly coats of Rana clamitans. (2002 - Delplace F, Maes E, Lemoine J, Strecker G) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Diversity of O-linked glycosylation patterns between species. Characterization of 25 carbohydrate chains from oviducal mucins of Rana ridibunda. (2001 - Mourad R, Morelle W, Neveu A, Strecker G) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- The carbohydrate moiety of the bermuda grass antigen BG60. New oligosaccharides of plant origin. (1996 - Ohsuga H, Su S, Takahashi N, Yang S, Nakagawa H, Shimada I, Arata Y, Lee Y) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human H+Leb+ gastric mucin. (1984 - Slomiany B, Zdebska E, Slomiany A) / Status : Reviewed
- Structures of carbohydrate chains of glycoprotein isolated from goat submaxillary mucin. (1982 - Dutta B, Rao C) / Status : Reviewed
- Urinary oligosaccharides of fucosidosis. Evidence of the occurrence of X-antigenic determinant in serum-type sugar chains of glycoproteins. (1978 - Nishigaki M, Yamashita K, Matsuda I, Arashima S, Kobata A) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
Reference
- Acid ceramidase / Homo sapiens
- Acid sphingomyelinase-like phosphodiesterase 3a / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-L-iduronidase / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Angiopoietin-2 / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein D / Homo sapiens
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Beta-hexosaminidase subunit beta / Homo sapiens
- Beta-klotho / Homo sapiens
- Calreticulin / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Asn-650
- Cathepsin D / Homo sapiens
- Cathepsin Z / Homo sapiens
- CD109 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- CD63 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Clusterin / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Di-N-acetylchitobiase / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgin subfamily a member 4 / Homo sapiens
- Group XV phospholipase A2 / Homo sapiens
- Haptoglobin / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
- HLA class II histocompatibility antigen, DR beta 5 chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-4 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Interferon omega-1 / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- N-sulphoglucosamine sulphohydrolase / Homo sapiens
- Neutrophil gelatinase-associated lipocalin / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipase D3 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolyl 3-hydroxylase 1 / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein canopy homolog 3 / Homo sapiens
- Protein CREG1 / Homo sapiens
- Putative phospholipase B-like 2 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Ribonuclease T2 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Sialate O-acetylesterase / Homo sapiens
- Tenascin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Tissue alpha-L-fucosidase / Homo sapiens
- Tissue-type plasminogen activator / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Tripeptidyl-peptidase 1 / Homo sapiens
- Tryptase alpha/beta-1 / Homo sapiens
- Tryptase beta-2 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Mucin / Capra hircus
- Undefined site
-
Mucin / Equus caballus
- Undefined site
- 4F2 cell-surface antigen heavy chain / Mus musculus
- Acid ceramidase / Mus musculus
- Alkaline phosphatase, tissue-nonspecific isozyme / Mus musculus
- Alpha-N-acetylglucosaminidase / Mus musculus
- Angiotensin-converting enzyme / Mus musculus
- Arylsulfatase G / Mus musculus
- ATP-binding cassette sub-family A member 3 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Beta-hexosaminidase subunit beta / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Carboxypeptidase M / Mus musculus
- Carboxypeptidase Q / Mus musculus
- Cathepsin D / Mus musculus
- Cathepsin F / Mus musculus
- Cathepsin L1 / Mus musculus
- Cathepsin Z / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell adhesion molecule 1 / Mus musculus
- Cerebellin-2 / Mus musculus
- Cerebellin-4 / Mus musculus
- Chondroadherin-like protein / Mus musculus
- Chondroitin sulfate proteoglycan 4 / Mus musculus
- Chondroitin sulfate proteoglycan 5 / Mus musculus
- Collectin-12 / Mus musculus
- Complement C1q subcomponent subunit A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-4 / Mus musculus
- Contactin-6 / Mus musculus
- Cystatin-C / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Ferric-chelate reductase 1 / Mus musculus
- Galectin-3-binding protein / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 2 / Mus musculus
- Gamma-glutamyl hydrolase / Mus musculus
- Glucosylceramidase / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Heparan N-sulfatase / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hyaluronan and proteoglycan link protein 1 / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Iduronate 2-sulfatase / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive phospholipase C-like protein 2 / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
-
Interferon beta / Mus musculus
- Undefined site
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Isoform 2 of Receptor-type tyrosine-protein phosphatase U / Mus musculus
- Isoform 2 of Tomoregulin-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 5 of Neogenin / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Lipase / Mus musculus
- LisH domain and HEAT repeat-containing protein KIAA1468 / Mus musculus
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal alpha-mannosidase / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Major prion protein / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 2 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metabotropic glutamate receptor 5 / Mus musculus
- Mucolipin-1 / Mus musculus
- Multiple epidermal growth factor-like domains protein 9 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Myeloperoxidase / Mus musculus
- N-acetylglucosamine-6-sulfatase / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurexin-3 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Neuroplastin / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus
- P2X purinoceptor 4 / Mus musculus
- Palmitoyl-protein thioesterase 1 / Mus musculus
- Phospholipase D3 / Mus musculus
- Phospholipase D4 / Mus musculus
- Plexin-B1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Probable G-protein coupled receptor 158 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Reelin / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Seizure 6-like protein / Mus musculus
- Semaphorin-4B / Mus musculus
- Semaphorin-4D / Mus musculus
- Semaphorin-4G / Mus musculus
- Sialate O-acetylesterase / Mus musculus
- SID1 transmembrane family member 1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sister chromatid cohesion protein PDS5 homolog B / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
- Sortilin-related receptor / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- Tenascin / Mus musculus
- Tenascin-r / Mus musculus
- Testican-2 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Transferrin receptor protein 1 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane protein 2 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Tyrosine-protein kinase receptor / Mus musculus
- Vascular cell adhesion protein 1 / Mus musculus
- Vasopressin-neurophysin 2-copeptin / Mus musculus
- Versican core protein / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-3 / Mus musculus
- VPS10 domain-containing receptor SorCS2 / Mus musculus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Mucin / Rana clamitans
- Undefined site
-
Mucin / Rana ridibunda
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Bg60 / Cynodon dactylon
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- VNLTTR (6aa)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- SVAQNYSSITHLHSIGK (17aa)
- NVLLIVADDGGFESGVYNNTAIATPHLDALSR (32aa)
- NAIIIIADDGGFESGAYNNSAIATPHIDAIAR (32aa)
- KNYSVLYFQQK (11aa)
- NYSVIYFQQK (10aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- HECHFFNGTER (11aa)
- FECHFFNGTER (11aa)
- P04229 Asn-48     HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- Q9TQE0 Asn-48     HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Q30167 Asn-48     HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- QECYAFNGTQR (11aa)
- YECHFFNGTER (11aa)
- WQMNFTVR (8aa)
- HQNLTEVPNTIPELTQR (17aa)
- WYSAGLASNSSWFR (14aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- GKSNCSELNLR (11aa)
- QTVEEEGGASSYNTSSK (17aa)
- GGNVTLPCK (9aa)
- YETTNK (6aa)
- ISPGKNATGMEVGWYR (16aa)
- VDQNDNTSLQWSNPAQQTLYFDDKK (25aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- SNVTWF (6aa)
- QGNASDVILR (10aa)
- EEEAIQLDGLNASQIR (16aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- APLVNVTLYYEALCGGCR (18aa)
- CIQANYSIMENGK (13aa)
- VYSGVVSLSTENIYSFNHTSHPGQVTAVR (29aa)
- LEPNSVDPENITEILIANQK (20aa)
- AIGFENATQAIGR (13aa)
- NKSVLLGR (8aa)
- DVTVIEGEVATISCQVNK (18aa)
- FHAIHVSGTNGTKR (14aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTK (13aa)
- HAIHVSGTNGTKR (13aa)
- HAIHVSGTNGTK (12aa)
- TVTISDHGTVTYNGSICGDDQNGPK (25aa)
- GVAVTNTSQLGFR (13aa)
- NYTLWR (6aa)
- RMELSVGAIQANR (13aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- DNATEEEILVYLEK (14aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- MTPNIIHIAPENFYISHSPNSTAGPSCTIIEEAFRR (36aa)
- MTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFR (35aa)
- ENTSDPSIVIAFGR (14aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- STNHEPSEMSNK (12aa)
- SYNVTSVIFR (10aa)
- YHGFINTSYHR (11aa)
- IRNVSDTTKR (10aa)
- YHGFLNTSYHR (11aa)
- YHGFLNTSYH (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- SQTNLTDCPFHDQPHLMR (18aa)
- LVYNR (5aa)
- ELLSNQSEVMLR (12aa)
- TCDWIPKPNMSASCK (15aa)
- TYPNHYTLVTGLFAENHGIVANDMFDPILNK (31aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- DLCNFNEQLENGGTSLSEK (19aa)
- TFYWDFYTNR (10aa)
- AYWPDVIHSFPNR (13aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- LSYNFTHLDGYLDLLR (16aa)
- GISYNFTHIDGYIDIIR (17aa)
- ISNVTPADAGIYYCVK (16aa)
- STNHEPSEMSNR (12aa)
- GKNNQTECFNHVR (13aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- NVETNNSTVLIEGK (14aa)
- IFYNLSIQ (8aa)
- IFYNLSIQS (9aa)
- VHSGNFSTIPQYFK (14aa)
- KDDEPLETTGDFNTTK (16aa)
- SISNSTAR (8aa)
- IVNNATNVVIK (11aa)
- LIVNNATNVVIK (12aa)
- TQSLLIVNNATNVVIK (16aa)
- LVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYR (37aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- DAGVVCTNET (10aa)
- DAGVVCTNETR (11aa)
- FGCEIENNR (9aa)
- LKFNSTIK (8aa)
- NNHTASIIDR (10aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- FNPNISWQPIPVHTVPITEDR (21aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- AREPSNATQLDGPAR (15aa)
- LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
- VELVPLPSWQPVGENFTLSCR (21aa)
- IGIYADVGNK (10aa)
- NIGNTSEGPR (10aa)
- LENLSSTESGYTATLTR (17aa)
- IENISSSEMGYTATITR (17aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- ANDSDQGANAEIDYTFHQAPEVVR (24aa)
- VLTNQESPYQNHTGR (15aa)
- CCGAANYTDWEK (12aa)
- VVMDIPYEIWNETSAEVADIKK (22aa)
- CNSVLTYNLTPVVQK (15aa)
- IHDSFPTYYLPYNESVSFEDR (21aa)
- VYMKNVTVVLR (11aa)
- AGPNGTIFVADAYK (14aa)
- YDIPASINFIINK (13aa)
- KLPLNFTEGAR (11aa)
- NFTGGQLHSR (10aa)
- LEQNFFNCSCDIR (13aa)
- VYTYADTPNDFQLSNFSLPEEDTK (24aa)
- VYSSANNCTFEY (12aa)
- VYSSANNCTF (10aa)
- VYTYADTPNDFQLSNFSLPEEDTKLK (26aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VYSSANNCTFE (11aa)
- NQKDEINETDLK (12aa)
- NQSVPISCCR (10aa)
- NISVVVATHSPTLAK (15aa)
- YYNYTLSINGK (11aa)
- YWGIHLQAFVQNGTVSK (17aa)
- QTPEYQNR (8aa)
- SSPDTQDLYCLNESSK (16aa)
- QTPEYQNESSR (11aa)
- IVVYNQPYINYSR (13aa)
- GHVDPANDTFDIDPR (15aa)
- NYTVVMSTR (9aa)
- DCYPVQETFIRNYTVVMSTR (20aa)
- YYNYTISINGK (11aa)
- ECHAIRNYTLW (11aa)
- ECHAIRNYTIWR (12aa)
- TYTYADTPDDFQIHNFSIPEEDTK (24aa)
- ECHTIQNYTLWR (12aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- DGKPLLNDSR (10aa)
- VNTLEEGKGGPKNDTEER (18aa)
- VEPSDVGNYTCFVTNK (16aa)
- INITNIWVIDYFGGPK (16aa)
- QHTVTTTTKGENFTETDVK (19aa)
- EDVYRNHSIFIADINQER (18aa)
- IVQAEYWHDPIKEDVYRNHSIFIADINQER (30aa)
- NHSIFLADINQER (13aa)
- LVQAQYWHDPIKESVYRNYSIFLADINQER (30aa)
- NFTMNEK (7aa)
- TGEANITQIYIQEAIDFIKR (20aa)
- TPLTANITK (9aa)
- VLVAPPSEEANTTK (14aa)
- LAAPNLTVEEGK (12aa)
- GNYSCFVSSPSITK (14aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- KNLFLNHSENATAKD (15aa)
- GINESYKK (8aa)
- QDQQLQNCTEPG (12aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- TNSSFIQGFVDHVK (14aa)
- ILLQDLSSSAHHLANATLETEWFHGLR (27aa)
- TNSTFVQAIVEHVKEECDR (19aa)
- TNSTFVQALVEHVK (14aa)
- SIVYSCEWPIYMWPFQKPNYTEIR (24aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- TNSTFVQALVEHVKEECDR (19aa)
- SFNATAER (8aa)
- DEDAENLGHFVMFPANGSIDLMYFPYYGKK (30aa)
- DEDAENLGHFVMFPANGSIDLMYFPYYGK (29aa)
- AEFAVANDTGFVDIPQQEK (19aa)
- ANLTK (5aa)
- NTTISVHPSTR (11aa)
- ENSKQNGSANSATNPAGLDK (20aa)
- YHANTSAQQLFQK (13aa)
- NRTDVEYELDEK (12aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- VNGTWLQAGVVSWGEGCAQPNRPGIYTR (28aa)
- VNGTWLQAGVVSWDEGCAQPNRPGIYTR (28aa)
- VDLPIGINITR (11aa)
- ELGVVMYNCSCLAR (14aa)
- EIGVVMYNCSCIAR (14aa)
- HMNETSHTQGSLR (13aa)
- LLFPTNSSSR (10aa)
- DRNSSDETFLK (11aa)
- KDNTTVTR (8aa)
- NSSDETFLK (9aa)
- NDRNSSDETFIK (12aa)
- DNTTVTR (7aa)
- FLNVTPNVEVNVECR (15aa)
- NANGSYTCEECDSSCVGCTGEGPGNCK (27aa)
- YQYVDCGRNTT (11aa)
- VASVININPNTTHSTGSCR (19aa)
- SVLENTTSYEEAK (13aa)
- VFPQVNVTK (9aa)
- YYHGELSYLNVTRK (14aa)
- YYHGELSYLNVTR (13aa)
- IININPNK (8aa)
- VYIIAHVPVGYLPSSQNITAMR (22aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- WGQNCSCHHGGYYNCEDK (18aa)
- GTEVNTTVIGENDPIDEVQGFIFGK (25aa)
- ERPPTFLTPEGNESHKEELR (20aa)
- VVANGTGTQGQIK (13aa)
- SAVSTSWLLPYNHTWSHEK (19aa)
- SAVSTSWIIPYNYTWSPEK (19aa)
- LNPNVTLDGDSLVATATATASAEQEGTK (28aa)
- LNSSTIK (7aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- GQCANGTCLCQEGYAGEDCSQR (22aa)
- KKENGVFEEISNSSGR (16aa)
- IIAPAYFIIGGNQSGEGCVITR (22aa)
- DLGPALANSSHDVK (14aa)
- VLENEKFDTHEYHNESR (17aa)
- DYGNYTCVATNK (12aa)
- VIYQNHNK (8aa)
- QINSSISGNIWDK (13aa)
- ACPLDPATNK (10aa)
- TGCLPCQCNNR (11aa)
- TQVFGPVDPTVNTTYAFFNTFFK (23aa)
- ALIYQFSPIYTGNISSFQQCYIFD (24aa)
- FFHVNGSAFLPR (12aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- EDGMLPANR (9aa)
- RNITLPEAK (9aa)
- DLGPTLANSTHHNV (14aa)
- DIGPTIANSTHHNVR (15aa)
- ETQENLTVYSFPTPLLTLSEPEAPEGK (27aa)
- NYFHYNQSYPPTYNVK (16aa)
- KMSNITFR (8aa)
- YYTCLIYNCSAQPHIAPFSGPIDR (24aa)
- VQPIVAVADEGWYILQNK (18aa)
- FENQTCFPLPDSR (13aa)
- FPNITNLCPF (10aa)
- FPNITNL (7aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- IIDNNKTEK (9aa)
- LIDNNK (6aa)
- TLFLFPNQTGFPSK (14aa)
- VPYNVGPGFAGNFSTQK (17aa)
- EMLPFWMNSTGK (12aa)
- CLNHTTQK (8aa)
- GEVFNATRF (9aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- VFNATR (6aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- NLGGLETEDDYGYQGHVQTCNFSAQMAK (28aa)
- NISSEEK (7aa)
- QGNNHTCTWK (10aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- PGDPGKDLASGENGTECR (18aa)
- DLASGENGTECR (12aa)
- PRPGDPGKDLASGENGTECR (20aa)
- VQPFNVTQGK (10aa)
- VYINDSVELSR (11aa)
- IHNLTYLK (8aa)
- KNFTK (5aa)
- GPGIKPNQTSK (11aa)
- ALVTLEGIPAAVPGQPAELQLNVTK (25aa)
- IANITQGEDQYYIR (14aa)
- LEGFAQENSKYNK (13aa)
- AANYTSSLNLPDK (13aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- HTDDLTSLNNTLVNIR (16aa)
- MIVANIDIGPTIIDIAGYDINK (22aa)
- NIDLGPTILDIAGYDLNK (18aa)
- DNHTHSDIQVK (11aa)
- AFLLSLAALRDNHTHSDIQVK (21aa)
- IQDFNYTDHTLGR (13aa)
- QVVENMTR (8aa)
- MGQNVSLNLR (10aa)
- EVMNLLQPLNVTK (13aa)
- KINSSLQLPDR (11aa)
- GFFCDAALDVDGETLRKNQSSELR (24aa)
- YKGLNLTEDTYKPR (14aa)
- NLTFEGPLPEK (11aa)
- ALCPNTTR (8aa)
- VFIVPVGNHSNIPFSR (16aa)
- NSTKQEIIAAIEK (13aa)
- AVAYGEKNLTFQGPLPK (17aa)
- NLSASVIAVTIQGGAHHLDLR (21aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
- YTLGGSHNQTIR (12aa)
- INFTAPFNPNK (11aa)
- ANQTALCGGGVQTR (14aa)
- RANQTALCGGGVQTR (15aa)
- SSSHLPPSSYFNASGR (16aa)
- FLSSSPHLPPSSYFNASG (18aa)
- FISSSPHIPPSSYFNASGR (19aa)
- HIPGIIHNMTAR (12aa)
- EKLLLPAKNTTHLK (14aa)
- LLLPAKNTTHLK (12aa)
- EETLLYDNATSSVADRK (17aa)
- DGQLLPSSNYSNIK (14aa)
- IVQIFPNDTSIK (12aa)
- TNTSALLYDSLR (12aa)
- SYNDSVDPR (9aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- NSTKEEILAALEK (13aa)
- GETASLLCNISVR (13aa)
- NNVITINITGK (11aa)
- IINVTK (6aa)
- IINGSQR (7aa)
- VPGNVTAVIGETIK (14aa)
- NNEGGVIAQLPSDVTSFNQTGLKPGEEYIVNVVALK (36aa)
- YEQGTGCWQGPNR (13aa)
- IIISPEENVTLTCTAENQLER (21aa)
- CTSQHLLNR (9aa)
- LSHYKQNFSFCR (12aa)
- ANSTGTLVITNPTR (14aa)
- GKANSTGTLVITNPTR (16aa)
- ALADVLQDIADDNSSR (16aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- SDVPNTSPNSTSQHVAEFETER (22aa)
- TPASDPHGDNLTYSVFYTK (19aa)
- SDINPANGSYPFQAIR (16aa)
- RHEEGHMINCTCFGQGR (17aa)
- LLLTAAPNLTTSPAFR (16aa)
- AAIPSAIDTNSSK (13aa)
- LVNSTFLHNK (10aa)
- TVIRPFYLTNSS (12aa)
- TVIRPFYLTNS (11aa)
- GTNESEASSTQFTTEIDAPK (20aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- YQDVNCTEVPVAIHADQL (18aa)
- QDVNCTEVPVAIHADQL (17aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- GNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHR (35aa)
- TPNNNGT (7aa)
- GVPLVGADVCGFLGNTSEELCVR (23aa)
- AGCLIGAEHVNNSY (14aa)
- VPGNQTSTTLK (11aa)
- NSTVMSR (7aa)
- STEVSNHTLK (10aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- QKNITAFNETLFR (13aa)
- IETILLNGTDRK (12aa)
- DAGVGFPEYQEEDNSTYNFR (20aa)
- INCNSSKGPETLYAGQK (17aa)
- INQTEPVAGNYYPVNTR (17aa)
- RDDYRPTWTLNQTEPVAGNYYPVNTR (26aa)
- EQTVSDPFLVVSNTSTFVPYEIK (23aa)
- ETWNNVTVWGSR (12aa)
- QTGLAPGQEYEISLHIVKNNTR (22aa)
- QKDGDDEWTSVVVANVSK (18aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- VSVVNSTLAEVHWDPVPPK (19aa)
- VINETWAWK (9aa)
- FKVLASNR (8aa)
- QMVENFSPNQTK (12aa)
- NNTIVNEIVR (10aa)
- VTVIGVATAPQQVISNGVPVSNFTYSPDTK (30aa)
- EVTVLGVATAPTQVLSNGIPVSNFTYSPDNK (31aa)
- AEPPLNASAGDQEEK (15aa)
- AEPPINASASDQGEK (15aa)
- NTTSYVLR (8aa)
- AVESFTWNITILKGQADLLK (20aa)
- KNNTCVKEENTCLR (14aa)
- VPAQEKNF (8aa)
- HVTYVPAQEKNF (12aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- GVFVSNGTHWFVTQR (15aa)
- NFSNTK (6aa)
- VNSSLHSQISR (11aa)
- SDEFNCSSGMCIR (13aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- NCYHYDYNVTDWSTCQLSEK (20aa)
- TLAGENQTALEIEELNRK (18aa)
- TLAGENQTALEIEELNR (17aa)
- KYEQAKNISQDLEK (14aa)
- YEQAKNISQDLEK (13aa)
- KCNGFHCPNGTCIPSSK (17aa)
- YTSDPNVTSVGPSK (14aa)
- IGSYNGTAGDSLSYHQGRPFSTEDR (25aa)
- IGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYK (39aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- RIPAINR (7aa)
- SLSPHAGTEPCPPEAAVCLLNGSKPVNLGK (30aa)
- WALHSASVSHNASAFTVDR (19aa)
- AQAALDKANASR (12aa)
- WTGHNVTVVQR (11aa)
- GPCSHLCLINYNR (13aa)
- LDPTVLDASELANR (14aa)
- THANGSIKR (9aa)
- DNATDSVPLR (10aa)
- GCKDNATDSVPLR (13aa)
- RGCKDNATDSVPLR (14aa)
- VETGENCTSPAPK (13aa)
- CRDGSCIGNSSR (12aa)
- IGSENNMTSCHRPVCR (16aa)
- KLNLDGSNYTLLK (13aa)
- RMHLNGSNVQVLHR (14aa)
- MHLNGSNVQVLHR (13aa)
- VWVCDRDNDCVDGSDEPANCTQMTCGVDEFR (31aa)
- TCPLDEFQCNNTLCKPLAWK (20aa)
- LTSCATNASMCGDEAR (16aa)
- GVTHLNISGLK (11aa)
- QTGDVTCNCTDGR (13aa)
Mass spectrometry observed peptide
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- Free / No-core
(avg mass : 1056.9755)
- Urine (UBERON_0001088)
- Fucosidosis (DOID:14500)
-
- N-Linked / Complex
(avg mass : 1056.9755)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
-
- N-Linked / No-core
(avg mass : 1056.9755)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / No-core
(avg mass : 1056.9755)
- Hemolymph (UBERON_0001011)
-
Interferon beta / Mus musculus
- Undefined site
-
- N-Linked / No-core
(avg mass : 1056.9755)
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Venom (UBERON_0007113)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Pollen (BTO_0001097)
- Seed (BTO_0001226)
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- The carbohydrate moiety of the bermuda grass antigen BG60. New oligosaccharides of plant origin. (1996 - Ohsuga H, Su S, Takahashi N, Yang S, Nakagawa H, Shimada I, Arata Y, Lee Y) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Bg60 / Cynodon dactylon
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LS174T (CVCL_1384)
- SPC-Mb-92-C6 (CVCL_VT62)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Mixed phenotype acute leukemia (DOID:9953)
- Myeloma, Multiple (DOID:9538)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- X-ray crystal structure and characterization of halide-binding sites of human myeloperoxidase at 1.8 A resolution. (2000 - Fiedler T, Davey C, Fenna R) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Fractionation and characterization of boar seminal plasma spermadhesion PSP-II glycoforms reveal the presence of uncommon N-acetylgalactosamine-containing N-linked oligosaccharides. (1997 - Solis D, Calvete J, Sanz L, Hettel C, Raida M, Diaz-Maurio T, Tpfer-Petersen E) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Novel tyvelose-containing tri- and tetra-antennary N-glycans in the immunodominant antigens of the intracellular parasite Trichinella spiralis. (1994 - Reason A, Ellis L, Appleton J, Wisnewski N, Grieve R, McNeil M, Wassom D, Morris H, Dell A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interferon omega 1 in Sf9 cells. No evidence for complex-type N-linked glycosylation or sialylation. (1993 - Voss T, Erglen E, Ahorn H, Kubelka V, Sugiyama K, Maurer-Fogy I, Glssl J) / Status : Reviewed
- Biosynthesis and secretion of human interleukin 2 glycoprotein variants from baculovirus-infected Sf21 cells. Characterization of polypeptides and posttranslational modifications. (1993 - Grabenhorst E, Hofer B, Nimtz M, Jger V, Conradt H) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characterization of the oligosaccharide structures on bee venom phospholipase A2. (1993 - Hollander T, Aeed P, Elhammer A) / Status : Reviewed
- Alpha 1-6(alpha 1-3)-difucosylation of the asparagine-bound N-acetylglucosamine in honeybee venom phospholipase A2. (1992 - Staudacher E, Altmann F, Marz L, Hard K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Characterization of oligosaccharide structures on a chimeric respiratory syncytial virus protein expressed in insect cell line Sf9. (1991 - Wathen M, Aeed P, Elhammer A) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Arylsulfatase a / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Interferon omega-1 / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Interferon beta / Mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Mrc ox-45 surface antigen / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Fg / Autographa californica nucleopolyhedrovirus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Interleukin-2 [mu33] / Spodoptera frugiperda
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- KDIVEYYNDSNGSHVLQGRF (20aa)
- KNLFLNHSENATAKD (15aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- BTI-Tn-5B1-4 (CVCL_C190)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- VNLTTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
- Ascitic fluid (UBERON_0007795)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Undefined core
(avg mass : 1056.9755)
- Embryo (UBERON_0000922)
-
- O-Linked / Core 1
(avg mass : 1056.9755)
- Ovary (UBERON_0000992)
- Ovarian cyst (DOID:5119)
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Bufo bufo
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Rana clamitans
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
-
Mucin / Equus caballus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Immunochemical properties of B-active and non-B-active blood group substances from horse gastric mucosae and the relative size distributions of oligosaccharides liberated by base-borohydride. (1976 - Newman W, Kabat E) / Status : Reviewed
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Mucin / Equus caballus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Rana clamitans
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- Egg Cell Jelly Coat
-
Mucin / Rana ridibunda
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1056.9755)
- LOVO (CVCL_0399)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 9
(avg mass : 1056.9755)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1056.9755)
-
Mucin / Capra hircus
- Undefined site
-
- Hex:3 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1056.9755)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- BTI-Tn-5B1-4 (CVCL_C190)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Structure 10984
- N-Linked / No-core / Gal(b1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-3)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / No-core / Man(a1-3)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-3)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Pauci-Mannose / Structure 10068
- N-Linked / Pauci-Mannose / Structure 10536
- N-Linked / Undefined core / Structure 9559
Source
Suggested structure
- Hex:3 HexNAc:2 dHex:1 / N-Linked
(avg mass : 1056.9755)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1056.9755)
Reported glycosite
- O-Linked / Core 9
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1056.9755)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1056.9755)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1056.9755)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 1056.9755)