taxonomy (5)
protein (79)
source (14)
structure (17)
composition (1)
disease (9)
reference (32)
site (101)
peptide (81)
- Homo sapiens (Human)
- Equus caballus (Domestic horse)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Adenosine deaminase 2 / Homo sapiens Q9NZK5
- Adipocyte enhancer-binding protein 1 / Homo sapiens Q8IUX7
- Alpha-mannosidase 2 / Homo sapiens Q16706
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD166 antigen / Homo sapiens Q13740
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Decorin / Homo sapiens P07585
- Desmoglein-2 / Homo sapiens Q14126
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Galectin-3-binding protein / Homo sapiens Q08380
- Glutaminase kidney isoform, mitochondrial / Homo sapiens O94925
- GPI inositol-deacylase / Homo sapiens Q75T13
- Haptoglobin / Homo sapiens P00738
- Hepatitis a virus cellular receptor 2 / Homo sapiens Q8TDQ0
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit beta-1 / Homo sapiens P07942
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Microfibril-associated glycoprotein 4 / Homo sapiens P55083
- Mucin-5B / Homo sapiens Q9HC84
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Periostin / Homo sapiens Q15063
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens P04180
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- Serotransferrin / Homo sapiens P02787
- Transferrin receptor protein 1 / Homo sapiens P02786
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uromodulin / Homo sapiens P07911
- WAP four-disulfide core domain protein 2 / Homo sapiens Q14508
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Immunoglobulin gamma / Equus caballus
- Ovotransferrin / Gallus gallus P02789
- Acetylcholine receptor protein / Torpedo californica P02712 P02718 P02710 P02714
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- C10 (CVCL_5245)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
Source
- N-Linked / Complex / Structure 289
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1945
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 9374
- N-Linked / Complex / Structure 9778
- N-Linked / Complex / Structure 10041
- N-Linked / Complex / Structure 10230
- N-Linked / Complex / Structure 10248
- N-Linked / Complex / Structure 10429
- N-Linked / Complex / Structure 10522
- N-Linked / Complex / Structure 10938
- N-Linked / Complex / Structure 10947
- N-Linked / Complex / Structure 10977
- O-Linked / Core 2 / Structure 9528
- O-Linked / Core 2 / Structure 11053
- O-Linked / Core 2 / Structure 11083
Reported structure
- Hex:5 HexNAc:5 NeuAc:1 (avg mass : 2135.9602 )
Composition
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Hypersensitivity reaction disease (DOID:0060056)
- Myeloma, Multiple (DOID:9538)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
Disease
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Change in glycosylation of chicken transferrin glycans biosynthesized during embryogenesis and primary culture of embryo hepatocytes. (1994 - Jacquinot P, Leger D, Wieruszeski J, Coddeville B, Montreuil J, Spik G) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Adenosine deaminase 2 / Homo sapiens
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Alpha-mannosidase 2 / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Glutaminase kidney isoform, mitochondrial / Homo sapiens
- GPI inositol-deacylase / Homo sapiens
- Haptoglobin / Homo sapiens
- Hepatitis a virus cellular receptor 2 / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-316
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Microfibril-associated glycoprotein 4 / Homo sapiens
- Mucin-5B / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
Ovotransferrin / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- TAVNCSSDFDACLITK (16aa)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- YKNNSDISSTR (11aa)
- DVNCSVMGPQEK (12aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- AIGFENATQAIGR (13aa)
- MLFVEPILEVSSLPTTNSTTNSATK (25aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- DIYTFDGALNK (11aa)
- HAIHVSGTNGTKRF (14aa)
- AEMNGSK (7aa)
- DSVINLSESVEDGPK (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- INISENYTISISNAR (15aa)
- TFYWDFYTNR (10aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- TQSLLIVNNATNVVIK (16aa)
- FGCEIENNR (9aa)
- VDIEDFENNTAYAK (14aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- DFTAAFPR (8aa)
- VYSSANNCTFE (11aa)
- TPLTANITK (9aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- KNLFLNHSENATAKD (15aa)
- VVLHPNYSQVDIGLIK (16aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- DFEDLYTPVNGSIVIVR (17aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- MIENGSISFIPTIR (14aa)
- DTCPPLMLYNPTTYQMDVNPEGK (23aa)
- THTNISE (7aa)
- ITDIENGSIANIPR (14aa)
- FLLKYNENGTIT (12aa)
- MAWPEDHVFISTPSFNYTGR (20aa)
- FPNITNLCPFGE (12aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- NATVVWMK (8aa)
- IANITQGEDQYYIR (14aa)
- NILDALMLNTTR (12aa)
- LLIAGTNSSDLQQILSLLESNK (22aa)
- IYTHVYCQSTMLDTNSWIFACINSTSMCLQGVDLSWK (37aa)
- SFHNFTLCYIK (11aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- YVQNGTYTVK (10aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- IYPITWNGSICMR (13aa)
- NASGIYAEIDGAK (13aa)
- EVNDTLLVNELK (12aa)
- WNNTPMDEALHFGHHDVFK (19aa)
- KFGRNGSDCPDKF (13aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- LSDTTSQSNSTAK (13aa)
- DIECQAESFPNWTLAQVGQK (20aa)
- VAVVQHAPSESVDNASMPPVK (21aa)
- EAGNITTDGYEIIGK (15aa)
- AFGQFFSPGEVIYNK (15aa)
- AFGQFFSPGEVIYNKTDR (18aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Blood Serum (UBERON_0001977)
- Control/Healthy
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- Immunoglobulin alpha (non secretory) / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- YKNNSDISSTR (11aa)
- ENISDPTSPLR (11aa)
- GLTFQQNASSM(SO)CVPDQDTAIR (25aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- THTNISE (7aa)
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Change in glycosylation of chicken transferrin glycans biosynthesized during embryogenesis and primary culture of embryo hepatocytes. (1994 - Jacquinot P, Leger D, Wieruszeski J, Coddeville B, Montreuil J, Spik G) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Structure of the carbohydrate units of IgA1 immunoglobulin. I. Composition, glycopeptide isolation, and structure of the asparagine-linked oligosaccharide units. (1974 - Baenziger J, Kornfeld S) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Ovotransferrin / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Haptoglobin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KNLFLNHSENATAKD (15aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KFGRNGSDCPDKF (13aa)
-
- N-Linked / Complex
(avg mass : 2135.9602)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin gamma / Equus caballus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Blood Serum (UBERON_0001977)
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Blood Plasma (UBERON_0001969)
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2135.9602)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
-
- O-Linked / Core 2
(avg mass : 2135.9602)
- Urine (UBERON_0001088)
- Hepatitis a virus cellular receptor 2 / Homo sapiens
- DFTAAFPR (8aa)
-
- O-Linked / Core 2
(avg mass : 2135.9602)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 2
(avg mass : 2135.9602)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- Hex:5 HexNAc:5 NeuAc:1 / N-Linked
(avg mass : 2135.9602)
- Blood Serum (UBERON_0001977)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Jurkat (CVCL_0065)
- N-Linked / Complex / Structure 289
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 1945
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / Structure 9374
- N-Linked / Complex / Structure 9778
- N-Linked / Complex / Structure 10041
- N-Linked / Complex / Structure 10230
- N-Linked / Complex / Structure 10248
- N-Linked / Complex / Structure 10429
- N-Linked / Complex / Structure 10522
- N-Linked / Complex / Structure 10938
- N-Linked / Complex / Structure 10947
- N-Linked / Complex / Structure 10977
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Adenosine deaminase 2 / Homo sapiens
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Alpha-mannosidase 2 / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- CD166 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Glutaminase kidney isoform, mitochondrial / Homo sapiens
- GPI inositol-deacylase / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Microfibril-associated glycoprotein 4 / Homo sapiens
- Mucin-5B / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Periostin / Homo sapiens
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Serotransferrin / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Uromodulin / Homo sapiens
- WAP four-disulfide core domain protein 2 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TAVNCSSDFDACLITK (16aa)
- TGVCPELQADQNCTQECVSDSECADNLK (28aa)
- DVNCSVMGPQEK (12aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- AIGFENATQAIGR (13aa)
- MLFVEPILEVSSLPTTNSTTNSATK (25aa)
- ENISDPTSPLR (11aa)
- DIYTFDGALNK (11aa)
- HAIHVSGTNGTKRF (14aa)
- AEMNGSK (7aa)
- DSVINLSESVEDGPK (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- INISENYTISISNAR (15aa)
- TFYWDFYTNR (10aa)
- FGCEIENNR (9aa)
- VDIEDFENNTAYAK (14aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TPLTANITK (9aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- VVLHPNYSQVDIGLIK (16aa)
- FHLANR (6aa)
- KDNTTVTR (8aa)
- DFEDLYTPVNGSIVIVR (17aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- MIENGSISFIPTIR (14aa)
- DTCPPLMLYNPTTYQMDVNPEGK (23aa)
- ITDIENGSIANIPR (14aa)
- FLLKYNENGTIT (12aa)
- MAWPEDHVFISTPSFNYTGR (20aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- NATVVWMK (8aa)
- IANITQGEDQYYIR (14aa)
- NILDALMLNTTR (12aa)
- LLIAGTNSSDLQQILSLLESNK (22aa)
- IYTHVYCQSTMLDTNSWIFACINSTSMCLQGVDLSWK (37aa)
- SFHNFTLCYIK (11aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- YVQNGTYTVK (10aa)
- VPGNVTAVIGETIK (14aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- IYPITWNGSICMR (13aa)
- NASGIYAEIDGAK (13aa)
- EVNDTLLVNELK (12aa)
- WNNTPMDEALHFGHHDVFK (19aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- LSDTTSQSNSTAK (13aa)
- DIECQAESFPNWTLAQVGQK (20aa)
- VAVVQHAPSESVDNASMPPVK (21aa)
- EAGNITTDGYEIIGK (15aa)
- AFGQFFSPGEVIYNK (15aa)
- AFGQFFSPGEVIYNKTDR (18aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 NeuAc:1 / N-Linked
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 2135.9602)
Source
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 2
(avg mass : 2135.9602)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2135.9602)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2135.9602)