Hex:3 HexNAc:8 dHex:1

Taxonomy

• Homo sapiens (Human)
• Trichinella spiralis
• Bothrops moojeni (Brazilian lancehead)

Protein

• C-type mannose receptor 2 / Homo sapiens    Q9UBG0
• Cathepsin D / Homo sapiens    P07339
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement factor b / Homo sapiens    P00751
• Glandular kallikrein 1 / Homo sapiens    P06870
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Uromodulin / Homo sapiens    P07911
• Zymogen granule protein 16 homolog B / Homo sapiens    Q96DA0
• Tsl-1 antigens / Trichinella spiralis    
• Uncharacterized protein / Trichinella spiralis    
• Batroxobin / Bothrops moojeni    

Source

• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  

Reported structure

• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-?)]Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 4 x HexNAc"
• N-Linked / Complex / Structure 9464

Composition

• Hex:3 HexNAc:8 dHex:1 (avg mass : 2276.1455 )

Disease

• Cancer, breast (DOID:1612)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)

Reference

• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed

Reported glycosite

• C-type mannose receptor 2 / Homo sapiens
  •        Asn-492
• Cathepsin D / Homo sapiens
  •        Asn-134
• Clusterin / Homo sapiens
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Complement factor b / Homo sapiens
  •        Asn-142
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-513
• Zymogen granule protein 16 homolog B / Homo sapiens
  •        Asn-197
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein / Trichinella spiralis
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134     Cathepsin D / Homo sapiens
• RSPYYNVSDEISFHCYDGYTLRGSANRT (28aa)
  •    P00751    Asn-142     Complement factor b / Homo sapiens
• SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
  •    Q96DA0    Asn-197     Zymogen granule protein 16 homolog B / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• WNDSPCNQSLPSICK (15aa)
  •    Q9UBG0    Asn-492     C-type mannose receptor 2 / Homo sapiens
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513     Uromodulin / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens