taxonomy (5)
protein (25)
source (6)
structure (4)
composition (1)
disease (2)
reference (8)
site (27)
peptide (13)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Clusterin / Homo sapiens P10909
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Fibronectin / Homo sapiens P02751
- Glandular kallikrein 1 / Homo sapiens P06870
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens P30464
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens P30466
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens P30475
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens P30484
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens Q29836
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens Q29718
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens P30508
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens Q95604
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens P30501
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens Q9TNN7
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens P30505
- Junctional adhesion molecule A / Homo sapiens Q9Y624
- Lactotransferrin / Homo sapiens P02788
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Thrombospondin-1 / Homo sapiens P07996
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Uncharacterized protein / Dirofilaria immitus
- Uncharacterized protein / Trichinella spiralis
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
Source
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
- N-Linked / Complex / Structure 9433
Reported structure
- Hex:3 HexNAc:7 dHex:1 (avg mass : 2072.9505 )
Composition
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
Reference
- Clusterin / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibronectin / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Hypoxia up-regulated protein 1 / Mus musculus
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- GYYNQSEAGSHTIQR (15aa)
- Q95604 Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- P30475 Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- Q29718 Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- P30505 Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Q29836 Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- P30484 Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- Q9TNN7 Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- P30508 Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- P30501 Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- P30464 Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- P30466 Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- IANITQGEDQYYIR (14aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- LGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPK (66aa)
- VVNSTTGPGEHIR (13aa)
- AFNTTK (6aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2072.9505)
- Urine (UBERON_0001088)
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2072.9505)
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2072.9505)
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 2072.9505)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
-
- Hex:3 HexNAc:7 dHex:1 / N-Linked
(avg mass : 2072.9505)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
- N-Linked / Complex / Structure 9433
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Clusterin / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibronectin / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Junctional adhesion molecule A / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Hypoxia up-regulated protein 1 / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- ELPGVCNETMMALWEECKPCLK (22aa)
- GYYNQSEAGSHTIQR (15aa)
- Q95604 Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- P30475 Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- Q29718 Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- P30505 Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- Q29836 Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- P30484 Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- Q9TNN7 Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- P30508 Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- P30501 Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- P30464 Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- P30466 Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- IANITQGEDQYYIR (14aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- LGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPK (66aa)
- VVNSTTGPGEHIR (13aa)
- AFNTTK (6aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:7 dHex:1 / N-Linked
(avg mass : 2072.9505)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2072.9505)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2072.9505)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2072.9505)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2072.9505)