Hex:3 HexNAc:7 dHex:1

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Dirofilaria immitus (Canine heartworm nematode)
• Trichinella spiralis
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Clusterin / Homo sapiens    P10909
• Fibrillin-2 / Homo sapiens    P35556
• Fibrillin-3 / Homo sapiens    Q75N90
• Fibronectin / Homo sapiens    P02751
• Glandular kallikrein 1 / Homo sapiens    P06870
• HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens    P30464
• HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens    P30466
• HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens    P30475
• HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens    P30484
• HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens    Q29836
• HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens    Q29718
• HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens    P30508
• HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens    Q95604
• HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens    P30501
• HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens    Q9TNN7
• HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens    P30505
• Junctional adhesion molecule A / Homo sapiens    Q9Y624
• Lactotransferrin / Homo sapiens    P02788
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Thrombospondin-1 / Homo sapiens    P07996
• Hypoxia up-regulated protein 1 / Mus musculus    Q9JKR6
• Uncharacterized protein / Dirofilaria immitus    
• Uncharacterized protein / Trichinella spiralis    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  

Reported structure

• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GalNAc(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
• N-Linked / Complex / Structure 9433

Composition

• Hex:3 HexNAc:7 dHex:1 (avg mass : 2072.9505 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)

Reference

• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
• Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed

Reported glycosite

• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-374
• Fibrillin-2 / Homo sapiens
  •        Asn-2120
• Fibrillin-3 / Homo sapiens
  •        Asn-2033
• Fibronectin / Homo sapiens
  •        Asn-528
  •        Asn-542
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
  •        Asn-110
• Junctional adhesion molecule A / Homo sapiens
  •        Asn-185
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Hypoxia up-regulated protein 1 / Mus musculus
  •        Asn-596
• Uncharacterized protein / Dirofilaria immitus
  •        Undefined site
• Uncharacterized protein / Trichinella spiralis
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331

Mass spectrometry observed peptide

• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• GYYNQSEAGSHTIQR (15aa)
  •    P30466    Asn-110     HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
  •    P30508    Asn-110     HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
  •    Q29718    Asn-110     HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
  •    Q9TNN7    Asn-110     HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
  •    P30505    Asn-110     HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
  •    P30501    Asn-110     HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
  •    P30475    Asn-110     HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
  •    P30484    Asn-110     HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
  •    P30464    Asn-110     HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
  •    Q29836    Asn-110     HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
  •    Q95604    Asn-110     HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• AFSNSSYVINPTTGEIVFDPISASDTGEYSCEAR (34aa)
  •    Q9Y624    Asn-185     Junctional adhesion molecule A / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• LGNTISSLFGGGTSSDAKENGTDAVQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPK (66aa)
  •    Q9JKR6    Asn-596     Hypoxia up-regulated protein 1 / Mus musculus
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• AFNTTK (6aa)
  •    P35556    Asn-2120     Fibrillin-2 / Homo sapiens
  •    Q75N90    Asn-2033     Fibrillin-3 / Homo sapiens