Hex:4 HexNAc:3 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Drosophila melanogaster (Fruit fly)
• Influenza a virus (strain a/fowl plague virus/rostock/34)
• Sendai virus (strain hvj)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Beta-secretase-fc fusion protein / Homo sapiens    P56817
• Biglycan / Homo sapiens    P21810
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cathepsin D / Homo sapiens    P07339
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Cerebellin-1 / Homo sapiens    P23435
• Chordin-like protein 2 / Homo sapiens    Q6WN34
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Fibulin-2 / Homo sapiens    P98095
• Haptoglobin / Homo sapiens    P00738
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Integrin alpha-L / Homo sapiens    P20701
• Lactotransferrin / Homo sapiens    P02788
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Mucin-5B / Homo sapiens    Q9HC84
• Myeloperoxidase / Homo sapiens    P05164
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Phospholipid transfer protein / Homo sapiens    P55058
• Plexin-c1 / Homo sapiens    O60486
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Rhodopsin / Homo sapiens    P08100
• Serotransferrin / Homo sapiens    P02787
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens    O00300
• Uncharacterized protein from Meconium / Homo sapiens    
• Uncharacterized protein from Urine / Homo sapiens    
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Lactotransferrin / Bos taurus    P24627
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus    
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus    
• Carboxypeptidase M / Mus musculus    Q80V42
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus    O88507
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus    
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Laminin subunit beta-2 / Mus musculus    Q61292
• Laminin subunit gamma-1 / Mus musculus    P02468
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Metabotropic glutamate receptor 3 / Mus musculus    Q9QYS2
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Reticulocalbin-1 / Mus musculus    Q05186
• Rho-associated protein kinase 2 / Mus musculus    P70336
• Teneurin-3 / Mus musculus    Q9WTS6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459
• Fusion glycoprotein / Sendai virus (strain hvj)    P04855
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Allantois (UBERON_0004340)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Embryo (UBERON_0000922)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Seminal Fluid (UBERON_0006530)  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• CE (CVCL_6D96)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• LS174T (CVCL_1384)  
• NS0 (CVCL_3940)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 1497
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Structure 9720
• N-Linked / Complex / Structure 10433
• N-Linked / Complex / Structure 10487
• N-Linked / Complex / Structure 10949
• N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Hybrid / Structure 9371
• N-Linked / Hybrid / Structure 9662
• N-Linked / Hybrid / Structure 9872
• N-Linked / Hybrid / Structure 10026
• N-Linked / No-core / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )

Disease

• Cancer, breast (DOID:1612)
• Choriocarcinoma (DOID:3594)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Fucosidosis (DOID:14500)
• Gangliosidosis GM1 (DOID:3322)
• Gastritis (DOID:4029)
• Gaucher Disease (DOID:1926)
• Hydatidiform Mole, Invasive (DOID:3590)
• Hypersensitivity reaction disease (DOID:0060056)
• Myeloma (DOID:0070004)
• Myeloma, Multiple (DOID:9538)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Plasmacytoma (Mouse) (DOID:3721)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed

Reported glycosite

• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Beta-secretase-fc fusion protein / Homo sapiens
  •        Undefined site
• Biglycan / Homo sapiens
  •        Asn-270
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cathepsin D / Homo sapiens
  •        Asn-134
  •        Asn-263
• Ceramide synthase 2 / Homo sapiens
  •        Asn-19
• Cerebellin-1 / Homo sapiens
  •        Asn-79
• Chordin-like protein 2 / Homo sapiens
  •        Asn-114
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-29
• Erythropoietin / Homo sapiens
  •        Asn-51
  •        Asn-65
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
• Fibulin-2 / Homo sapiens
  •        Asn-1035
• Haptoglobin / Homo sapiens
  •        Asn-211
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Undefined site
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Integrin alpha-L / Homo sapiens
  •        Asn-89
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-123
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2500
  •        Asn-2693
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Mucin-5B / Homo sapiens
  •        Asn-5046
• Myeloperoxidase / Homo sapiens
  •        Asn-483
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipid transfer protein / Homo sapiens
  •        Asn-398
• Plexin-c1 / Homo sapiens
  •        Asn-771
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-469
  •        Asn-499
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prosaposin / Homo sapiens
  •        Undefined site
  •        Asn-80
  •        Asn-101
  •        Asn-332
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Rhodopsin / Homo sapiens
  •        Undefined site
• Serotransferrin / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
  •        Asn-289
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Urine / Homo sapiens
  •        Undefined site
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Lactotransferrin / Bos taurus
  •        Asn-495
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Carboxypeptidase M / Mus musculus
  •        Asn-38
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
  •        Asn-142
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-436
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-316
  •        Asn-397
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-92
  •        Asn-580
• Laminin subunit beta-2 / Mus musculus
  •        Asn-1500
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1239
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Metabotropic glutamate receptor 3 / Mus musculus
  •        Asn-439
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-246
  •        Asn-293
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-730
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Rho-associated protein kinase 2 / Mus musculus
  •        Asn-791
• Teneurin-3 / Mus musculus
  •        Asn-2140
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
  •        Asn-94
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
  •        Asn-249
• Fusion glycoprotein / Sendai virus (strain hvj)
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-122
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-234
  •        Asn-331
  •        Asn-343
  •        Asn-602
  •        Asn-615
  •        Asn-717
  •        Asn-1074
  •        Asn-1098
  •        Asn-1134
  •        Asn-1159
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-343
  •        Asn-1074
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19     Ceramide synthase 2 / Homo sapiens
• DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
  •    P53634    Asn-29     Dipeptidyl peptidase 1 / Homo sapiens
• SVAQNYSSITHLHSIGK (17aa)
  •    Q80V42    Asn-38     Carboxypeptidase M / Mus musculus
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
  •    Q05186    Asn-47     Reticulocalbin-1 / Mus musculus
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• ISPGKNATGMEVGWYR (16aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AVCGGVLVHPQWVLTAAHCIRNK (23aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• STNHEPSEMSNR (12aa)
  •    P23435    Asn-79     Cerebellin-1 / Homo sapiens
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• GSNYTSK (7aa)
  •    P20701    Asn-89     Integrin alpha-L / Homo sapiens
• LLSNR (5aa)
  •    O08532-4    Asn-92     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• VLTLANFTTK (10aa)
  •    P01831    Asn-94     Thy-1 membrane glycoprotein / Mus musculus
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101     Prosaposin / Homo sapiens
• RSHNRSEEFLIAGKL (15aa)
  •    P01033    Asn-101     Metalloproteinase inhibitor 1 / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
  •    Q6WN34    Asn-114     Chordin-like protein 2 / Homo sapiens
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
  •    P13473    Asn-123     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134     Cathepsin D / Homo sapiens
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136     Translocon-associated protein subunit alpha / Homo sapiens
• GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
  •    O88507    Asn-142     Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• AGPNGTIFVADAYK (14aa)
  •    Q9HDC9    Asn-160     Adipocyte plasma membrane-associated protein / Homo sapiens
• EEQYNSTYR (9aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197     Palmitoyl-protein thioesterase 1 / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• GINIT (5aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LLFPTNSSSR (10aa)
  •    P11627    Asn-246     Neural cell adhesion molecule L1 / Mus musculus
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256     Transmembrane protein 106B / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• GSISYINVTR (10aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280     Immunoglobulin mu chain C region / Mus musculus
• RHIGHANLTFEQLRS (15aa)
  •    O00300    Asn-289     Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• ETQENLTVYSFPTPLLTLSEPEAPEGK (27aa)
  •    Q60625    Asn-316     Intercellular adhesion molecule 5 / Mus musculus
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPF (10aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LIDNNK (6aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CPFGEVFNATR (11aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• GFFCDAALDVDGETLRKNQSSELR (24aa)
  •    Q60625    Asn-397     Intercellular adhesion molecule 5 / Mus musculus
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• VGVHINNTQTK (11aa)
  •    Q9CPW0    Asn-436     Contactin-associated protein-like 2 / Mus musculus
• INFTAPFNPNK (11aa)
  •    Q9QYS2    Asn-439     Metabotropic glutamate receptor 3 / Mus musculus
• KVPGNVTAVLGETLKV (16aa)
  •    P01833    Asn-469     Polymeric immunoglobulin receptor / Homo sapiens
• SYNDSVDPR (9aa)
  •    P05164    Asn-483     Myeloperoxidase / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• YIDKGNR (7aa)
  •    O08532-4    Asn-580     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QDVNCTEVPVAIHADQL (17aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IETILLNGTDR (11aa)
  •    Q91ZX7    Asn-730     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• NLTLK (5aa)
  •    P70336    Asn-791     Rho-associated protein kinase 2 / Mus musculus
• DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
  •    P98095    Asn-1035     Fibulin-2 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• IGIVNNT (7aa)
  •    P0DTC2    Asn-1134     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KYEQAKNISQDLEK (14aa)
  •    P02468    Asn-1239     Laminin subunit gamma-1 / Mus musculus
• AQAALDKANASR (12aa)
  •    Q61292    Asn-1500     Laminin subunit beta-2 / Mus musculus
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581     Fibrillin-1 / Homo sapiens
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007     Matrix-remodeling-associated protein 5 / Homo sapiens
• EIKIGPFANTTK (12aa)
  •    Q9WTS6    Asn-2140     Teneurin-3 / Mus musculus
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500     Matrix-remodeling-associated protein 5 / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• VSIIDNGTITVR (12aa)
  •    Q9NR99    Asn-2693     Matrix-remodeling-associated protein 5 / Homo sapiens
• VVLLDPKPVANVTCVNK (17aa)
  •    Q9HC84    Asn-5046     Mucin-5B / Homo sapiens