Hex:4 HexNAc:3 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Influenza a virus (strain a/fowl plague virus/rostock/34)
• Sendai virus (strain hvj)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Apolipoprotein d / Homo sapiens    P05090
• Beta-secretase-fc fusion protein / Homo sapiens    P56817
• Biglycan / Homo sapiens    P21810
• Cathepsin D / Homo sapiens    P07339
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Cerebellin-1 / Homo sapiens    P23435
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Chymotrypsin-like elastase family member 3B / Homo sapiens    P08861
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibrillin-1 / Homo sapiens    P35555
• Fibronectin / Homo sapiens    P02751
• Fibulin-2 / Homo sapiens    P98095
• Immunoglobulin gamma / Homo sapiens    P01859    P01857    P01860    P01861
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-5/beta-1 / Homo sapiens    P05556    P08648
• Integrin alpha-L / Homo sapiens    P20701
• Lactotransferrin / Homo sapiens    P02788
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Mucin-5B / Homo sapiens    Q9HC84
• Myeloperoxidase / Homo sapiens    P05164
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Phospholipid transfer protein / Homo sapiens    P55058
• Plexin-c1 / Homo sapiens    O60486
• Prolactin-inducible protein / Homo sapiens    P12273
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Rhodopsin / Homo sapiens    P08100
• Serotransferrin / Homo sapiens    P02787
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Uncharacterized protein from Meconium / Homo sapiens
• Uncharacterized protein from Urine / Homo sapiens
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Lactotransferrin / Bos taurus    P24627
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
• Carboxypeptidase M / Mus musculus    Q80V42
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus    O88507
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
• Immunoglobulin mu chain C region / Mus musculus    P01872
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Laminin subunit beta-2 / Mus musculus    Q61292
• Laminin subunit gamma-1 / Mus musculus    P02468
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus    P08101
• Metabotropic glutamate receptor 3 / Mus musculus    Q9QYS2
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Reticulocalbin-1 / Mus musculus    Q05186
• Rho-associated protein kinase 2 / Mus musculus    P70336
• Teneurin-3 / Mus musculus    Q9WTS6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Amiloride-sensitive amine oxidase / Sus scrofa    Q9TRC7
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459
• Fusion glycoprotein / Sendai virus (strain hvj)    P04855
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Allantois (UBERON_0004340)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Kidney (UBERON_0002113)   6/9CII (CVCL_VT76)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Seminal Fluid (UBERON_0006530)  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• CE (CVCL_6D96)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• NS0 (CVCL_3940)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 1497
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / No-core / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Undefined core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc + " + Hex + HexNAc + Fuc "

Composition

• Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )

Disease

• Cancer, breast (DOID:1612)
• Choriocarcinoma (DOID:3594)
• COVID-19 (DOID:0080600)
• Fucosidosis (DOID:14500)
• Gangliosidosis GM1 (DOID:3322)
• Gaucher Disease (DOID:1926)
• Hydatidiform Mole, Invasive (DOID:3590)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Plasmacytoma (Mouse) (DOID:3721)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
• Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
• Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
• Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed

Reported glycosite

• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Apolipoprotein d / Homo sapiens
  •        Asn-98
• Beta-secretase-fc fusion protein / Homo sapiens
  •        Undefined site
• Biglycan / Homo sapiens
  •        Asn-270
• Cathepsin D / Homo sapiens
  •        Asn-134
  •        Asn-263
• Ceramide synthase 2 / Homo sapiens
  •        Asn-19
• Cerebellin-1 / Homo sapiens
  •        Asn-79
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Chymotrypsin-like elastase family member 3B / Homo sapiens
  •        Asn-114
• Clusterin / Homo sapiens
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-29
• Erythropoietin / Homo sapiens
  •        Asn-51
  •        Asn-65
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
• Fibulin-2 / Homo sapiens
  •        Asn-1035
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Integrin alpha-5/beta-1 / Homo sapiens
  •        Undefined site
• Integrin alpha-L / Homo sapiens
  •        Asn-89
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-249
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-123
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2500
  •        Asn-2693
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Mucin-5B / Homo sapiens
  •        Asn-5046
• Myeloperoxidase / Homo sapiens
  •        Asn-483
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
• Periostin / Homo sapiens
  •        Asn-599
• Phospholipid transfer protein / Homo sapiens
  •        Asn-398
• Plexin-c1 / Homo sapiens
  •        Asn-771
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prosaposin / Homo sapiens
  •        Undefined site
  •        Asn-80
  •        Asn-101
  •        Asn-332
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
  •        Asn-53
  •        Asn-690
• Rhodopsin / Homo sapiens
  •        Undefined site
• Serotransferrin / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Urine / Homo sapiens
  •        Undefined site
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Lactotransferrin / Bos taurus
  •        Asn-495
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Carboxypeptidase M / Mus musculus
  •        Asn-38
• Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
  •        Asn-142
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-436
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Immunoglobulin mu chain C region / Mus musculus
  •        Asn-280
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-316
  •        Asn-397
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-92
  •        Asn-580
• Laminin subunit beta-2 / Mus musculus
  •        Asn-1500
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1239
• Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
  •        Undefined site
• Metabotropic glutamate receptor 3 / Mus musculus
  •        Asn-439
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-246
  •        Asn-293
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-730
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Rho-associated protein kinase 2 / Mus musculus
  •        Asn-791
• Teneurin-3 / Mus musculus
  •        Asn-2140
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
  •        Asn-94
• Amiloride-sensitive amine oxidase / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
  •        Asn-249
• Fusion glycoprotein / Sendai virus (strain hvj)
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-122
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-657
  •        Asn-709
  •        Asn-717
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-234
  •        Asn-331
  •        Asn-343
  •        Asn-602
  •        Asn-615
  •        Asn-717
  •        Asn-1074
  •        Asn-1098
  •        Asn-1135
  •        Asn-1159
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-657
  •        Asn-1074

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19
• DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
  •    P53634    Asn-29
• SVAQNYSSITHLHSIGK (17aa)
  •    Q80V42    Asn-38
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
  •    Q05186    Asn-47
• NTNI (4aa)
  •    Q9BYF1    Asn-53
• NTNITEENVQNMNNAGDK (18aa)
  •    Q9BYF1    Asn-53
• YETTNK (6aa)
  •    P13473    Asn-58
• ISPGKNATGMEVGWYR (16aa)
  •    Q61885    Asn-59
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• STNHEPSEMSNR (12aa)
  •    P23435    Asn-79
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80
• DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
  •    P07602    Asn-80
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98
• GSNYTSK (7aa)
  •    P20701    Asn-89
• LLSNR (5aa)
  •    O08532-4    Asn-92
• VLTLANFTTK (10aa)
  •    P01831    Asn-94
• TCDWIPKPNMSASCK (15aa)
  •    P07602    Asn-101
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122
• AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
  •    P13473    Asn-123
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136
• GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
  •    O88507    Asn-142
• AGPNGTIFVADAYK (14aa)
  •    Q9HDC9    Asn-160
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• SEFRVYSSANNCTFE (15aa)
  •    P0DTC2    Asn-165
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197
• GINIT (5aa)
  •    P0DTC2    Asn-234
• LLFPTNSSSR (10aa)
  •    P11627    Asn-246
• KDNTTVTR (8aa)
  •    P11279    Asn-249
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256
• IININPNK (8aa)
  •    P11279    Asn-261
• GSISYINVTR (10aa)
  •    P07339    Asn-263
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275
• IMESHPNGTFSAK (13aa)
  •    P01872    Asn-280
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• ETQENLTVYSFPTPLLTLSEPEAPEGK (27aa)
  •    Q60625    Asn-316
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330
• FPNITNLCPF (10aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGEVFNATR (18aa)
  •    P0DTC2    Asn-343
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• LIDNNK (6aa)
  •    P07602    Asn-332
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343
• CPFGEVFNATR (11aa)
  •    P0DTC2    Asn-343
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• GFFCDAALDVDGETLRKNQSSELR (24aa)
  •    Q60625    Asn-397
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
  •    P02751    Asn-430
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430
• VGVHINNTQTK (11aa)
  •    Q9CPW0    Asn-436
• INFTAPFNPNK (11aa)
  •    Q9QYS2    Asn-439
• SYNDSVDPR (9aa)
  •    P05164    Asn-483
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• YIDKGNR (7aa)
  •    O08532-4    Asn-580
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-615
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615
• QDVNCTEVPVAIHADQL (17aa)
  •    P0DTC2    Asn-615
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-717
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-709
• NFTIS (5aa)
  •    P0DTC2    Asn-717
• IETILLNGTDR (11aa)
  •    Q91ZX7    Asn-730
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785
• NLTLK (5aa)
  •    P70336    Asn-791
• DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
  •    P98095    Asn-1035
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074
• GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• IGIVNNT (7aa)
  •    P0DTC2    Asn-1135
• KYFKNHTS (8aa)
  •    P0DTC2    Asn-1159
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1174
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1174
• VAKNLNE (7aa)
  •    P0DTC2    Asn-1194
• VAKNLNESLIDLQE (14aa)
  •    P0DTC2    Asn-1194
• KYEQAKNISQDLEK (14aa)
  •    P02468    Asn-1239
• AQAALDKANASR (12aa)
  •    Q61292    Asn-1500
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007
• EIKIGPFANTTK (12aa)
  •    Q9WTS6    Asn-2140
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679
• VSIIDNGTITVR (12aa)
  •    Q9NR99    Asn-2693
• VVLLDPKPVANVTCVNK (17aa)
  •    Q9HC84    Asn-5046