taxonomy (9)
protein (92)
source (30)
structure (18)
composition (1)
disease (10)
reference (42)
site (146)
peptide (126)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Sus scrofa (Pig)
- Drosophila melanogaster (Fruit fly)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Sendai virus (strain hvj)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein d / Homo sapiens P05090
- Beta-secretase-fc fusion protein / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- Cathepsin D / Homo sapiens P07339
- Ceramide synthase 2 / Homo sapiens Q96G23
- Cerebellin-1 / Homo sapiens P23435
- Chordin-like protein 2 / Homo sapiens Q6WN34
- Choriogonadotropin - alpha and beta chains / Homo sapiens P01215 P0DN86
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Erythropoietin / Homo sapiens P01588
- Extracellular matrix protein 1 / Homo sapiens Q16610
- Fibrillin-1 / Homo sapiens P35555
- Fibronectin / Homo sapiens P02751
- Fibulin-2 / Homo sapiens P98095
- Haptoglobin / Homo sapiens P00738
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Integrin alpha-L / Homo sapiens P20701
- Lactotransferrin / Homo sapiens P02788
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Mucin-5B / Homo sapiens Q9HC84
- Myeloperoxidase / Homo sapiens P05164
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Phospholipid transfer protein / Homo sapiens P55058
- Plexin-c1 / Homo sapiens O60486
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Rhodopsin / Homo sapiens P08100
- Serotransferrin / Homo sapiens P02787
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens O00300
- Uncharacterized protein from Meconium / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Lactotransferrin / Bos taurus P24627
- Thyrotropin-aplha and beta chains / Bos taurus P01223 P01217
- Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Carboxypeptidase M / Mus musculus Q80V42
- Ciliary neurotrophic factor receptor subunit alpha / Mus musculus O88507
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus P01872
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Laminin subunit beta-2 / Mus musculus Q61292
- Laminin subunit gamma-1 / Mus musculus P02468
- Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus P08101
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Myelin-oligodendrocyte glycoprotein / Mus musculus Q61885
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Reticulocalbin-1 / Mus musculus Q05186
- Rho-associated protein kinase 2 / Mus musculus P70336
- Teneurin-3 / Mus musculus Q9WTS6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Fusion glycoprotein / Sendai virus (strain hvj) P04855
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Allantois (UBERON_0004340)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Embryo (UBERON_0000922)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- CE (CVCL_6D96)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1497
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Structure 9668
- N-Linked / Complex / Structure 9720
- N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9371
- N-Linked / Hybrid / Structure 9662
- N-Linked / Hybrid / Structure 9872
- N-Linked / No-core / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
Reported structure
- Hex:4 HexNAc:3 dHex:1 (avg mass : 1422.3129 )
Composition
- Cancer, breast (DOID:1612)
- Choriocarcinoma (DOID:3594)
- COVID-19 (DOID:0080600)
- Fucosidosis (DOID:14500)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Hydatidiform Mole, Invasive (DOID:3590)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
- Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
Reference
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein d / Homo sapiens
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
- Cathepsin D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Cerebellin-1 / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Erythropoietin / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Fibulin-2 / Homo sapiens
- Haptoglobin / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Integrin alpha-L / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Mucin-5B / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Plexin-c1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
-
Rhodopsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- Carboxypeptidase M / Mus musculus
- Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Immunoglobulin mu chain C region / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
- Metabotropic glutamate receptor 3 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Teneurin-3 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
-
Fusion glycoprotein / Sendai virus (strain hvj)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
- SVAQNYSSITHLHSIGK (17aa)
- HENNTKDNSIQHEFSLTR (18aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- YETTNK (6aa)
- ISPGKNATGMEVGWYR (16aa)
- FSNVTWF (7aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- NK (2aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- STNHEPSEMSNR (12aa)
- DNATEEEILVYLEK (14aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- GSNYTSK (7aa)
- LLSNR (5aa)
- VLTLANFTTK (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- TCDWIPKPNMSASCK (15aa)
- RSHNRSEEFLIAGKL (15aa)
- TFYWDFYTNR (10aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- FGCEIENNR (9aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- AGPNGTIFVADAYK (14aa)
- VYSSANNCTFE (11aa)
- SEFRVYSSANNCTFE (15aa)
- EEQYNSTYR (9aa)
- NHSIFLADINQER (13aa)
- KNLFLNHSENATAKD (15aa)
- GINIT (5aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- YQYVDCGRNTT (11aa)
- IININPNK (8aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- MIENGSISFIPTIR (14aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- IMESHPNGTFSAK (13aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- NGTITDAVDCALDPLSE (17aa)
- RHIGHANLTFEQLRS (15aa)
- VIYQNHNK (8aa)
- ETQENLTVYSFPTPLLTLSEPEAPEGK (27aa)
- FFAENETWVVDSCTTCTCK (19aa)
- FPNITNLCPF (10aa)
- RFPNIT (6aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGE (12aa)
- LIDNNK (6aa)
- GEVFNATRF (9aa)
- FPNITNLCPFGEVFNATR (18aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- QGNNHTCTWK (10aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- GFFCDAALDVDGETLRKNQSSELR (24aa)
- NYTDCTSEGR (10aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
- VGVHINNTQTK (11aa)
- INFTAPFNPNK (11aa)
- KVPGNVTAVLGETLKV (16aa)
- SYNDSVDPR (9aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- QDVNCTEVPVAIHADQL (17aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
- AGCLIGAEHVNNSYE (15aa)
- NFTIS (5aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- IETILLNGTDR (11aa)
- NMTLFSDLVAEK (12aa)
- NLTLK (5aa)
- DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- VNSSLHSQISR (11aa)
- IGIVNNT (7aa)
- KYFKNHTS (8aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- VAKNLNE (7aa)
- VAKNLNESLIDLQE (14aa)
- KYEQAKNISQDLEK (14aa)
- AQAALDKANASR (12aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- ITLHENR (7aa)
- EIKIGPFANTTK (12aa)
- ITVHGNGSLDIR (12aa)
- EAGNITTDGYEIIGK (15aa)
- VSIIDNGTITVR (12aa)
- VVLLDPKPVANVTCVNK (17aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Allantois (UBERON_0004340)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Liver (UBERON_0002107)
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Placenta (UBERON_0001987)
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- Choriocarcinoma (DOID:3594)
- Fucosidosis (DOID:14500)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Hydatidiform Mole, Invasive (DOID:3590)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Characterization and 400-MHz 1H-NMR analysis of urinary fucosyl glycoasparagines in fucosidosis. (1991 - Michalski J, Wieruszeski J, Alonso C, Cache P, Montreuil J, Strecker G) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Structures of the asparagine-linked sugar chains of human chorionic gonadotropin produced in choriocarcinoma. Appearance of triantennary sugar chains and unique biantennary sugar chains. (1983 - Mizuochi T, Nishimura R, Derappe C, Taniguchi T, Hamamoto T, Mochizuki M, Kobata A) / Status : Reviewed
- Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
-
Beta-secretase-fc fusion protein / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Fusion glycoprotein / Sendai virus (strain hvj)
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Kidney (UBERON_0002113)
- CE (CVCL_6D96)
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Milk (UBERON_0001913)
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Lactotransferrin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Kidney (UBERON_0002113) 6/9CII (CVCL_VT76)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Pancreas (UBERON_0001264)
- P3X63Ag8U.1 (CVCL_3412)
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- N-glycan structures of a recombinant mouse soluble Fcgamma receptor II. (1998 - Takahashi N, Yamada W, Masuda K, Araki H, Tsukamoto Y, Galinha A, Sauts C, Kato K, Shimada I) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Chymotrypsin-like elastase family member 3B / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Metalloproteinase inhibitor 1 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1422.3129)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1422.3129)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1422.3129)
- Retina (UBERON_0000966)
-
Rhodopsin / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1422.3129)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Chordin-like protein 2 / Homo sapiens
- Haptoglobin / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Tumor necrosis factor receptor superfamily member 11B / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RSHNRSEEFLIAGKL (15aa)
- KSCQHNGTMYQHGEIFSAHELFPSRL (26aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- KNLFLNHSENATAKD (15aa)
- RHIGHANLTFEQLRS (15aa)
- KVPGNVTAVLGETLKV (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- N-Linked / Hybrid
(avg mass : 1422.3129)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1422.3129)
Released - Embryo (UBERON_0000922)
-
- N-Linked / No-core
(avg mass : 1422.3129)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- Hex:4 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1422.3129)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 1497
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Structure 9668
- N-Linked / Complex / Structure 9720
- N-Linked / Hybrid / GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Hybrid / Structure 9371
- N-Linked / Hybrid / Structure 9662
- N-Linked / Hybrid / Structure 9872
- N-Linked / No-core / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Apolipoprotein d / Homo sapiens
- Biglycan / Homo sapiens
- Cathepsin D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Cerebellin-1 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Extracellular matrix protein 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibronectin / Homo sapiens
- Fibulin-2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin alpha-L / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Mucin-5B / Homo sapiens
- Myeloperoxidase / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Phospholipid transfer protein / Homo sapiens
- Plexin-c1 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
- Carboxypeptidase M / Mus musculus
- Ciliary neurotrophic factor receptor subunit alpha / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Immunoglobulin mu chain C region / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Laminin subunit beta-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Teneurin-3 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
- SVAQNYSSITHLHSIGK (17aa)
- HENNTKDNSIQHEFSLTR (18aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGK (29aa)
- YETTNK (6aa)
- ISPGKNATGMEVGWYR (16aa)
- FSNVTWF (7aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- STNHEPSEMSNR (12aa)
- DNATEEEILVYLEK (14aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- GSNYTSK (7aa)
- LLSNR (5aa)
- VLTLANFTTK (10aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- FGCEIENNR (9aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- GFYCSWHLPTPTYIPNTFNVTVLHGSK (27aa)
- AGPNGTIFVADAYK (14aa)
- VYSSANNCTFE (11aa)
- SEFRVYSSANNCTFE (15aa)
- EEQYNSTYR (9aa)
- NHSIFLADINQER (13aa)
- GINIT (5aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- YQYVDCGRNTT (11aa)
- IININPNK (8aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- MIENGSISFIPTIR (14aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- IMESHPNGTFSAK (13aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- NGTITDAVDCALDPLSE (17aa)
- VIYQNHNK (8aa)
- ETQENLTVYSFPTPLLTLSEPEAPEGK (27aa)
- FFAENETWVVDSCTTCTCK (19aa)
- FPNITNLCPF (10aa)
- RFPNIT (6aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGE (12aa)
- LIDNNK (6aa)
- GEVFNATRF (9aa)
- FPNITNLCPFGEVFNATR (18aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- QGNNHTCTWK (10aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- GFFCDAALDVDGETLRKNQSSELR (24aa)
- NYTDCTSEGR (10aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
- VGVHINNTQTK (11aa)
- INFTAPFNPNK (11aa)
- SYNDSVDPR (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- RHEEGHMINCTCFGQGR (17aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- QDVNCTEVPVAIHADQL (17aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR (39aa)
- AGCLIGAEHVNNSYE (15aa)
- NFTIS (5aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- IETILLNGTDR (11aa)
- NMTLFSDLVAEK (12aa)
- NLTLK (5aa)
- DVDECAIGTHNCSEAETCHNIQGSFR (26aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- VNSSLHSQISR (11aa)
- IGIVNNT (7aa)
- KYFKNHTS (8aa)
- ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- VAKNLNE (7aa)
- VAKNLNESLIDLQE (14aa)
- KYEQAKNISQDLEK (14aa)
- AQAALDKANASR (12aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- ITLHENR (7aa)
- EIKIGPFANTTK (12aa)
- ITVHGNGSLDIR (12aa)
- EAGNITTDGYEIIGK (15aa)
- VSIIDNGTITVR (12aa)
- VVLLDPKPVANVTCVNK (17aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:3 dHex:1 / N-Linked
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1422.3129)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1422.3129)