taxonomy (17)
protein (415)
source (47)
structure (25)
composition (1)
disease (18)
reference (109)
site (777)
peptide (940)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis familiaris (Dog)
- Cavia porcellus (Domestic guinea pig)
- Desmodus rotundus (Common vampire bat)
- Equus caballus (Domestic horse)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Salmo salar (Atlantic salmon)
- Columba livia (Domestic pigeon)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Tropidechis carinatus (Australian rough-scaled snake)
- Friend murine leukemia virus (F-mulv)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- 5'-AMP-activated protein kinase catalytic subunit alpha-2 / Homo sapiens P54646
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens Q76LX8
- Acid ceramidase / Homo sapiens Q13510
- ADAM DEC1 / Homo sapiens O15204
- ADAMTS-like protein 2 / Homo sapiens Q86TH1
- Adhesion G protein-coupled receptor F5 / Homo sapiens Q8IZF2
- Adhesion G protein-coupled receptor L4 / Homo sapiens Q9HBW9
- Adhesion G-protein coupled receptor D1 / Homo sapiens Q6QNK2
- Adipocyte enhancer-binding protein 1 / Homo sapiens Q8IUX7
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Afamin / Homo sapiens P43652
- Agrin / Homo sapiens O00468
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens P05186
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-1b-glycoprotein / Homo sapiens P04217
- Alpha-2-antiplasmin / Homo sapiens P08697
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-mannosidase 2 / Homo sapiens Q16706
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Aminopeptidase n / Homo sapiens P15144
- Angiopoietin-related protein 4 / Homo sapiens Q9BY76
- Angiotensin-converting enzyme / Homo sapiens P12821
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Angiotensinogen / Homo sapiens P01019
- Ankyrin repeat domain-containing protein 62 / Homo sapiens A6NC57
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein b-100 / Homo sapiens P04114
- Apolipoprotein C-IV / Homo sapiens P55056
- Apolipoprotein d / Homo sapiens P05090
- Apolipoprotein f / Homo sapiens Q13790
- Apolipoprotein M / Homo sapiens O95445
- Asialoglycoprotein receptor 2 / Homo sapiens P07307
- ATP-dependent 6-phosphofructokinase, liver type / Homo sapiens P17858
- Attractin / Homo sapiens O75882
- Basal cell adhesion molecule / Homo sapiens P50895
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens P98160
- BDNF/NT-3 growth factors receptor / Homo sapiens Q16620
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Beta-Ala-His dipeptidase / Homo sapiens Q96KN2
- Biglycan / Homo sapiens P21810
- Bile-salt-activated lipase / Homo sapiens P19835
- Biotinidase / Homo sapiens P43251
- Bone marrow stromal antigen 2 / Homo sapiens Q10589
- Breast cancer type 1 susceptibility protein / Homo sapiens P38398
- Butyrophilin subfamily 1 member A1 / Homo sapiens Q13410
- C4b-binding protein alpha chain / Homo sapiens P04003
- C4b-binding protein beta chain / Homo sapiens P20851
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens Q9HCU4
- Cadherin-13 / Homo sapiens P55290
- Cadherin-related family member 2 / Homo sapiens Q9BYE9
- Calbindin / Homo sapiens P05937
- Calcium-activated chloride channel regulator 2 / Homo sapiens Q9UQC9
- Calumenin / Homo sapiens O43852
- Carboxypeptidase b2 / Homo sapiens Q96IY4
- Carboxypeptidase N subunit 2 / Homo sapiens P22792
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Catalase / Homo sapiens P04040
- Cathepsin D / Homo sapiens P07339
- Cathepsin L1 / Homo sapiens P07711
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens P20645
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD166 antigen / Homo sapiens Q13740
- CD276 antigen / Homo sapiens Q5ZPR3
- CD44 antigen / Homo sapiens P16070
- CD59 glycoprotein / Homo sapiens P13987
- Cell adhesion molecule 1 / Homo sapiens Q9BY67
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Ceruloplasmin / Homo sapiens P00450
- Cholesteryl ester transfer protein / Homo sapiens P11597
- Cholinesterase / Homo sapiens P06276
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- Claudin-18 / Homo sapiens P56856
- Clusterin / Homo sapiens P10909
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens Q11201
- Coagulation factor IX / Homo sapiens P00740
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor VIII / Homo sapiens P00451
- Coagulation factor XI / Homo sapiens P03951
- Coagulation factor XII / Homo sapiens P00748
- Coagulation factor XIII B chain / Homo sapiens P05160
- Collagen alpha-1(V) chain / Homo sapiens P20908
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-1(XIV) chain / Homo sapiens Q05707
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Collagen alpha-6(VI) chain / Homo sapiens A6NMZ7
- Complement C1q subcomponent subunit A / Homo sapiens P02745
- Complement c1r subcomponent / Homo sapiens P00736
- Complement C1r subcomponent-like protein / Homo sapiens Q9NZP8
- Complement C1s subcomponent / Homo sapiens P09871
- Complement C2 / Homo sapiens P06681
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Complement C5 / Homo sapiens P01031
- Complement component c6 / Homo sapiens P13671
- Complement component c7 / Homo sapiens P10643
- Complement component C8 alpha chain / Homo sapiens P07357
- Complement component C8 beta chain / Homo sapiens P07358
- Complement component C9 / Homo sapiens P02748
- Complement decay-accelerating factor / Homo sapiens P08174
- Complement factor b / Homo sapiens P00751
- Complement factor h / Homo sapiens P08603
- Complement factor H-related protein 1 / Homo sapiens Q03591
- Complement factor H-related protein 2 / Homo sapiens P36980
- Complement factor H-related protein 3 / Homo sapiens Q02985
- Complement factor H-related protein 4 / Homo sapiens Q92496
- Complement factor H-related protein 5 / Homo sapiens Q9BXR6
- Complement factor i / Homo sapiens P05156
- Complement receptor type 1 / Homo sapiens P17927
- Contactin-1 / Homo sapiens Q12860
- Contactin-3 / Homo sapiens Q9P232
- Contactin-4 / Homo sapiens Q8IWV2
- COP9 signalosome complex subunit 2 / Homo sapiens P61201
- Corticosteroid-binding globulin / Homo sapiens P08185
- Coxsackievirus and adenovirus receptor / Homo sapiens P78310
- Cubilin / Homo sapiens O60494
- Decorin / Homo sapiens P07585
- Desmocollin-2 / Homo sapiens Q02487
- Desmoglein-2 / Homo sapiens Q14126
- Dickkopf-related protein 3 / Homo sapiens Q9UBP4
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 4 / Homo sapiens P27487
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Dopamine beta-hydroxylase / Homo sapiens P09172
- E3 ubiquitin-protein ligase Mdm2 / Homo sapiens Q00987
- Early activation antigen CD69 / Homo sapiens Q07108
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens Q93070
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Homo sapiens Q13822
- EGF-containing fibulin-like extracellular matrix protein 2 / Homo sapiens O95967
- EMILIN-1 / Homo sapiens Q9Y6C2
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens Q6P179
- Endothelial protein C receptor / Homo sapiens Q9UNN8
- Ephrin-B2 / Homo sapiens P52799
- Epidermal growth factor receptor / Homo sapiens P00533
- Epididymis-specific alpha-mannosidase / Homo sapiens Q9Y2E5
- Epithelial cell adhesion molecule / Homo sapiens P16422
- Erythropoietin / Homo sapiens P01588
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens Q8IXL6
- Extracellular sulfatase Sulf-1 / Homo sapiens Q8IWU6
- Extracellular sulfatase Sulf-2 / Homo sapiens Q8IWU5
- Fer-1-like protein 6 / Homo sapiens Q2WGJ9
- Fetuin-B / Homo sapiens Q9UGM5
- Fibrinogen / Homo sapiens P02671 P02675 P02679
- Fibrinogen beta chain / Homo sapiens P02675
- Fibrinogen gamma chain / Homo sapiens P02679
- Fibroblast growth factor receptor 1 / Homo sapiens P11362
- Fibroblast growth factor receptor 4 / Homo sapiens P22455
- Fibroleukin / Homo sapiens Q14314
- Fibromodulin / Homo sapiens Q06828
- Fibronectin / Homo sapiens P02751
- Folate receptor alpha / Homo sapiens P15328
- Follitropin, alpha and beta chains / Homo sapiens P01225 P01215
- Frizzled-4 / Homo sapiens Q9ULV1
- G-protein coupled receptor 126 / Homo sapiens Q86SQ4
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyltranspeptidase 1 / Homo sapiens P19440
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens P04406
- Glycocalicin / Homo sapiens P07359
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Glycosaminoglycan xylosylkinase / Homo sapiens O75063
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Haptoglobin / Homo sapiens P00738
- Helicase POLQ-like / Homo sapiens Q8TDG4
- Hemopexin / Homo sapiens P02790
- Heparin cofactor 2 / Homo sapiens P05546
- Hepatocyte growth factor / Homo sapiens P14210
- Hepatocyte growth factor activator / Homo sapiens Q04756
- Hepatocyte growth factor-like protein / Homo sapiens P26927
- Histidine-rich glycoprotein / Homo sapiens P04196
- Histone-lysine N-methyltransferase SUV420H1 / Homo sapiens Q4FZB7
- Homeobox protein Hox-B3 / Homo sapiens P14651
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Icos ligand / Homo sapiens O75144
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens Q8TDY8
- Inactive dipeptidyl peptidase 10 / Homo sapiens Q8N608
- Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens P36268
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Inhibin beta E chain / Homo sapiens P58166
- Inhibitor of nuclear factor kappa-B kinase-interacting protein / Homo sapiens Q70UQ0
- Insulin-like growth factor-binding protein 3 / Homo sapiens P17936
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens P35858
- Integral membrane protein 2B / Homo sapiens Q9Y287
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-5 / Homo sapiens P08648
- Integrin alpha-5/beta-1 / Homo sapiens P05556 P08648
- Integrin alpha-V / Homo sapiens P06756
- Integrin beta-3 / Homo sapiens P05106
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens P19827
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens P19823
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens Q06033
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens Q86UX2
- Intercellular adhesion molecule 2 / Homo sapiens P13598
- Interferon alpha/beta receptor 2 / Homo sapiens P48551
- Interleukin-1 receptor accessory protein / Homo sapiens Q9NPH3
- Interleukin-1 receptor antagonist protein / Homo sapiens P18510
- Interleukin-1 receptor type 2 / Homo sapiens P27930
- Interleukin-1 receptor-like 1 / Homo sapiens Q01638
- Kallistatin / Homo sapiens P29622
- Keratin, type II cytoskeletal 1 / Homo sapiens P04264
- Kininogen-1 / Homo sapiens P01042
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Leptin receptor / Homo sapiens P48357
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Leucine-rich repeat transmembrane protein FLRT3 / Homo sapiens Q9NZU0
- Leucine-rich repeat-containing protein 15 / Homo sapiens Q8TF66
- Ligand-dependent nuclear receptor corepressor-like protein / Homo sapiens Q8N3X6
- Lipopolysaccharide-binding protein / Homo sapiens P18428
- Lipoprotein lipase / Homo sapiens P06858
- Low-density lipoprotein receptor / Homo sapiens P01130
- Lumican / Homo sapiens P51884
- Lutropin beta chain / Homo sapiens P01229
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens P07333
- Macrophage mannose receptor 1 / Homo sapiens P22897
- Macrophage receptor MARCO / Homo sapiens Q9UEW3
- Maltase-glucoamylase, intestinal / Homo sapiens O43451
- Mannan-binding lectin serine protease 1 / Homo sapiens P48740
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Membrane cofactor protein / Homo sapiens P15529
- Mesothelin / Homo sapiens Q13421
- Mimecan / Homo sapiens P20774
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Mucin-5B / Homo sapiens Q9HC84
- Multimerin-1 / Homo sapiens Q13201
- Multimerin-2 / Homo sapiens Q9H8L6
- Multiple inositol polyphosphate phosphatase 1 / Homo sapiens Q9UNW1
- Myeloperoxidase / Homo sapiens P05164
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens Q9NY97
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens Q96PD5
- Neogenin / Homo sapiens Q92859
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Neural cell adhesion molecule L1-like protein / Homo sapiens O00533
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens P41271
- Neurofascin / Homo sapiens O94856
- Neuronal cell adhesion molecule / Homo sapiens Q92823
- Neuropilin-1 / Homo sapiens O14786
- Neuroplastin / Homo sapiens Q9Y639
- Noelin / Homo sapiens Q99784
- Oncoprotein-induced transcript 3 protein / Homo sapiens Q8WWZ8
- Oncostatin-M-specific receptor subunit beta / Homo sapiens Q99650
- Osteomodulin / Homo sapiens Q99983
- Osteopontin / Homo sapiens P10451
- P-selectin / Homo sapiens P16109
- P2X purinoceptor 4 / Homo sapiens Q99571
- Pantetheinase / Homo sapiens O95497
- Periostin / Homo sapiens Q15063
- Peroxidasin homolog / Homo sapiens Q92626
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens P04180
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens P80108
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens Q96FE7
- Phospholipase D3 / Homo sapiens Q8IV08
- Phospholipase D4 / Homo sapiens Q96BZ4
- Pigment epithelium-derived factor / Homo sapiens P36955
- Plasma kallikrein / Homo sapiens P03952
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasma serine protease inhibitor / Homo sapiens P05154
- Plasminogen / Homo sapiens P00747
- Platelet endothelial cell adhesion molecule / Homo sapiens P16284
- Platelet glycoprotein V / Homo sapiens P40197
- Platelet-derived growth factor receptor beta / Homo sapiens P09619
- Platelet-derived growth factor subunit b / Homo sapiens P01127
- Plexin-B1 / Homo sapiens O43157
- Plexin-B2 / Homo sapiens O15031
- Plexin-c1 / Homo sapiens O60486
- Podocalyxin / Homo sapiens O00592
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pregnancy zone protein / Homo sapiens P20742
- Probable serine carboxypeptidase CPVL / Homo sapiens Q9H3G5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Prolactin-inducible protein / Homo sapiens P12273
- Prolargin / Homo sapiens P51888
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl endopeptidase FAP / Homo sapiens Q12884
- Prominin-1 / Homo sapiens O43490
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostatic acid phosphatase / Homo sapiens P15309
- Protein AMBP / Homo sapiens P02760
- Protein heg homolog 1 / Homo sapiens Q9ULI3
- Protein phosphatase 1 regulatory subunit 21 / Homo sapiens Q6ZMI0
- Protein Z-dependent protease inhibitor / Homo sapiens Q9UK55
- Protein-lysine 6-oxidase / Homo sapiens P28300
- Prothrombin / Homo sapiens P00734
- Protocadherin-9 / Homo sapiens Q9HC56
- Putative gamma-glutamyltranspeptidase 3 / Homo sapiens A6NGU5
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens Q12913
- Receptor-type tyrosine-protein phosphatase F / Homo sapiens P10586
- Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens P23470
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Receptor-type tyrosine-protein phosphatase mu / Homo sapiens P28827
- Reelin / Homo sapiens P78509
- Rhodopsin / Homo sapiens P08100
- Ribonuclease pancreatic / Homo sapiens P07998
- Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens Q86VB7
- Secretory phospholipase a2 receptor / Homo sapiens Q13018
- Seizure 6-like protein 2 / Homo sapiens Q6UXD5
- Selenoprotein P / Homo sapiens P49908
- Semaphorin-4B / Homo sapiens Q9NPR2
- Semaphorin-4D / Homo sapiens Q92854
- Semaphorin-6A / Homo sapiens Q9H2E6
- Semaphorin-7A / Homo sapiens O75326
- Serotransferrin / Homo sapiens P02787
- Serum albumin / Homo sapiens P02768
- Serum amyloid p-component / Homo sapiens P02743
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Sex hormone-binding globulin / Homo sapiens P04278
- Sialic acid-binding Ig-like lectin 14 / Homo sapiens Q08ET2
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- Sodium-dependent phosphate transporter 1 / Homo sapiens Q8WUM9
- Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens P54709
- Sortilin / Homo sapiens Q99523
- Sulfhydryl oxidase 1 / Homo sapiens O00391
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens Q4LDE5
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Target of Nesh-SH3 / Homo sapiens Q7Z7G0
- Tenascin / Homo sapiens P24821
- Tenascin-N / Homo sapiens Q9UQP3
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Thyroxine-binding globulin / Homo sapiens P05543
- Trafficking protein particle complex subunit 8 / Homo sapiens Q9Y2L5
- Trans-Golgi network integral membrane protein 2 / Homo sapiens O43493
- Transcobalamin-1 / Homo sapiens P20061
- Transferrin receptor protein 1 / Homo sapiens P02786
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens O75509
- Tyrosine-protein kinase receptor TYRO3 / Homo sapiens Q06418
- Tyrosine-protein kinase receptor UFO / Homo sapiens P30530
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein from Pleura / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vascular cell adhesion protein 1 / Homo sapiens P19320
- Vascular non-inflammatory molecule 2 / Homo sapiens O95498
- Vasorin / Homo sapiens Q6EMK4
- Villin-1 / Homo sapiens P09327
- Vitamin d-binding protein / Homo sapiens P02774
- Vitamin k-dependent protein c / Homo sapiens P04070
- Vitamin K-dependent protein S / Homo sapiens P07225
- Vitronectin / Homo sapiens P04004
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Von willebrand factor / Homo sapiens P04275
- Zinc finger protein 318 / Homo sapiens Q5VUA4
- Zinc finger protein 432 / Homo sapiens O94892
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Alpha-1-acid glycoprotein / Bos taurus Q3SZR3
- Alpha-2-hs-glycoprotein / Bos taurus P12763
- Coagulation factor IX / Bos taurus P00741
- Fetuin-b / Bos taurus Q58D62
- Plasminogen / Bos taurus P06868
- Prothrombin / Bos taurus P00735
- Alpha-1-acid glycoprotein / Canis familiaris F6Y713
- Factor b1 / Cavia porcellus
- Factor b2 / Cavia porcellus
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Choriogonadotropin beta chain / Equus caballus P08751
- Uncharacterized protein from Dander / Equus caballus
- Major urinary protein / Mus musculus
- Monoclonal antibody okt3 / Mus musculus
- Alpha-1-acid glycoprotein / Ovis aries W5P7S6
- C-reactive protein / Rattus norvegicus P48199
- Serotransferrin / Rattus norvegicus P12346
- T-kininogen / Rattus norvegicus P08932 P01048
- Uncharacterized protein / Rattus norvegicus
- Plasminogen / Sus scrofa P06867
- Vitronectin / Sus scrofa P48819
- Kininogen / Salmo salar
- Salarin / Salmo salar
- Immunoglobulin gamma / Columba livia
- Ovotransferrin / Gallus gallus P02789
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Acetylcholine receptor protein / Torpedo californica P02710 P02714 P02712 P02718
- Coagulation factor x / Tropidechis carinatus P81428
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Adrenal Gland (UBERON_0002369)
- Amniotic Fluid (UBERON_0000173)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Dander
- Electric Organ (UBERON_0006869)
- Heart (UBERON_0000948)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) Hep-G2 (CVCL_0027)
- Liver (UBERON_0002107)
- Lumbar Vertebra (UBERON_0002414)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Retina (UBERON_0000966)
- Semen (UBERON_0001968)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097)
- Spleen (UBERON_0002106)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Jurkat (CVCL_0065)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Hepatocyte (CL_0000182)
- Leukocyte (CL_0000738)
- Low-Density Lipoprotein Particle (GO_0034362)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Structure 473
- N-Linked / Complex / Gal(b1-4)GlcNAc(?1-?)Man(a1-3)[Gal(b1-4)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-?)"
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x NeuAc(a2-?)"
- N-Linked / Complex / NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-3)[NeuAc(?2-3)Gal(?1-4)GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(?2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)ManNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-4)HexNAc(?1-?)Man(a1-3)[NeuAc(a2-3)Gal(b1-4)HexNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[NeuAc(a2-3)Gal(b1-?)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-3)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)ManNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-?)Man(a1-3)[NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(a2-?)Gal(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-?)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-3)[NeuAc(a2-?)Gal(b1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9297
- N-Linked / Complex / Structure 9581
- N-Linked / Complex / Structure 9807
- N-Linked / Complex / Structure 9867
- N-Linked / Undefined core / NeuAc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)[NeuAc(??-?)Hex(??-?)HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
Reported structure
- Hex:5 HexNAc:4 NeuAc:2 (avg mass : 2224.0231 )
Composition
- Amyloidosis, A-I Amyloid (DOID:9120)
- Amyloidosis, AA Amyloid (DOID:9120)
- Amyloidosis, AL Amyloid (DOID:9120)
- Cancer, breast (DOID:1612)
- Carcinoma (DOID:305)
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Esophageal cancer (DOID:5041)
- Hypercholesterolemia, Familial (DOID:13810)
- Leukemia (DOID:1240)
- Leukemia, Myloid, Chronic (DOID:8552)
- Malignant material
- Oral squamous cell carcinoma (DOID:0050866)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Site-specific N-glycosylation analysis of human factor XI: Identification of a noncanonical NXC glycosite (2014 - Faid V, Denguir N, Chapuis V, Bihoreau N, Chevreux G) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls (2014 - Kontro H, Joenväärä S, Haglund C, Renkonen R) / Status : Reviewed
- Confident assignment of site-specific glycosylation in complex glycoproteins in a single step (2014 - Khatri K, Staples GO, Leymarie N, Leon DR, Turiák L, Huang Y, Yip S, Hu H, Heckendorf CF, Zaia J.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Quantitative analysis of site-specific N-glycans on sera haptoglobin β chain in liver diseases. (2013 - Zhang S, Jiang K, Sun C, Lu H, Liu Y.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Occurrence of O-linked Xyl-GlcNAc and Xyl-Glc disaccharides in trocarin, a factor Xa homolog from snake venom (2003 - Joseph JS, Valiyavettil M, Gowda DC, Kini RM) / Status : Reviewed
- N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Structural elucidation of the N- and O-glycans of human apolipoprotein(a): role of O-glycans in conferring protease resistance. (2001 - Garner B, Merry A, Royle L, Harvey D, Rudd P, Thillet J) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- The glycan structure of albumin Redhill, a glycosylated variant of human serum albumin (2001 - Kragh-Hansen, Donaldson, Jensen) / Status : Reviewed
- Glycosylation analysis of two cysteine proteinase inhibitors from Atlantic salmon skin: di-O-acetylated sialic acids are the major sialic acid species on N-glycans (2001 - Ylonen, Kalkkinen, Saarinen, Bogwald, Helin) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- Characterisation of horse dander allergen glycoproteins using amino acid and glycan structure analyses. A mass spectrometric method for glycan chain analysis of glycoproteins separated by two-dimensional electrophoresis. (2000 - Bulone V, Rademaker G, Pergantis S, Krogstad-Johnsen T, Smestad-Paulsen B, Thomas-Oates J) / Status : Reviewed
- Structural analysis of N-linked sugar chains of human blood clotting factor IX. (2000 - Makino Y, Omichi K, Kuraya N, Ogawa H, Nishimura H, Iwanaga S, Hase S) / Status : Reviewed
- N-Glycan structures of an osteopontin from human bone. (2000 - Masuda K, Takahashi N, Tsukamoto Y, Honma H, Kohri K) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- N-Glycan structures of an osteopontin from human bone. (2000 - Masuda K, Takahashi N, Tsukamoto Y, Honma H, Kohri K) / Status : Reviewed
- Glycosylated major urinary protein of the house mouse: characterization of its N-linked oligosaccharides. (2000 - Mechref Y, Zidek L, Ma W, Novotny M) / Status : Reviewed
- Structural determination of N-linked carbohydrates by matrix-assisted laser desorption/ionization-mass spectrometry following enzymatic release within sodium dodecyl sulfate-polyacrylamide electrophoresis gels: application to species-specific glycosylation of alpha1-acid glycoprotein. (1998 - Kuster B, Hunter A, Wheeler S, Dwek R, Harvey D) / Status : Reviewed
- Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
- Two-dimensional chromatography in the analysis of complex glycans from transferrin. (1998 - Charlwood J, Birrell H, Tolson D, Camilleri P) / Status : Reviewed
- Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. (1998 - Olsen E, Rahbek-Nielsen H, Thogersen I, Roepstorff P, Enghild J) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Detailed oligosaccharide structures of human integrin alpha 5 beta 1 analyzed by a three-dimensional mapping technique. (1996 - Nakagawa H, Zheng M, Hakomori S, Tsukamoto Y, Kawamura Y, Takahashi N) / Status : Reviewed
- Human alpha-fetoprotein produced from Hep G2 cell line: structure and heterogeneity of the oligosaccharide moiety. (1995 - Ferranti P, Pucci P, Marino G, Fiume I, Terrana B, Ceccarini C, Malorni A) / Status : Reviewed
- Structural differences between complex-type Asn-linked glycan chains of glycoproteins in rat hepatocytes and Zajdela hepatoma cells. (1995 - Goulut-Chassaing C, Bourrillon R) / Status : Reviewed
- An efficient preparation and structural characterization of sialylglycopeptides from protease treated egg yolk. (1995 - Koketsu M, Seko A, Juneja L, Kim M, Kashimura N, Yamamoto T) / Status : Reviewed
- Three-dimensional elution mapping of pyridylaminated N-linked neutral and sialyl oligosaccharides. (1995 - Takahashi N, Nakagawa H, Fujikawa K, Kawamura Y, Tomiya N) / Status : Reviewed
- Structural determination of two N-linked glycans isolated from recombinant human lactoferrin expressed in BHK cells. (1995 - Legrand D, Salmon V, Coddeville B, Benaissa M, Plancke Y, Spik G) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the N-linked oligosaccharides on human plasma vitronectin. (1995 - Ogawa H, Yoneda A, Seno N, Hayashi M, Ishizuka I, Hase S, Matsumoto I) / Status : Reviewed
- Primary structure of the major glycan from human seminal transferrin. (1994 - D'Andrea G, D'Alessandro A, Salucci M, Oratore A) / Status : Reviewed
- A strategy for the mapping of N-glycans by high-performance capillary electrophoresis. (1994 - Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D) / Status : Reviewed
- The carbohydrate structure of the asparagine-linked oligosaccharides of rat plasma thiostatin. (1994 - Rusiniak M, Bedi G, Back N) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Human serum amyloid P component is an invariant constituent of amyloid deposits and has a uniquely homogeneous glycostructure. (1994 - Pepys M, Rademacher T, Amatayakul-Chantler S, Williams P, Noble G, Hutchinson W, Hawkins P, Nelson S, Gallimore J, Herbert J) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Change in glycosylation of chicken transferrin glycans biosynthesized during embryogenesis and primary culture of embryo hepatocytes. (1994 - Jacquinot P, Leger D, Wieruszeski J, Coddeville B, Montreuil J, Spik G) / Status : Reviewed
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- Structural study of the N-linked oligosaccharides of hepatocyte growth factor by two-dimensional sugar mapping. (1993 - Hara H, Nakae Y, Sogabe T, Ihara I, Ueno S, Sakai H, Inoue H, Shimizu S, Nakamura T, Shimizu N) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Sugar chains of human cord serum alpha-fetoprotein: characteristics of N-linked sugar chains of glycoproteins produced in human liver and hepatocellular carcinomas. (1993 - Yamashita K, Taketa K, Nishi S, Fukushima K, Ohkura T) / Status : Reviewed
- Studies on the carbohydrate moiety and on the biosynthesis of rat C-reactive protein. (1993 - Sambasivam H, Rassouli M, Murray R, Nagpurkar A, Mookerjea S, Azadi P, Dell A, Morris H) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Structures of the N-linked oligosaccharides on porcine plasma vitronectin. (1993 - Yoneda A, Ogawa H, Matsumoto I, Ishizuka I, Hase S, Seno N) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- N-glycosylation site mapping of human serotransferrin by serial lectin affinity chromatography, fast atom bombardment-mass spectrometry, and 1H nuclear magnetic resonance spectroscopy. (1992 - Fu D, van Halbeek H) / Status : Reviewed
- Structure of the N- and O-glycans of the A-chain of human plasma alpha 2HS-glycoprotein as deduced from the chemical compositions of the derivatives prepared by stepwise degradation with exoglycosidases. (1992 - Watzlawick H, Walsh M, Yoshioka Y, Schmid K, Brossmer R) / Status : Reviewed
- Separation and characterization of the two Asn-linked glycosylation sites of chicken serum riboflavin-binding protein. Glycosylation differences despite similarity of primary structure. (1992 - Rohrer J, White H) / Status : Reviewed
- Comparative study of asparagine-linked glycans of plasma T-kininogen in normal rats and during acute inflammation. (1992 - Baussant T, Alonso C, Wieruszeski J, Strecker G, Montreuil J, Alhenc-Gelas F, Michalski J) / Status : Reviewed
- The Asn-linked carbohydrate chains of human Tamm-Horsfall glycoprotein of one male. Novel sulfated and novel N-acetylgalactosamine-containing N-linked carbohydrate chains. (1992 - Hard K, Van Zadelhoff G, Moonen P, Kamerling J, Vliegenthart F) / Status : Reviewed
- Electrophoretic resolution and fluorescence detection of N-linked glycoprotein oligosaccharides after reductive amination with 8-aminonaphthalene-1,3,6-trisulphonic acid. (1992 - Stack R, Sullivan M) / Status : Reviewed
- Carbohydrate structures of recombinant soluble human CD4 expressed in Chinese hamster ovary cells. (1991 - Spellman M, Leonard C, Basa L, Gelineo I, van Halbeek H) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structure determination of the glycans of human-serum alpha 1-antichymotrypsin using 1H-NMR spectroscopy and deglycosylation by N-glycanase. (1991 - Laine A, Hachulla E, Strecker G, Michalski J, Wieruszeski J) / Status : Reviewed
- Carbohydrate microheterogeneity of rat serotransferrin. Determination of glycan primary structures and characterization of a new type of trisialylated diantennary glycan. (1991 - Spik G, Coddeville B, Strecker G, Montreuil J, Regoeczi E, Chindemi P, Rudolph J) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Site-specific N-glycosylation of human chorionic gonadotrophin--structural analysis of glycopeptides by one- and two-dimensional 1H NMR spectroscopy. (1991 - Weisshaar G, Hiyama J, Renwick A) / Status : Reviewed
- NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharides of guinea-pig factor B of the alternative complement pathway. (1990 - Mizuochi T, Hamako J, Titani K, Matsushita M, Okada H) / Status : Reviewed
- Structure determination of the major N- and O-linked carbohydrate chains of the beta subunit from equine chorionic gonadotropin. (1990 - Damm J, Hard K, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Primary structure of glycans isolated from human leucocyte lactotransferrin. Absence of fucose residues questions the proposed mechanism of hyposideraemia. (1990 - Derisbourg P, Wieruszeski J, Montreuil J, Spik G) / Status : Reviewed
- Isolation and structure determination of the intact sialylated N-linked carbohydrate chains of recombinant human follitropin expressed in Chinese hamster ovary cells. (1990 - Hard K, Mekking A, Damm J, Kamerling J, de Boer W, Wijnands R, Vliegenthart J) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- The carbohydrate structures of a mouse monoclonal IgG antibody OKT3. (1990 - Krotkiewski H, Grnberg G, Krotkiewska B, Nilsson B, Svensson S) / Status : Reviewed
- Protein and carbohydrate structural analysis of a recombinant soluble CD4 receptor by mass spectrometry. (1989 - Carr SA, Hemling ME, Folena-Wasserman G, Sweet RW, Anumula K, Barr JR, Huddleston MJ, Taylor P) / Status : Reviewed
- The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns. (1988 - Marti T, Schaller J, Rickli E, Schmid K, Kamerling J, Gerwig G, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The asparagine-linked oligosaccharides on bovine fetuin. Structural analysis of N-glycanase-released oligosaccharides by 500-megahertz 1H NMR spectroscopy. (1988 - Green E, Adelt G, Baenziger J, Wilson S, Van Halbeek H) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- The structures of the carbohydrate moieties of bovine blood coagulation factor IX (Christmas factor). (1983 - Mizuochi T, Taniguchi T, Fujikawa K, Titani K, Kobata A) / Status : Reviewed
- The structures and microheterogeneity of the carbohydrate chains of human plasma ceruloplasmin. A study employing 500-MHz 1H-NMR spectroscopy. (1982 - Endo M, Suzuki K, Schmid K, Fournet B, Karamanos Y, Montreuil J, Dorland L, van Halbeek H, Vliegenthart J) / Status : Reviewed
- The asparagine-linked sugar chains of plasma membrane glycoproteins of K-562 human leukaemic cells: a comparative study with human erythrocytes. (1982 - Yoshima H, Shiraishi N, Matsumoto A, Maeda S, Sugiyama T, Kobata A) / Status : Reviewed
- Carbohydrate structure of human fibrinogen. Use of 300-MHz 1H-NMR to characterize glycosidase-treated glycopeptides. (1982 - Townsend RR, Hilliker E, Li Y-T, Laine RA, Bell WR, Lee YC) / Status : Reviewed
- Studies on the structures of the carbohydrate moiety of human prothrombin. (1981 - Mizuochi T, Fujii J, Kisiel W, Kobata A) / Status : Reviewed
- Structural studies of asparagine-linked sugar chains of human ceruloplasmin. Structural characteristics of the triantennary complex type sugar chains of human plasma glycoproteins. (1981 - Yamashita K, Liang CJ, Funakoshi S, Kobata A) / Status : Reviewed
- Studies on the oligosaccharide chains of human alpha 1-protease inhibitor. II. Structure of oligosaccharides. (1980 - Mega T, Lujan E, Yoshida A) / Status : Reviewed
- Structural studies of the sugar chains of cold-insoluble globulin isolated from human plasma. (1980 - Takasaki S, Yamashita K, Suzuki K, Kobata A) / Status : Reviewed
- Structure of the oligosaccharide of human J chain. (1979 - Baenziger J) / Status : Reviewed
- The carbohydrate of bovine prothrombin. Occurrence of Galb1-3GlcNAc grouping in asparagine-linked sugar chains. (1979 - Mizuochi T, Yamashita K, Fujikawa K, Kisiel W, Kobata A) / Status : Reviewed
Reference
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- 5'-AMP-activated protein kinase catalytic subunit alpha-2 / Homo sapiens
- A disintegrin and metalloproteinase with thrombospondin motifs (13adamts13) / Homo sapiens
- Acid ceramidase / Homo sapiens
- ADAM DEC1 / Homo sapiens
- ADAMTS-like protein 2 / Homo sapiens
- Adhesion G protein-coupled receptor F5 / Homo sapiens
- Adhesion G protein-coupled receptor L4 / Homo sapiens
- Adhesion G-protein coupled receptor D1 / Homo sapiens
- Adipocyte enhancer-binding protein 1 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Afamin / Homo sapiens
- Agrin / Homo sapiens
- Alkaline phosphatase, tissue-nonspecific isozyme / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-1b-glycoprotein / Homo sapiens
- Alpha-2-antiplasmin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-mannosidase 2 / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Angiopoietin-related protein 4 / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asn-690
- Angiotensinogen / Homo sapiens
- Ankyrin repeat domain-containing protein 62 / Homo sapiens
- Antithrombin-III / Homo sapiens
- Apolipoprotein (a) / Homo sapiens
- Apolipoprotein b-100 / Homo sapiens
- Apolipoprotein C-IV / Homo sapiens
- Apolipoprotein d / Homo sapiens
- Apolipoprotein f / Homo sapiens
- Apolipoprotein M / Homo sapiens
- Asialoglycoprotein receptor 2 / Homo sapiens
- ATP-dependent 6-phosphofructokinase, liver type / Homo sapiens
- Attractin / Homo sapiens
- Basal cell adhesion molecule / Homo sapiens
- Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
- BDNF/NT-3 growth factors receptor / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Beta-Ala-His dipeptidase / Homo sapiens
- Biglycan / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
- Biotinidase / Homo sapiens
- Bone marrow stromal antigen 2 / Homo sapiens
- Breast cancer type 1 susceptibility protein / Homo sapiens
- Butyrophilin subfamily 1 member A1 / Homo sapiens
- C4b-binding protein alpha chain / Homo sapiens
- C4b-binding protein beta chain / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
- Cadherin-13 / Homo sapiens
- Cadherin-related family member 2 / Homo sapiens
- Calbindin / Homo sapiens
- Calcium-activated chloride channel regulator 2 / Homo sapiens
- Calumenin / Homo sapiens
- Carboxypeptidase b2 / Homo sapiens
- Carboxypeptidase N subunit 2 / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Catalase / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin L1 / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD166 antigen / Homo sapiens
- CD276 antigen / Homo sapiens
- CD44 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Cell adhesion molecule 1 / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Cholesteryl ester transfer protein / Homo sapiens
- Cholinesterase / Homo sapiens
- Choriogonadotropin beta chain / Homo sapiens
- Claudin-18 / Homo sapiens
- Clusterin / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
-
Coagulation factor IX / Homo sapiens
- Undefined site
- Coagulation factor V / Homo sapiens
- Coagulation factor VIII / Homo sapiens
- Coagulation factor XI / Homo sapiens
- Coagulation factor XII / Homo sapiens
- Coagulation factor XIII B chain / Homo sapiens
- Collagen alpha-1(V) chain / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-1(XIV) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Complement C1q subcomponent subunit A / Homo sapiens
- Complement c1r subcomponent / Homo sapiens
- Complement C1r subcomponent-like protein / Homo sapiens
- Complement C1s subcomponent / Homo sapiens
- Complement C2 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Complement C5 / Homo sapiens
- Complement component c6 / Homo sapiens
- Complement component c7 / Homo sapiens
- Complement component C8 alpha chain / Homo sapiens
- Complement component C8 beta chain / Homo sapiens
- Complement component C9 / Homo sapiens
- Complement decay-accelerating factor / Homo sapiens
- Complement factor b / Homo sapiens
- Complement factor h / Homo sapiens
- Complement factor H-related protein 1 / Homo sapiens
- Complement factor H-related protein 2 / Homo sapiens
- Complement factor H-related protein 3 / Homo sapiens
- Complement factor H-related protein 4 / Homo sapiens
- Complement factor H-related protein 5 / Homo sapiens
- Complement factor i / Homo sapiens
- Complement receptor type 1 / Homo sapiens
- Contactin-1 / Homo sapiens
- Contactin-3 / Homo sapiens
- Contactin-4 / Homo sapiens
- COP9 signalosome complex subunit 2 / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Coxsackievirus and adenovirus receptor / Homo sapiens
- Cubilin / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dickkopf-related protein 3 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 4 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Dopamine beta-hydroxylase / Homo sapiens
- E3 ubiquitin-protein ligase Mdm2 / Homo sapiens
- Early activation antigen CD69 / Homo sapiens
- Ecto-ADP-ribosyltransferase 4 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Homo sapiens
- EGF-containing fibulin-like extracellular matrix protein 2 / Homo sapiens
- EMILIN-1 / Homo sapiens
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
- Endothelial protein C receptor / Homo sapiens
- Ephrin-B2 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- Erythropoietin / Homo sapiens
- Extracellular serine/threonine protein kinase FAM20C / Homo sapiens
- Extracellular sulfatase Sulf-1 / Homo sapiens
- Extracellular sulfatase Sulf-2 / Homo sapiens
- Fer-1-like protein 6 / Homo sapiens
- Fetuin-B / Homo sapiens
-
Fibrinogen / Homo sapiens
- Undefined site
-
Fibrinogen beta chain / Homo sapiens
- Undefined site
- Asn-394
-
Fibrinogen gamma chain / Homo sapiens
- Undefined site
- Asn-78
- Fibroblast growth factor receptor 1 / Homo sapiens
- Fibroblast growth factor receptor 4 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
-
Follitropin, alpha and beta chains / Homo sapiens
- Undefined site
- Frizzled-4 / Homo sapiens
- G-protein coupled receptor 126 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyltranspeptidase 1 / Homo sapiens
- Glyceraldehyde-3-phosphate dehydrogenase / Homo sapiens
- Glycocalicin / Homo sapiens
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Glycosaminoglycan xylosylkinase / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Helicase POLQ-like / Homo sapiens
- Hemopexin / Homo sapiens
- Heparin cofactor 2 / Homo sapiens
- Hepatocyte growth factor / Homo sapiens
- Hepatocyte growth factor activator / Homo sapiens
- Hepatocyte growth factor-like protein / Homo sapiens
- Histidine-rich glycoprotein / Homo sapiens
- Histone-lysine N-methyltransferase SUV420H1 / Homo sapiens
- Homeobox protein Hox-B3 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Icos ligand / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant delta / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin superfamily DCC subclass member 4 / Homo sapiens
- Inactive dipeptidyl peptidase 10 / Homo sapiens
- Inactive gamma-glutamyltranspeptidase 2 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Inhibin beta E chain / Homo sapiens
- Inhibitor of nuclear factor kappa-B kinase-interacting protein / Homo sapiens
- Insulin-like growth factor-binding protein 3 / Homo sapiens
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
- Integral membrane protein 2B / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-5 / Homo sapiens
-
Integrin alpha-5/beta-1 / Homo sapiens
- Undefined site
- Integrin alpha-V / Homo sapiens
- Integrin beta-3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Interferon alpha/beta receptor 2 / Homo sapiens
- Interleukin-1 receptor accessory protein / Homo sapiens
- Interleukin-1 receptor antagonist protein / Homo sapiens
- Interleukin-1 receptor type 2 / Homo sapiens
- Interleukin-1 receptor-like 1 / Homo sapiens
- Kallistatin / Homo sapiens
- Keratin, type II cytoskeletal 1 / Homo sapiens
- Kininogen-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Leptin receptor / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Leucine-rich repeat transmembrane protein FLRT3 / Homo sapiens
- Leucine-rich repeat-containing protein 15 / Homo sapiens
- Ligand-dependent nuclear receptor corepressor-like protein / Homo sapiens
- Lipopolysaccharide-binding protein / Homo sapiens
- Lipoprotein lipase / Homo sapiens
- Low-density lipoprotein receptor / Homo sapiens
- Lumican / Homo sapiens
- Lutropin beta chain / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrophage colony-stimulating factor 1 receptor / Homo sapiens
- Macrophage mannose receptor 1 / Homo sapiens
- Macrophage receptor MARCO / Homo sapiens
- Maltase-glucoamylase, intestinal / Homo sapiens
- Mannan-binding lectin serine protease 1 / Homo sapiens
- Matrix metalloproteinase-9 / Homo sapiens
- Membrane cofactor protein / Homo sapiens
- Mesothelin / Homo sapiens
- Mimecan / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Mucin-5B / Homo sapiens
- Multimerin-1 / Homo sapiens
- Multimerin-2 / Homo sapiens
- Multiple inositol polyphosphate phosphatase 1 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Neogenin / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neural cell adhesion molecule L1-like protein / Homo sapiens
- Neuroblastoma suppressor of tumorigenicity 1 / Homo sapiens
- Neurofascin / Homo sapiens
- Neuronal cell adhesion molecule / Homo sapiens
- Neuropilin-1 / Homo sapiens
- Neuroplastin / Homo sapiens
- Noelin / Homo sapiens
- Oncoprotein-induced transcript 3 protein / Homo sapiens
- Oncostatin-M-specific receptor subunit beta / Homo sapiens
- Osteomodulin / Homo sapiens
-
Osteopontin / Homo sapiens
- Undefined site
- P-selectin / Homo sapiens
- P2X purinoceptor 4 / Homo sapiens
- Pantetheinase / Homo sapiens
- Periostin / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phosphatidylcholine-sterol acyltransferase / Homo sapiens
- Phosphatidylinositol-glycan-specific phospholipase D / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- Phospholipase D4 / Homo sapiens
- Pigment epithelium-derived factor / Homo sapiens
- Plasma kallikrein / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Plasma serine protease inhibitor / Homo sapiens
- Plasminogen / Homo sapiens
- Platelet endothelial cell adhesion molecule / Homo sapiens
- Platelet glycoprotein V / Homo sapiens
- Platelet-derived growth factor receptor beta / Homo sapiens
- Platelet-derived growth factor subunit b / Homo sapiens
- Plexin-B1 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Plexin-c1 / Homo sapiens
- Podocalyxin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pregnancy zone protein / Homo sapiens
- Probable serine carboxypeptidase CPVL / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolargin / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl endopeptidase FAP / Homo sapiens
- Prominin-1 / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostatic acid phosphatase / Homo sapiens
- Protein AMBP / Homo sapiens
- Protein heg homolog 1 / Homo sapiens
- Protein phosphatase 1 regulatory subunit 21 / Homo sapiens
- Protein Z-dependent protease inhibitor / Homo sapiens
- Protein-lysine 6-oxidase / Homo sapiens
- Prothrombin / Homo sapiens
- Protocadherin-9 / Homo sapiens
- Putative gamma-glutamyltranspeptidase 3 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Receptor-type tyrosine-protein phosphatase eta / Homo sapiens
- Receptor-type tyrosine-protein phosphatase F / Homo sapiens
- Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Receptor-type tyrosine-protein phosphatase mu / Homo sapiens
- Reelin / Homo sapiens
-
Rhodopsin / Homo sapiens
- Undefined site
- Ribonuclease pancreatic / Homo sapiens
- Scavenger receptor cysteine-rich type 1 protein M130 / Homo sapiens
- Secretory phospholipase a2 receptor / Homo sapiens
- Seizure 6-like protein 2 / Homo sapiens
- Selenoprotein P / Homo sapiens
- Semaphorin-4B / Homo sapiens
- Semaphorin-4D / Homo sapiens
- Semaphorin-6A / Homo sapiens
- Semaphorin-7A / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum albumin / Homo sapiens
- Serum amyloid p-component / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Sex hormone-binding globulin / Homo sapiens
- Sialic acid-binding Ig-like lectin 14 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Sodium-dependent phosphate transporter 1 / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-3 / Homo sapiens
- Sortilin / Homo sapiens
- Sulfhydryl oxidase 1 / Homo sapiens
- Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 / Homo sapiens
- T-cell surface glycoprotein cd4 / Homo sapiens
- Target of Nesh-SH3 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-N / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Thyroxine-binding globulin / Homo sapiens
- Trafficking protein particle complex subunit 8 / Homo sapiens
- Trans-Golgi network integral membrane protein 2 / Homo sapiens
- Transcobalamin-1 / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 21 / Homo sapiens
- Tyrosine-protein kinase receptor TYRO3 / Homo sapiens
- Tyrosine-protein kinase receptor UFO / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Pleura / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
- Vascular cell adhesion protein 1 / Homo sapiens
- Vascular non-inflammatory molecule 2 / Homo sapiens
- Vasorin / Homo sapiens
- Villin-1 / Homo sapiens
- Vitamin d-binding protein / Homo sapiens
- Vitamin k-dependent protein c / Homo sapiens
- Vitamin K-dependent protein S / Homo sapiens
- Vitronectin / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
- Von willebrand factor / Homo sapiens
- Zinc finger protein 318 / Homo sapiens
- Zinc finger protein 432 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Bos taurus
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
-
Coagulation factor IX / Bos taurus
- Undefined site
- Fetuin-b / Bos taurus
- Plasminogen / Bos taurus
-
Prothrombin / Bos taurus
- Undefined site
-
Alpha-1-acid glycoprotein / Canis familiaris
- Undefined site
-
Factor b1 / Cavia porcellus
- Undefined site
-
Factor b2 / Cavia porcellus
- Undefined site
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Uncharacterized protein from Dander / Equus caballus
- Undefined site
-
Major urinary protein / Mus musculus
- Undefined site
-
Monoclonal antibody okt3 / Mus musculus
- Undefined site
-
Alpha-1-acid glycoprotein / Ovis aries
- Undefined site
- C-reactive protein / Rattus norvegicus
-
Serotransferrin / Rattus norvegicus
- Undefined site
-
T-kininogen / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
- Plasminogen / Sus scrofa
-
Vitronectin / Sus scrofa
- Undefined site
-
Kininogen / Salmo salar
- Undefined site
-
Salarin / Salmo salar
- Undefined site
-
Immunoglobulin gamma / Columba livia
- Undefined site
-
Ovotransferrin / Gallus gallus
- Undefined site
- Riboflavin-binding protein / Gallus gallus
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Coagulation factor x / Tropidechis carinatus
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- SWPAVGNCSSALR (13aa)
- NPNATSSSSQDPESLQDRGEGK (22aa)
- QIDLNITCR (9aa)
- ASSNPNATSSSSQDPESLQDR (21aa)
- NPNATSSSSQDPESLQDR (18aa)
- MDPNAAYVNMSNHHR (15aa)
- CANLVPVPITNATLDR (16aa)
- NFNSTQKFIED (11aa)
- LVPVPITNATLDR (13aa)
- DIENFNSTQK (10aa)
- RDIENFNSTQKF (12aa)
- CANLVPVPITNATLDQITGK (20aa)
- LVPVPITNATLDQITGK (17aa)
- EEEMLENVSLVCPK (14aa)
- VTACHSSQPNATLYK (15aa)
- SIVLEPIYWNSSNSK (15aa)
- GCNDSDVLAVAGFALR (16aa)
- GCNDSDVLAVAGF (13aa)
- NGNGTACIMANFSAAFSVNYDTK (23aa)
- KQEEAGVRPSAGNVSTHPSLSQRPGGSTKS (30aa)
- NITQIVGHSGCEAK (14aa)
- TAVNCSSDFDACIITK (16aa)
- TAVNCSSDFDACLITK (16aa)
- VHINTTSDSILLK (13aa)
- YKNNSDISSTR (11aa)
- HLVIHNESTCEQLAK (15aa)
- VYIHPFHLVIHNESTCEQLAK (21aa)
- GSLEVNCSTTCNQPEVGGLETSLDK (25aa)
- VIHNESTCEQLAK (13aa)
- YNSQNQSNNQFVLYR (15aa)
- KYNSQNQSNNQFVLYR (16aa)
- WQMNFTVR (8aa)
- NLSMPLLPADFHK (13aa)
- KNLSMPLLPADFHKE (15aa)
- LAVDEEENADNNTK (14aa)
- ESVTDHVNLITPLEKPLQNFTLCFR (25aa)
- PIQNFTICFR (10aa)
- WFSAGLASNSSWLR (14aa)
- EAENITTGC (9aa)
- GCVLLSYLNETVTVSASLESVR (22aa)
- NEEYNK (6aa)
- MFNNCEVVLGNLEITYVQR (19aa)
- WFYIASAFRNEEYNK (15aa)
- KWFYIASAFRNEEYNKS (17aa)
- AFNSTLPTMAQMEK (14aa)
- YETTNK (6aa)
- LEPNSVDPENITEIFIANQK (20aa)
- NMTFDLPSDATVVLNR (16aa)
- MSVILLTPDELTNSSETR (18aa)
- MKELLETVVNR (11aa)
- LLHGDPGEEDGAELDLNMTR (20aa)
- IADAHIDRVENTTVYYIVIDVQESDCSVISR (31aa)
- TLDDNGTMLFFK (12aa)
- ATTLDDNGTMLFFKGE (16aa)
- TLFCNASK (8aa)
- CSDGWSFDATTLDDNGTMLFFK (22aa)
- DDNGTMLFFK (10aa)
- SFDATTLDDNGTMLFFK (17aa)
- CIQANYSLMENGKIK (15aa)
- LNGTDVDTGMDFR (13aa)
- NVTHLLQQELTEAQK (15aa)
- CIQANYSLMEN (11aa)
- CIQANYSIMENGK (13aa)
- CIQANYSLMENGK (13aa)
- CLNWLDAQSGLASAPVSGAGNHSYCR (26aa)
- INLTWHK (7aa)
- INICGSVDIVQCGPSSAVCMHDLK (24aa)
- FEAEHISNYTALLLSR (16aa)
- NK (2aa)
- QLAHQSNSTNIFFSPV (16aa)
- QLAHQSNSTNIF (12aa)
- QLAHQSNSTNIFF (13aa)
- QLAHQSNSTNIFFSPVSIATAF (22aa)
- ELNGSCMR (8aa)
- QLAHQSNSTNIFFSPVSIATAFAMLSLGTK (30aa)
- RTPEDTAEDTCHLIPGVAESVATCHFNHSSKT (32aa)
- EWDNTTTECR (10aa)
- ENISDPTSPLR (11aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- SVQEIQATFFYFTPNKTEDTIFLR (24aa)
- SVQEIQATFFYFTPNK (16aa)
- AFHYNVSSHGCQLLPWTQHSPHTR (24aa)
- YFTPNKTEDTIFLR (14aa)
- SVQEIQATFFYFTPNKT (17aa)
- QVHFFVNASDVDNVK (15aa)
- FNSSGTHFSNLSK (13aa)
- EMITEASFYLFNATK (15aa)
- ANTTQPGIVEGGQVIK (16aa)
- AFGSNPNLTK (10aa)
- TTENYPNAGLIMNYCR (16aa)
- GVAVTNTSK (9aa)
- EAVFAVNALNISEK (14aa)
- LYHFLLGAWSLNATELDPCPLSPELLGLTK (30aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DLQSLEDILHQVENK (15aa)
- VDKDLQSLEDILHQVENK (18aa)
- DSVINLSESVEDGPK (15aa)
- DNATEEEILVYLEK (14aa)
- AFITNFSMIIDGMTYPGIIK (20aa)
- AFITNFSMNIDGMTYPGIIK (20aa)
- DPGAAVPGAANASAQQPR (18aa)
- EGYSNISYIVVNHQGISSR (19aa)
- KEGYSNISYIVVNHQGISSR (20aa)
- EAGNHTSGAGIVQINK (16aa)
- ENTSDPSLVIAFGR (14aa)
- IETSNVIWVGNYSTTVK (17aa)
- DDVLFYNISSMK (12aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- WSDIWNATK (9aa)
- NNATVHEQVGGPSLTSDLQAQSK (23aa)
- EDALNETR (8aa)
- NNATVHEQVGGPSLTSDLQAQ (21aa)
- NATVHEQVGGPSLTSDLQAQSK (22aa)
- NNATVHEQVGGPSITSDIQAQSK (23aa)
- KNNATVHEQVGGPSLTSDLQAQSKG (25aa)
- KKKEDALNETRE (12aa)
- NQCETR (6aa)
- QNQCFYNSSYLNVQR (15aa)
- AIVNFTR (7aa)
- ICNQNSSNPNQR (12aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- TAFITNFTLTIDGVTYPGNVK (21aa)
- LNLSENYTLSISNAR (15aa)
- LSLGAHNTTLTEILK (15aa)
- SLGAHNTTLTEILK (14aa)
- QDQCIYNTTYINVQR (15aa)
- ALAFLSLGAHNTTLTEILK (19aa)
- NVIFSPLSISTALAFLSLGAHNTTLTEILK (30aa)
- QDQCIYNTTYLNVQR (15aa)
- FLNESYK (7aa)
- GSQWSDIEEFCNR (13aa)
- AQLLQGLGFNLTER (14aa)
- AQIIQGIGFNITER (14aa)
- AFITNF (6aa)
- IGHCPDPVIVNGEFSSSGPVNVSDK (25aa)
- ADGTVNQIEGEATPVNLTEPAK (22aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- KCQLNLTDSENR (12aa)
- IAVQFGPGFSWIANFTK (17aa)
- TCDWIPKPNMSASCK (15aa)
- FQLLNFSSSELK (12aa)
- LFNVTPQDEQK (11aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- ELPGVCNETMMALWEECK (18aa)
- ELPGVCNETMMALWEECKPC (20aa)
- TKLKELPGVCNE (12aa)
- VQNMSQSIEVLDR (13aa)
- FINNGTCTAEGK (12aa)
- GHTLTLNFTR (10aa)
- FLNNGTCTAEGK (12aa)
- TAIFPDIIAQGNASIR (16aa)
- SNSSMHITDCR (11aa)
- QESMNSNVSVYQPPR (15aa)
- TFYWDFYTNR (10aa)
- SIDVSIQNVSVVFK (14aa)
- FNLTETSEAEIHQSFQHLLR (20aa)
- SGDASINVTNIQISDIGTYQCK (22aa)
- FNITETSEAEIHQSFQHIIR (20aa)
- ADTHDEIIEGINFNITEIPEAQIHEGFQEIIR (32aa)
- ADTHDEILEGLNFNLT (16aa)
- ADTHDEILEGLNFNLTEIPEAQIH (24aa)
- YTTFEYPNTINFSCNTGFYLNGADSAK (27aa)
- ADTHDEILEGLNFNLTEIPEAQIHEGF (27aa)
- ADTHDEILEGLNFNLTEIPEAQIHE (25aa)
- ADTHDEILEGLNFNLTEIPEAQIHEG (26aa)
- ADTHDEILEGLNFNLTEIPEAQ (22aa)
- ADTHDEILEGLNFNLTEIPEAQIHEGFQEL (30aa)
- FVQGNSTEVACHPGYGLPK (19aa)
- KFVQGNSTEVACHPGYGLPK (20aa)
- HNFSHCCSK (9aa)
- DIVEYYNDSNGSHVIQGR (18aa)
- DIVEYYNDSNGSHVLQGR (18aa)
- LQLEAVNITDLSENR (15aa)
- AVLVNNITTGER (12aa)
- LGSYPVGGNVSFECEDGFILR (21aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- SKWNITMESYVVHTNYDEYAIFITK (25aa)
- SKWNITMESY (10aa)
- ANMTLTSGIMFIVSGLCAI (19aa)
- QACASFNGNCCLWNTTVEVK (20aa)
- SANASFNIK (9aa)
- LHEITNETFR (10aa)
- GAFISNFSMTVDGK (14aa)
- GAFISNF (7aa)
- QGGVNATQVLIQHLR (15aa)
- DLEITNATLQSEEDSR (16aa)
- DVQIIVFPEDGIHGFNFTR (19aa)
- IAFATMFNSSEQSQK (15aa)
- WHHHNITYWIQNYSEDLPR (19aa)
- NSNLQHINFTR (11aa)
- DKLAACLEGNCAEGLGTNYRGHVNITR (27aa)
- GHVNITR (7aa)
- ITNNQTGQMVFSETVITSVGDEEGR (25aa)
- SPYYNVSDEISFHCYDGYTIR (21aa)
- TQSLLIVNNATNVVIK (16aa)
- GNESALWDCK (10aa)
- VIDFNCTTSSVSSALANTK (19aa)
- VIDFNCTTSSVSSAIANTK (19aa)
- LRPDDSKNFSIQVR (14aa)
- MLLTFHTDFSNEENGTIMFYK (21aa)
- LQNNENNISCVER (13aa)
- ALSHLALGAQNHTLQR (16aa)
- ALALSHLALGAQNHTLQR (18aa)
- GINYNSSVAK (10aa)
- IQNNENNISCVER (13aa)
- LHINHNNLTESVGPLPK (17aa)
- TLNQSSDELQLSMGN (15aa)
- GVNFNVSK (8aa)
- KLHINHNNLTESVGPLPK (18aa)
- TLNQSSDELQLSMGNAMFVK (20aa)
- TINQSSDEIQISMGNAMFVK (20aa)
- FGCEIENNR (9aa)
- LGACNDTLQQLMEVFK (16aa)
- LGACNDTLQQLMEVFKFDTISEK (23aa)
- KLNYTLSQGHR (11aa)
- KLGACNDTLQQLMEVFKF (18aa)
- IGACNDTIQQIMEVFK (16aa)
- NGSGAVFPVAGADVQTLR (18aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- TFAVYLNNTGYR (12aa)
- VNNGPLGNPIWNISGDPTR (19aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- TFAVYINSTGYR (12aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- TELFSSSCPGGIMLNETGQGYQR (23aa)
- GLSFDVSLEVSQGPGLLNDTK (21aa)
- NEIMINSSIMR (11aa)
- VDNFTQNPGMFR (12aa)
- GEMSRPGEVCSALNLCESLQK (21aa)
- AYLLPAPPAPGNASESEEDR (20aa)
- VLYLAAYNCTLRPVSK (16aa)
- AHVFFEVAVNGSSFVSFRPER (21aa)
- LNPTPGSNAISDVPGER (17aa)
- EHEGAIYPDNTTDFQRADDK (20aa)
- YKEHEGAIYPDNTTDFQR (18aa)
- EHEGAIYPDNTTDFQ (15aa)
- KEHEGAIYPDNTTDFQRA (18aa)
- KEHEGAIYPDNTTDFQRADDKV (22aa)
- EHEGAIYPDNTTDFQR (16aa)
- IGIYADVGNK (10aa)
- EVSFINCSIDNGGCTHYCIEEVGWR (25aa)
- NVSVEALASALQLLAR (16aa)
- GTFTDCALANMTEQIR (16aa)
- SNLSLVNQNKSCEI (14aa)
- CNTTQGNEVTSILR (14aa)
- YPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVR (42aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- SRYPHKPEINSTTHPGADLQENFCR (25aa)
- HKPEINSTTHPGADLQENFCR (21aa)
- GFNASYIR (8aa)
- YPHKPEINSTTHPGADIQENFCR (23aa)
- AENQTAPGEVPALSNLRPPSR (21aa)
- EFGFAWPESLNCSK (14aa)
- QDILNNSLTTLSQDITK (17aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- QIEEFINQSSPFYFWMNGDR (20aa)
- QLEEFLNQSSPF (12aa)
- QLEEFLNQSSPFYFWMNGDR (20aa)
- QLEEFLNQ (8aa)
- DTVITNQEEPYQNHSGR (17aa)
- RNPPMGGNVVIFDTVITNQEEPYQNHSGR (29aa)
- QQYNALLSNMSR (12aa)
- NPPMGGNVVIFDTVITNQEEPYQNHSGR (28aa)
- IISNASCTTNCLAPLAK (17aa)
- IPNNTQWVTWSPVGHK (16aa)
- FSPATHPSEGLEENYCR (17aa)
- FNDTEVLQR (9aa)
- NVTVQVAGETYSLHVGCDLIDSFALDEPFYEHLQAEK (37aa)
- VNCSVPEEK (9aa)
- RNVSWATGRS (10aa)
- HPSCWNLVNGTVVPLGEMR (19aa)
- SRDCDPPGNPVHGYFEGNNFTLGSTISYYCEDR (33aa)
- NGLEENFCR (9aa)
- VCQDCPLLAPLNDTRVVHAAK (21aa)
- VCQDCPIIAPINDTR (15aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- KVCQDCPLLAPLNDTR (16aa)
- KVCQDCPLLAPLNDTRV (17aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- RKVCQDCPLLAPLNDTRV (18aa)
- RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
- VCQDCPLLAPLNDTR (15aa)
- FINDTMAVYEAK (12aa)
- FLNDTMAVYEAK (12aa)
- IGSFEGIVNITFIHIQHNR (19aa)
- AGPNGTLFVADAYK (14aa)
- AGPNGTIFVADAYK (14aa)
- YDIPASINFIINK (13aa)
- GWNWTSGFNK (10aa)
- VYKPSAGNNSLY (12aa)
- DITDLINNTFIR (12aa)
- PSAGNNSLYR (10aa)
- KEHETCLAPELYNGNYSTTQK (21aa)
- VYKPSAGNNSLYR (13aa)
- RVYKPSAGNNSLYRD (15aa)
- EHETCLAPELYNGNYSTTQK (20aa)
- LNLTTDPK (8aa)
- TLYETEVFSTDFSNISAAK (19aa)
- IYIDHNNITR (10aa)
- GFLALYQTVAVNYSQPISEASR (22aa)
- EFNNWFNVTGSDK (13aa)
- IGDCISEDSYPDGNITWYR (19aa)
- KIGDCISEDSYPDGNITWYR (20aa)
- HGIQYFNNNTQHSSLFMLNEVK (22aa)
- NGSLFAFR (8aa)
- HGIQYFNNNTQH (12aa)
- HGIQYFNNNTQHSSLFTLNEVK (22aa)
- FVACQMELLHSNGSQR (16aa)
- CYVIPINTSIVMPPR (15aa)
- CGNCSLTTLK (10aa)
- NCGVNCSGDVFTALIGEIASPNYPK (25aa)
- KCGNCSLTTLKDEDFCK (17aa)
- NCGVNCSGDVFTALIGEIASPNYPKPYPENSR (32aa)
- NCGVNCSGDVFTAIIGEIASPNYPKPYPENSR (32aa)
- CGNCSLTTLKDEDFCK (16aa)
- IVDVNITSEGK (11aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- NAQNNGSNFQLEEISR (16aa)
- AAFNAQNNGSNFQLEEISR (19aa)
- NVTLILDCK (9aa)
- KAALAAFNAQNNGSNFQLEEISRA (24aa)
- LSDLSINSTECLHVHCR (17aa)
- LPEMAQPVDPAHNVSR (16aa)
- ISDISINSTECIHVHCR (17aa)
- FGYILHTDNR (10aa)
- REGDHEFIEVPEAQEDVEATFPVHQPGNYSCSYR (34aa)
- IVVYNQPYINYSR (13aa)
- REGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR (34aa)
- VANLTFVVNSLDGK (14aa)
- EGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYR (33aa)
- ETFFNISK (8aa)
- LLDLSGNNLTHLPK (14aa)
- ILANGSIVLNGSLSYNNK (18aa)
- DTAVFECLPQHAMFGNDTITCTTH (24aa)
- MVSHHNITTGATIINEQWIITTAK (24aa)
- SLEAINGSGLQMGLQR (16aa)
- EHAVFTSNQEEQDPANHTCGVK (22aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- MVSHHNLTTGATLIN (15aa)
- MVSHHNLTTGATL (13aa)
- KMVSHHNLTTGATLINEQWLLTTAKN (26aa)
- CPSSGTPNPTLR (12aa)
- QVLFLDTVYGNCSTHFTVK (19aa)
- VYVNGTLSTSDPSGK (15aa)
- KLPPGLLANFTLLR (14aa)
- KLPPGLLANFT (11aa)