Hex:7 HexNAc:2

Taxonomy

• Cocos nucifera (Coconut)
• Physomitrella patens
• Trichinella spiralis
• Antheraea pernyi (Chinese oak silkmoth)
• Homo sapiens (Human)
• Aspergillus niger
• Phaseolus vulgaris (Kidney bean)
• Felis catus (Cat)
• Pistacia vera (Pistachio)
• Juglans regia (English walnut)
• Influenza a virus (strain a/fowl plague virus/rostock/34)
• Megathura crenulata (Californian giant keyhole limpet)
• Fagopyrum esculentum (Common buckwheat)
• Saccharomyces cerevisiae (Baker's yeast)
• Olea europaea (Common olive)
• Daucus carota (Carrot)
• Musa acuminata (Banana)
• Arabidopsis thaliana (Thale cress)
• Leishmania tropica
• Vigna radiata var. radiata (Mung bean)
• Friend spleen focus-forming virus (gm3.4 mutant)
• Allium cepa (Onion)
• Fragaria x ananassa (Strawberry)
• Cherax quadricarinatus (Australian red claw crayfish)
• Mamestra brassicae
• Human immunodeficiency virus (Hiv)
• Citrus sinensis (Orange)
• Brassica oleracea var. botrytis (Cauliflower)
• Trimeresurus stejnegeri (Chinese green tree viper)
• Artemisia vulgaris (Mugwort)
• Nicotiana alata (Persian tobacco)
• Leishmania major
• Mesocricetus auratus (Golden hamster)
• Coturnix coturnix japonica (Japanese quail)
• Schistosoma mansoni
• Oryza sativa (Rice)
• Trypansoma brucei
• Nicotiana tabacum (Common tobacco)
• Riftia pachyptila (Giant tubeworm)
• Spodoptera frugiperda (Fall armyworm)
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Friend spleen focus-forming virus (gm1 mutant)
• Lycopersicon esculentum (Tomato)
• Marburg virus (strain musoke)
• Asparagus officinalis (Garden asparagus)
• Sus scrofa (Pig)
• Mus musculus (House mouse)
• Spinacia oleracea (Spinach)
• Persea americana (Avocado)
• Carica papaya (Papaya)
• Prunus dulcis var. sativa (Sweet almond)
• Rattus norvegicus (Norway rat)
• Apis mellifera (Honeybee)
• Leishmania donovani
• Naja kaouthia (Monocled cobra)
• Malus domestica var. golden delicious (Cultivated apple - golden delicious)
• Leishmania amazonensis
• Solanum tuberosum (Potato)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Actinidia chinensis (Kiwi fruit)
• Friend murine leukemia virus (F-mulv)
• Friend spleen focus-forming virus (anemia inducing strain)
• Friend spleen focus-forming virus
• Sendai virus (strain hvj)
• Pisum sativum (Pea)
• Glycine max (Soybean)
• Ricinus communis (Castor bean)
• Agaricus bisporus (Common mushroom)
• Apium graveolens var. oulce (Celery)
• Leishmania mexicana
• Bos taurus (Bovine)
• Friend spleen focus-forming virus (gm1.2 mutant)
• Kinetoplastids
• Trypanosoma brucei brucei
• Friend mink cell focus-forming virus
• Bombyx mori (Domestic silkworm)
• Drosophila melanogaster (Fruit fly)
• Friend spleen focus-forming virus (gm1.2.3 mutant)
• Pyrus communis var. williams (Pear)
• Lupinus luteus (Yellow lupine)
• Caenorhabditis elegans
• Pontastacus leptodactylus (Narrow-clawed crayfish)
• Gallus gallus (Chicken)
• Arachis hypogaea (Peanut)
• Pinus pinea (Italian stone pine)
• Acremonium sp
• Corylus avellana (Hazelnut)

Protein

• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Desmocollin-2 / Homo sapiens    Q02487
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens    P04843
• Alpha-amylase / Oryza sativa    P17654
• Transmembrane emp24 domain-containing protein 4 / Mus musculus    Q8R1V4
• Uncharacterized protein from Seed / Vigna radiata var. radiata
• Ephrin-A3 / Mus musculus    O08545
• Sortilin-related receptor / Mus musculus    O88307
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus    Q8VBZ3
• Low-density lipoprotein receptor-related protein 2 / Homo sapiens    P98164
• Protein FAM171A2 / Mus musculus    A2A699
• Semaphorin-4D / Homo sapiens    Q92854
• Sulfatase-modifying factor 1 / Mus musculus    Q8R0F3
• Transmembrane protein 178B / Mus musculus    M0QWJ9
• E3 ubiquitin-protein ligase RNF130 / Mus musculus    Q8VEM1
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus    P46978
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus    P03393
• Uncharacterized protein from Whole Organism / Schistosoma mansoni
• Thrombospondin type-1 domain-containing protein 4 / Mus musculus    Q3UTY6
• Opioid-binding protein/cell adhesion molecule / Mus musculus    G5E8G3
• Uncharacterized protein from Seed / Fagopyrum esculentum
• Cathepsin D / Homo sapiens    P07339
• Prenylcysteine oxidase / Mus musculus    Q9CQF9
• HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens    P04440
• Gamma-glutamyltransferase 7 / Mus musculus    Q99JP7
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Integrin alpha-1 / Mus musculus    Q3V3R4
• Integrin beta-2 / Mus musculus    P11835
• Ig alpha-1 chain c region / Homo sapiens    P01876
• Complement C1q subcomponent subunit A / Mus musculus    P98086
• Low-density lipoprotein receptor-related protein 1B / Homo sapiens    Q9NZR2
• Immunoglobulin m / Homo sapiens
• Pituitary tumor-transforming gene 1 protein-interacting protein / Homo sapiens    P53801
• Receptor tyrosine-protein kinase erbB-3 / Mus musculus    Q61526
• Cadherin-2 / Mus musculus    P15116
• Gamma-glutamyl hydrolase / Mus musculus    Q9Z0L8
• Neutrophil gelatinase-associated lipocalin / Homo sapiens    P80188
• Aggrecan core protein / Mus musculus    Q61282
• Ephrin type-B receptor 3 / Homo sapiens    P54753
• Group XV phospholipase A2 / Mus musculus    Q8VEB4
• Integrin alpha-V / Mus musculus    P43406
• Basal cell adhesion molecule / Homo sapiens    P50895
• Translocon-associated protein subunit alpha / Mus musculus    Q9CY50
• Aminopeptidase n / Homo sapiens    P15144
• Neuronal growth regulator 1 / Mus musculus    Q80Z24
• Neuroendocrine convertase 2 / Mus musculus    P21661
• Metal transporter CNNM4 / Mus musculus    Q69ZF7
• Interferon beta / Mus musculus    P01575
• Basigin / Homo sapiens    P35613
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459
• Glutamate receptor ionotropic, kainate 3 / Mus musculus    B1AS29
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus    Q8BGN3
• Myelin-associated glycoprotein / Mus musculus    P20917
• Heat shock 70 kDa protein 13 / Mus musculus    Q8BM72
• Thrombospondin-1 / Homo sapiens    P07996
• CD166 antigen / Mus musculus    Q61490
• Dipeptidyl peptidase 2 / Homo sapiens    Q9UHL4
• Plexin-A4 / Mus musculus    Q80UG2
• Cadherin-4 / Mus musculus    P39038
• Calreticulin / Homo sapiens    P27797
• Ephrin type-a receptor 2 / Homo sapiens    P29317
• Protein O-glucosyltransferase 1 / Mus musculus    Q8BYB9
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus    Q01097
• Ribonuclease s-3 / Nicotiana alata    O24103
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
• Erlin-2 / Homo sapiens    O94905
• Pro-epidermal growth factor / Homo sapiens    P01133
• Galactose-binding lectin / Trimeresurus stejnegeri    Q9YGP1
• Sodium channel subunit beta-4 / Mus musculus    Q7M729
• Uncharacterized protein from Undefined tissue / Nicotiana tabacum
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Phosphatidylcholine-sterol acyltransferase / Mus musculus    P16301
• Transmembrane prolyl 4-hydroxylase / Mus musculus    Q8BG58
• Membralin / Mus musculus    Q8CIV2
• Hypoxia up-regulated protein 1 / Mus musculus    Q9JKR6
• Contactin-1 / Mus musculus    P12960
• Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus    Q80TS3-2
• Semaphorin-4D / Mus musculus    O09126
• Delta and Notch-like epidermal growth factor-related receptor / Mus musculus    Q8JZM4
• Neuronal cell adhesion molecule / Homo sapiens    Q92823
• Cystatin-C / Mus musculus    P21460
• Glucosylceramidase / Homo sapiens    P04062
• Uncharacterized protein from Undefined tissue / Asparagus officinalis
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Neuronal pentraxin receptor / Mus musculus    Q99J85
• Coagulation factor VIII / Homo sapiens    P00451
• Platelet glycoprotein IV / Bos taurus    P26201
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Uncharacterized protein from Seed / Pistacia vera
• Leishmanolysin / Leishmania donovani    P23223
• Receptor tyrosine-protein kinase erbB-2 / Homo sapiens    P04626
• Apisin / Apis mellifera    O18330
• ER membrane protein complex subunit 10 / Mus musculus    Q3TAS6
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Isoform 2 of Integrin alpha-3 / Mus musculus    Q62470-2
• Ig alpha-2 chain c region / Homo sapiens    P01877
• Attractin / Mus musculus    Q9WU60
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Torsin-1B / Mus musculus    Q9ER41
• Signal-regulatory protein beta-1 isoform 3 / Homo sapiens    Q5TFQ8
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens    O00469
• L-amino-acid oxidase / Homo sapiens    Q96RQ9
• Phaseolin, alpha-type / Phaseolus vulgaris    P07219
• Serpin h1 / Homo sapiens    P50454
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens    Q12797
• Integrin alpha-V / Homo sapiens    P06756
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Extracellular sulfatase Sulf-1 / Homo sapiens    Q8IWU6
• Isoform 2 of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 / Mus musculus    Q8BXA0-2
• Lysosomal alpha-mannosidase / Homo sapiens    O00754
• Uncharacterized protein from Fruit / Actinidia chinensis
• Tripeptidyl-peptidase 1 / Mus musculus    O89023
• Uncharacterized protein from Fruit / Musa acuminata
• Niemann-Pick C1 protein / Homo sapiens    O15118
• Semaphorin-4A / Mus musculus    Q62178
• Fibrillin-2 / Homo sapiens    P35556
• Putative phospholipase B-like 2 / Homo sapiens    Q8NHP8
• Neurocan core protein / Homo sapiens    O14594
• V-type proton ATPase subunit S1 / Homo sapiens    Q15904
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• N-acetylglucosamine-6-sulfatase / Mus musculus    Q8BFR4
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Pre-B-cell leukemia transcription factor-interacting protein 1 / Homo sapiens    Q96AQ6
• Acid ceramidase / Homo sapiens    Q13510
• Uncharacterized protein from Leaf / Arabidopsis thaliana
• Neurocan core protein / Mus musculus    P55066
• Carcinoembryonic antigen-related cell adhesion molecule 1 or 5 / Homo sapiens    P06731    P13688
• Cation-dependent mannose-6-phosphate receptor / Mus musculus    P24668
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens    Q8TCJ2
• Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus    Q9WV18
• Neuroplastin / Mus musculus    P97300
• Decorin / Homo sapiens    P07585
• ERO1-like protein alpha / Mus musculus    Q8R180
• Carboxypeptidase D / Homo sapiens    O75976
• Nucleotide exchange factor SIL1 / Mus musculus    Q9EPK6
• Complement c3 / Homo sapiens    P01024
• Transmembrane protein 87A / Homo sapiens    Q8NBN3
• Adhesion G protein-coupled receptor L1 / Mus musculus    Q80TR1
• Uncharacterized protein from Supernatant / Nicotiana tabacum
• Calreticulin / Spinacia oleracea    A0A0K9QF27
• Teneurin-2 / Mus musculus    Q9WTS5
• Metal transporter CNNM4 / Homo sapiens    Q6P4Q7
• Protocadherin-16 / Mus musculus    E9PVD3
• Claudin domain-containing protein 1 / Mus musculus    Q9CQX5
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
• Synaptotagmin-1 / Mus musculus    P46096
• Membrane glycoproteins / Mamestra brassicae
• Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
• Beta-hexosaminidase subunit alpha / Homo sapiens    P06865
• Procollagen galactosyltransferase 1 / Homo sapiens    Q8NBJ5
• Semaphorin-7A / Mus musculus    Q9QUR8
• Uncharacterized protein from Whole Cell / Kinetoplastids
• Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei    P26334
• Ovalbumin / Gallus gallus    P01012
• Microfibril-associated glycoprotein 4 / Homo sapiens    P55083
• Uncharacterized protein from Fruit / Pyrus communis var. williams
• Olfactomedin-4 / Homo sapiens    Q6UX06
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus    Q64676
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Cathepsin D / Mus musculus    P18242
• Arylphorin / Antheraea pernyi    Q7Z1F8
• Prosaposin / Homo sapiens    P07602
• Mucin-5B / Homo sapiens    Q9HC84
• Von willebrand factor / Homo sapiens    P04275
• Stromal interaction molecule 1 / Mus musculus    P70302
• Basigin / Mus musculus    P18572
• Tyrosine-protein kinase Mer / Mus musculus    Q60805
• CD109 antigen / Homo sapiens    Q6YHK3
• Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus    Q64689
• Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus    O35598
• T-cell surface antigen cd2 / Homo sapiens    P06729
• Cadherin-18 / Mus musculus    E9Q941    E9Q9Q6
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Leucine-rich repeat-containing protein 55 / Mus musculus    Q3UY51
• V-type proton ATPase subunit S1 / Mus musculus    Q9R1Q9
• Membrane glycoproteins / Bombyx mori
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Glutamate receptor 1 / Mus musculus    P23818
• Sodium channel subunit beta-1 / Mus musculus    P97952
• Cadherin-13 / Mus musculus    Q9WTR5
• Lipase member J / Homo sapiens    Q5W064
• Embigin / Mus musculus    P21995
• UPF0577 protein KIAA1324 / Homo sapiens    Q6UXG2
• ATP-binding cassette sub-family A member 7 / Mus musculus    Q91V24
• Collagen alpha-1(I) chain / Homo sapiens    P02452
• CD166 antigen / Homo sapiens    Q13740
• Erlin-1 / Homo sapiens    O75477
• G-protein coupled receptor 56 / Mus musculus    Q8K209
• Mannosyl-oligosaccharide glucosidase / Homo sapiens    Q13724
• Solute carrier family 12 member 5 / Mus musculus    Q91V14
• Sortilin-related receptor / Homo sapiens    Q92673
• Cysteine-rich with EGF-like domain protein 2 / Homo sapiens    Q6UXH1
• Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris    P02873
• Lysosomal Pro-X carboxypeptidase / Homo sapiens    P42785
• Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 / Homo sapiens    Q58DX5
• Contactin-2 / Mus musculus    Q61330
• Immunoglobulin j chain / Homo sapiens    P01591
• Integrin beta-5 / Homo sapiens    P18084
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Arylsulfatase B / Homo sapiens    P15848
• Cadherin-10 / Mus musculus    P70408
• Vitellogenin / Cherax quadricarinatus    Q9GSG2
• Reticulocalbin-1 / Mus musculus    Q05186
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Zinc transporter ZIP6 / Homo sapiens    Q13433
• Leishmanolysin c1 / Leishmania mexicana    P43150
• Ribonuclease s-6 / Nicotiana alata    Q40379
• Protocadherin Fat 2 / Mus musculus    Q5F226
• Arylsulfatase a / Homo sapiens    P15289
• Uncharacterized protein from Seed / Phaseolus vulgaris
• Uncharacterized protein from Leaf / Carica papaya
• Alpha-galactosidase A / Homo sapiens    P06280
• Tetratricopeptide repeat protein 17 / Homo sapiens    Q96AE7
• Uncharacterized protein from Floret / Brassica oleracea var. botrytis
• Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus    Q4VA61
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus    Q9Z247
• Protein disulfide-isomerase TMX3 / Mus musculus    Q8BXZ1
• Serum paraoxonase/arylesterase 2 / Mus musculus    Q62086
• Mammaglobin-A / Homo sapiens    Q13296
• Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
• Protein OS-9 / Mus musculus    Q8K2C7
• Neutral cholesterol ester hydrolase 1 / Mus musculus    Q8BLF1
• Amphoterin-induced protein 2 / Homo sapiens    Q86SJ2
• Angiotensin-converting enzyme / Mus musculus    P09470
• Thyroglobulin / Homo sapiens    P01266
• Protein OS-9 / Homo sapiens    Q13438
• V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens    Q7Z7D3
• Protein O-mannosyl-transferase 1 / Mus musculus    Q8R2R1
• Secretogranin-3 / Homo sapiens    Q8WXD2
• Inactive dipeptidyl peptidase 10 / Mus musculus    Q6NXK7
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Lysosome-associated membrane glycoprotein 1 / Mus musculus    P11438
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Integrin beta-1 / Homo sapiens    P05556
• SID1 transmembrane family member 1 / Mus musculus    Q6AXF6
• C-type lectin domain family 4 member A / Mus musculus    Q9QZ15
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Mast/stem cell growth factor receptor Kit / Homo sapiens    P10721
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens    P20645
• Major prion protein / Mus musculus    P04925
• Torsin-1A-interacting protein 1 / Mus musculus    Q921T2
• Knob protein gp70 / Friend murine leukemia virus    P03395
• Serotransferrin / Homo sapiens    P02787
• Tsl-1 antigens / Trichinella spiralis
• Protocadherin-9 / Mus musculus    A0A0A6YY09
• Uromodulin / Homo sapiens    P07911
• Gp120 / Human immunodeficiency virus
• Suppressor of tumorigenicity 14 protein / Homo sapiens    Q9Y5Y6
• Uncharacterized protein C11orf87 homolog / Mus musculus    Q32M26
• Plexin-B2 / Mus musculus    B2RXS4
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens    Q68CP4
• Melanoma inhibitory activity protein 3 / Mus musculus    Q8BI84
• Immunoglobulin y / Coturnix coturnix japonica
• Seipin / Mus musculus    Q9Z2E9
• Endothelin-converting enzyme 1 / Mus musculus    Q4PZA2
• Uncharacterized protein from Fruit / Malus domestica var. golden delicious
• Complement C2 / Homo sapiens    P06681
• Ceramide synthase 6 / Mus musculus    Q8C172
• Fibrillin-1 / Homo sapiens    P35555
• Integrin alpha-2 / Homo sapiens    P17301
• Dickkopf-related protein 3 / Mus musculus    Q9QUN9
• Lysosome-associated membrane glycoprotein 5 / Mus musculus    Q9D387
• Netrin receptor DCC / Mus musculus    P70211
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens    Q6P179
• Phaseolin, beta-type / Phaseolus vulgaris    P02853
• P2X purinoceptor 4 / Homo sapiens    Q99571
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus    P35438
• Hemopexin / Homo sapiens    P02790
• Cerebellin-2 / Mus musculus    Q8BGU2
• Choline transporter-like protein 1 / Mus musculus    Q6X893
• Fibroleukin / Homo sapiens    Q14314
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
• Uncharacterized protein from Hemolymph / Antheraea pernyi
• Alpha-glucosidase / Aspergillus niger    P56526
• Glutamate receptor 2 / Mus musculus    P23819
• Hepatocyte cell adhesion molecule / Mus musculus    Q640R3
• SPARC / Mus musculus    P07214
• Lactadherin / Homo sapiens    Q08431
• Zona pellucida sperm-binding protein matrix / Mus musculus    Q62005    P10761    P20239
• Torsin-1B / Homo sapiens    O14657
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens    O60568
• Prosaposin / Mus musculus    Q61207
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Periostin / Homo sapiens    Q15063
• CUB and sushi domain-containing protein 1 / Mus musculus    Q923L3
• Glucosidase 2 subunit beta / Homo sapiens    P14314
• Lysosomal thioesterase PPT2 / Mus musculus    O35448
• Isoform 2 of Catenin delta-1 / Mus musculus    P30999-2
• Keratin, type II cytoskeletal 8 / Homo sapiens    P05787
• Transmembrane emp24 domain-containing protein 9 / Mus musculus    Q99KF1
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Thrombospondin type-1 domain-containing protein 7B / Mus musculus    Q6P4U0
• Tetraspanin-3 / Homo sapiens    O60637
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens    P22413
• Integrin beta-1 / Mus musculus    P09055
• Serum paraoxonase/arylesterase 2 / Homo sapiens    Q15165
• Transmembrane protein 131 / Mus musculus    O70472
• Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus    Q8BHJ7
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Uncharacterized protein from Seed / Cocos nucifera
• Receptor-type tyrosine-protein phosphatase kappa / Mus musculus    P35822
• Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
• Neural cell adhesion molecule L1-like protein / Mus musculus    P70232
• Prolyl 3-hydroxylase 1 / Homo sapiens    Q32P28
• Cation-independent mannose-6-phosphate receptor / Mus musculus    Q07113
• Retinal-specific ATP-binding cassette transporter / Mus musculus    O35600
• Ig gamma-1 chain c region / Homo sapiens    P01857
• Hyaluronidase-4 / Homo sapiens    Q2M3T9
• Tetraspanin-3 / Mus musculus    Q9QY33
• Neuronal pentraxin-1 / Mus musculus    Q62443
• GPI inositol-deacylase / Mus musculus    Q3UUQ7
• Ig epsilon chain c region / Homo sapiens    P01854
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Integrin beta-3 / Homo sapiens    P05106
• Nuclear pore membrane glycoprotein 210 / Mus musculus    Q9QY81
• Vasorin / Homo sapiens    Q6EMK4
• Uncharacterized protein from Serum / Homo sapiens
• Thyroglobulin / Sus scrofa
• Seipin / Homo sapiens    Q96G97
• Endoplasmin / Homo sapiens    P14625
• Hemagglutinin-neuraminidase / Sendai virus (strain hvj)    P04853
• Lysosomal protective protein / Homo sapiens    P10619
• Immunoglobulin superfamily member 8 / Homo sapiens    Q969P0
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus    P11881-3
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Uncharacterized protein from Seed / Pinus pinea
• Plexin-C1 / Mus musculus    Q9QZC2
• Clusterin / Homo sapiens    P10909
• Serpin H1 / Mus musculus    P19324
• Cobra venom factor / Naja kaouthia    Q91132
• Tumor-associated calcium signal transducer 2 / Homo sapiens    P09758
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Protein NOV homolog / Mus musculus    Q64299
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)    P03393
• Plexin-A2 / Mus musculus    P70207
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Multiple epidermal growth factor-like domains protein 8 / Mus musculus    P60882
• Transmembrane protein 245 / Homo sapiens    Q9H330
• Contactin-associated protein 1 / Mus musculus    O54991
• CUB and sushi domain-containing protein 3 / Mus musculus    Q80T79
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)    P03393
• Protein FAM234B / Mus musculus    Q8BYI8
• Clusterin / Mus musculus    Q06890
• Integrin beta-6 / Homo sapiens    P18564
• Laminin subunit alpha-5 / Mus musculus    Q61001
• Aminopeptidase N / Mus musculus    P97449
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Siglec-8 / Homo sapiens
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Uncharacterized protein from Tuber / Solanum tuberosum
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Uncharacterized protein from Tuber / Allium cepa
• Beta-secretase / Homo sapiens    P56817
• Collagen alpha-1(III) chain / Homo sapiens    P02461
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Sortilin / Mus musculus    Q6PHU5
• Invertase [secreted form] / Saccharomyces cerevisiae
• Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens    P31997    P13688
• Protein kinase C-binding protein NELL2 / Mus musculus    Q61220
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens    O95302
• SUN domain-containing ossification factor / Mus musculus    Q8C341
• Protein FAM171A2 / Homo sapiens    A8MVW0
• Integrin beta-2 / Homo sapiens    P05107
• Glycerophosphodiester phosphodiesterase 1 / Mus musculus    Q9JL56
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Isoform 2 of Adhesion G protein-coupled receptor L2 / Mus musculus    Q8JZZ7-2
• SPARC-like protein 1 / Mus musculus    P70663
• Art v II / Artemisia vulgaris
• Membrane glycoproteins / Spodoptera frugiperda
• Lumican / Homo sapiens    P51884
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Transmembrane protein 106C / Mus musculus    Q80VP8
• Siglec-5 / Homo sapiens
• Collagen alpha-2(I) chain / Homo sapiens    P08123
• Insulin receptor / Homo sapiens    P06213
• Lactotransferrin / Bos taurus    P24627
• Acid ceramidase / Mus musculus    Q9WV54
• Laminin subunit beta-1 / Homo sapiens    P07942
• Integrin beta-8 / Mus musculus    Q0VBD0
• Myeloperoxidase / Homo sapiens    P05164
• SUN domain-containing protein 2 / Mus musculus    Q8BJS4
• Complement c4-a / Homo sapiens    P0C0L4
• Major protein allergan / Olea europaea    P19963
• Uncharacterized protein from Seed / Prunus dulcis var. sativa
• Integrin alpha-6 / Homo sapiens    P23229
• Synaptic vesicle glycoprotein 2A / Mus musculus    Q9JIS5
• Uncharacterized protein from Whole Organism / Trichinella spiralis
• Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus    P22723
• Galectin-3-binding protein / Homo sapiens    Q08380
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• G-protein coupled receptor 98 / Homo sapiens    Q8WXG9
• Immunoglobulin mu / Homo sapiens
• Prorenin / Homo sapiens    P00797
• Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
• Ascorbate oxidase / Acremonium sp
• Mucin / Mus musculus
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Phospholipase D3 / Homo sapiens    Q8IV08
• Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris    P02873
• Uncharacterized protein from Undefined tissue / Agaricus bisporus
• Transmembrane protein 106B / Mus musculus    Q80X71
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens    Q16880
• Nuclear pore membrane glycoprotein 210 / Homo sapiens    Q8TEM1
• Neural cell adhesion molecule 1 / Mus musculus    P13595
• Glutamate receptor ionotropic, kainate 2 / Mus musculus    P39087
• Hemoglobin extracellular / Riftia pachyptila
• Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens    O14672
• Adenosine receptor A1 / Homo sapiens    P30542
• Dopamine beta-hydroxylase / Mus musculus    Q64237
• Dyslexia-associated protein KIAA0319-like protein / Mus musculus    Q8K135
• C-type mannose receptor 2 / Homo sapiens    Q9UBG0
• Pre-B-cell leukemia transcription factor-interacting protein 1 / Mus musculus    Q3TVI8
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
• VIP36-like protein / Mus musculus    P59481
• Transferrin receptor protein 1 / Mus musculus    Q62351
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Fibrillin-3 / Homo sapiens    Q75N90
• Interferon gamma / Homo sapiens    P01579
• Leishmanolysin / Leishmania amazonensis    Q27673
• Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
• Transmembrane and TPR repeat-containing protein 4 / Mus musculus    Q8BG19
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus    Q9Z2L6
• Myelin protein zero-like protein 2 / Homo sapiens    O60487
• Neurofascin / Homo sapiens    O94856
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Tumor necrosis factor receptor superfamily member 5 / Homo sapiens    P25942
• Integrin alpha-M / Homo sapiens    P11215
• Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens    P78324
• Transmembrane protein 62 / Mus musculus    Q8BXJ9
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus    Q91YQ5
• Ribonuclease s-7 / Nicotiana alata    Q40381
• Neurofascin / Mus musculus    Q810U3
• Receptor-type tyrosine-protein phosphatase delta / Mus musculus    Q64487
• Cell cycle control protein 50A / Mus musculus    Q8VEK0
• Thioredoxin domain-containing protein 15 / Mus musculus    Q6P6J9
• Tetraspanin-1 / Homo sapiens    O60635
• Coagulation factor VIII / Sus scrofa    P12263
• Peroxidasin homolog / Homo sapiens    Q92626
• Reelin / Mus musculus    Q60841
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Nicastrin / Mus musculus    P57716
• Hemocyanin / Pontastacus leptodactylus    P83180
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
• Integrin alpha 7 / Mus musculus    Q61738
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus    P62812
• Heat shock 70 kDa protein 13 / Homo sapiens    P48723
• Uncharacterized protein from Fruit / Persea americana
• ER membrane protein complex subunit 1 / Mus musculus    Q8C7X2
• Excitatory amino acid transporter 2 / Mus musculus    P43006
• Zinc transporter ZIP10 / Mus musculus    Q6P5F6
• Trophoblast glycoprotein / Homo sapiens    Q13641
• Cathepsin L1 / Mus musculus    P06797
• MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus    Q0PMG2
• Insulin receptor / Mus musculus    P15208
• Uncharacterized protein from Royal Jelly / Apis mellifera
• Lipase member K / Homo sapiens    Q5VXJ0
• Protein EVI2A / Mus musculus    P20934
• Uncharacterized protein from Seed / Arachis hypogaea
• Sulfatase-modifying factor 1 / Homo sapiens    Q8NBK3
• Mucolipin-3 / Homo sapiens    Q8TDD5
• ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens    Q9BZQ6
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Variant surface glycoprotein mitat 1.4a / Trypansoma brucei    P02896
• Prostaglandin G/H synthase 2 / Homo sapiens    P35354
• Brevican core protein / Mus musculus    Q61361
• UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens    Q9NYU2
• Phospholipase B-like 1 / Homo sapiens    Q6P4A8
• Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus    Q6GQT6
• Cartilage-associated protein / Homo sapiens    O75718
• Prostaglandin g/h synthase 2 / Mus musculus    Q05769
• Cadherin-11 / Mus musculus    P55288
• Carbonic anhydrase 4 / Mus musculus    Q64444
• Uncharacterized protein from Tuber / Apium graveolens var. oulce
• TM2 domain-containing protein 3 / Homo sapiens    Q9BRN9
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Leukemia inhibitory factor receptor / Mus musculus    P42703
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Signal peptide peptidase-like 2A / Homo sapiens    Q8TCT8
• SUN domain-containing protein 2 / Homo sapiens    Q9UH99
• Plexin-B2 / Homo sapiens    O15031
• Leucine zipper protein 2 / Mus musculus    Q8BGY3
• Laminin subunit gamma-1 / Mus musculus    P02468
• P2X purinoceptor 7 / Mus musculus    Q9Z1M0
• UPF0577 protein KIAA1324-like homolog / Mus musculus    Q3UZV7
• Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens    P13674
• Immunoglobulin y / Gallus gallus
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens    P38571
• Apolipoprotein d / Homo sapiens    P05090
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Dystroglycan / Homo sapiens    Q14118
• Protocadherin Fat 1 / Mus musculus    F2Z4A3
• Receptor tyrosine-protein kinase erbB-3 / Homo sapiens    P21860
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus    Q9R0E1
• Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus    O55026
• Fibroblast growth factor receptor / Mus musculus    Q61851
• Glutamate carboxypeptidase 2 / Mus musculus    O35409
• Recombinant plasminogen - [r580e] / Homo sapiens    P00750
• Tenascin / Homo sapiens    P24821
• Aspartyl/asparaginyl beta-hydroxylase / Mus musculus    Q8BSY0    A2AL83
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosomal acid phosphatase / Mus musculus    P24638
• Lysosomal acid phosphatase / Homo sapiens    P11117
• Sialate O-acetylesterase / Homo sapiens    Q9HAT2
• Apolipoprotein b-100 / Homo sapiens    P04114
• HLA class II histocompatibility antigen, DQ alpha 1 chain / Homo sapiens    P01909
• Isoform 2 of Teneurin-3 / Mus musculus    Q9WTS6-2
• Lysosome membrane protein 2 / Mus musculus    O35114
• Uncharacterized protein from Seed / Pisum sativum
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• Lactosylceramide alpha-2,3-sialyltransferase / Mus musculus    O88829
• Cathepsin Z / Homo sapiens    Q9UBR2
• Thrombospondin-3 / Homo sapiens    P49746
• Legumain / Homo sapiens    Q99538
• Carboxypeptidase Q / Homo sapiens    Q9Y646
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Vitronectin / Homo sapiens    P04004
• Uncharacterized protein from Endosperm / Ricinus communis
• Alpha-L-iduronidase / Mus musculus    P48441
• Signal peptide, CUB and EGF-like domain-containing protein 1 / Mus musculus    Q6NZL8
• Nicastrin / Homo sapiens    Q92542
• Complement C4-B / Homo sapiens    P0C0L5
• Pro-neuregulin-2, membrane-bound isoform / Mus musculus    P56974
• Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens    Q13443
• Collagen alpha-2(V) chain / Homo sapiens    P05997
• Endoplasmin / Mus musculus    P08113
• Siglec-7 / Homo sapiens
• HLA class II histocompatibility antigen gamma chain / Homo sapiens    P04233
• Uncharacterized protein from Whole Organism / Caenorhabditis elegans
• Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus    Q9R1V7
• Twisted gastrulation protein homolog 1 / Homo sapiens    Q9GZX9
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Leukocyte surface antigen CD47 / Homo sapiens    Q08722
• Immunoglobulin gamma-2a heavy chain / Mus musculus
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus    P14094
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)    P03393
• Beta-hexosaminidase subunit beta / Homo sapiens    P07686
• Fibronectin / Homo sapiens    P02751
• Testican-2 / Mus musculus    Q9ER58
• Uncharacterized protein from Fruit / Citrus sinensis
• CUB domain-containing protein 1 / Homo sapiens    Q9H5V8
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Protein O-mannose kinase / Homo sapiens    Q9H5K3
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)    P03393
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Follistatin-related protein 1 / Homo sapiens    Q12841
• Prostaglandin-H2 D-isomerase / Mus musculus    O09114
• Semaphorin-3E / Mus musculus    P70275
• Uncharacterized protein from Undefined tissue / Glycine max
• Endopolygalacturonase II / Aspergillus niger    P26214
• Knob protein gp70 / Friend mink cell focus-forming virus
• Melanoma inhibitory activity protein 3 / Homo sapiens    Q5JRA6
• Protein CREG1 / Homo sapiens    O75629
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• C-type mannose receptor 2 / Mus musculus    Q64449
• Melanoma-associated antigen 2 / Homo sapiens    P43356
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Synaptophysin-like protein 1 / Homo sapiens    Q16563
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Uncharacterized protein from Fruit / Carica papaya
• Uncharacterized protein from Seed / Juglans regia
• Uncharacterized protein from Leaf / Arabidopsis thaliana
• Ribonuclease pancreatic [b] / Bos taurus    P61823
• Translocon-associated protein subunit beta / Mus musculus    Q9CPW5
• Hemocyanin / Megathura crenulata    Q10583    Q10584
• Leishmanolysin / Leishmania major    P08148
• Cadherin EGF LAG seven-pass G-type receptor 2 / Mus musculus    Q9R0M0
• Phospholipase D3 / Mus musculus    O35405
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Plexin-B1 / Mus musculus    Q8CJH3
• Zinc finger protein 521 / Mus musculus    Q6KAS7
• Uncharacterized protein from Cotyledon / Ricinus communis
• Uncharacterized protein from Whole Plant / Physomitrella patens
• Iduronate 2-sulfatase / Mus musculus    Q08890
• Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus    Q9CW73
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens    O75503
• Uncharacterized protein from Fruit / Lycopersicon esculentum
• Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus    Q9D6F4
• Palmitoyl-protein thioesterase 1 / Mus musculus    O88531
• Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus    P26049
• Torsin-1A-interacting protein 1 / Homo sapiens    Q5JTV8
• Leishmanolysin / Leishmania tropica    Q8MNZ1
• Probable C-mannosyltransferase DPY19L4 / Mus musculus    A2AJQ3
• N-acetylgalactosamine-6-sulfatase / Homo sapiens    P34059
• Uncharacterized family 31 glucosidase KIAA1161 / Mus musculus    Q69ZQ1
• ATP-binding cassette sub-family A member 2 / Mus musculus    P41234
• Uncharacterized protein from Seed / Corylus avellana
• Interleukin-1 receptor accessory protein-like 1 / Mus musculus    P59823
• Collagen alpha-1(V) chain / Homo sapiens    P20908
• Proenkephalin-A / Mus musculus    P22005
• HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens    P01903
• Lysosomal alpha-glucosidase / Mus musculus    P70699
• Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens    Q96KA5
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus    Q8BXA5
• Trophoblast glycoprotein / Mus musculus    Q9Z0L0
• Beta-galactosidase / Homo sapiens    P16278
• Glutamate receptor 3 / Mus musculus    Q9Z2W9
• Protein sel-1 homolog 1 / Mus musculus    Q9Z2G6
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus    Q6PHS9
• Epidermal growth factor receptor / Homo sapiens    P00533
• Uncharacterized protein from Fruit / Fragaria x ananassa
• Sacsin / Mus musculus    Q9JLC8
• Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens    P55259
• N-acylethanolamine-hydrolyzing acid amidase / Homo sapiens    Q02083
• Cleft lip and palate transmembrane protein 1 / Homo sapiens    O96005
• Cadherin-12 / Mus musculus    Q5RJH3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus    P63137
• Isoform 2 of TM2 domain-containing protein 1 / Mus musculus    Q99MB3-2
• Uncharacterized protein from Root / Daucus carota

Source

• BHK21/13/Py6 (CVCL_LM74)   Kidney (UBERON_0002113)   Plasma Membrane (GO_0005886)  
• Floret (BTO_0000468)  
• Root (BTO_0001188)  
• AH130 (CVCL_4367)   Liver (UBERON_0002107)  
• Zona Pellucida (UBERON_0000086)  
• Coelomic Fluid (UBERON_0036217)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Yolk (GO_0060417)  
• Endosperm (BTO_0000390)  
• Style (BTO_0001313)  
• Kidney (UBERON_0002113)  
• IZD-MB-0503 (CVCL_C411)   Hemocyte (CL_0000387)  
• Leaf (BTO_0000713)  
• Low-Density Lipoprotein Particle (GO_0034362)  
• BHK-21 (CVCL_1914)   Kidney (UBERON_0002113)   Plasma Membrane (GO_0005886)  
• IM4/V/IV-G1 (CVCL_VT68)   Ovary (UBERON_0000992)  
• Lymphocyte (CL_0000542)  
• Pollen (BTO_0001097)  
• Delipidated Cell  
• Allantois (UBERON_0004340)  
• IM4/V/IV-G4 (CVCL_VT71)   Ovary (UBERON_0000992)  
• CHO-DG44 (CVCL_7180)   Ovary (UBERON_0000992)  
• Hemolymph (UBERON_0001011)  
• Submandibular Gland (UBERON_0001736)  
• IM4/V/IV-G3 (CVCL_VT70)   Ovary (UBERON_0000992)  
• Venom (UBERON_0007113)  
• Brain (UBERON_0000955)  
• IM4/V/IV-G5 (CVCL_VT72)   Ovary (UBERON_0000992)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• NRK (CVCL_3758)   Kidney (UBERON_0002113)   Fibroblast (CL_0000057)  
• Urine (UBERON_0001088)  
• Leukocyte (CL_0000738)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Blood (UBERON_0000178)  
• Endothelial Cell of Umbilical Vein (CL_0002618)  
• Royal Jelly  
• Blood Plasma (UBERON_0001969)  
• Cotyledon (BTO_0000300)  
• Placenta (UBERON_0001987)  
• C127 (CVCL_6550)   Mammary Gland (UBERON_0001911)  
• NIH 3T3 (CVCL_0594)   Fibroblast (CL_0000057)  
• Pancreas (UBERON_0001264)  
• NS0 (CVCL_3940)  
• HEK293 (CVCL_0045)   Kidney (UBERON_0002113)  
• BM-N (CVCL_Z633)  
• Ovary (UBERON_0000992)  
• BW5147.PHAR2.7 (CVCL_VT60)   Leukocyte (CL_0000738)  
• Sf21 (CVCL_0518)   Ovary (UBERON_0000992)  
• A-431 (CVCL_0037)   Mammalian Vulva (UBERON_0000997)  
• SPC-Mb-92-C6 (CVCL_VT62)  
• Fruit (BTO_0000486)  
• Tuber (BTO_0001400)  
• BW5147 (CVCL_3896)   Leukocyte (CL_0000738)  
• HEK293T (CVCL_0063)   Kidney (UBERON_0002113)   Plasma Membrane (GO_0005886)  
• Retina (UBERON_0000966)  
• Lec1 (CVCL_3440)   Ovary (UBERON_0000992)  
• Rat1 (CVCL_0492)  
• Seed (BTO_0001226)  
• Egg Cell  
• Thyroid (UBERON_0002046)  
• Blood Serum (UBERON_0001977)  
• CHO (CVCL_0213)   Ovary (UBERON_0000992)  
• IM4/V/IV-G2 (CVCL_VT69)   Ovary (UBERON_0000992)  
• Microsome (GO_0005792)  
• Sf9 (CVCL_0549)   Ovary (UBERON_0000992)  

Reported structure

• N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(?1-?)[Man(?1-?)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-?)[Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-?)"
• N-Linked / High-Mannose / Structure 3542
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
• N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Structure 314
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Structure 3572
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
• N-Linked / High-Mannose / Man(?1-?)[Man(?1-?)]Man(a1-6)[Man(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(?1-?)"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Structure 979
• N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Galf(b1-2)[Man(a1-3)][Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:7 HexNAc:2 (avg mass : 1559.4021 )

Disease

• Hypercholesterolemia, Familial (DOID:13810)
• IgE myeloma (DOID:9538)
• Esophageal cancer (DOID:5041)
• Mannosidosis, alpha (DOID:3413)
• Carcinoma, Squamous cell (DOID:1749)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Myeloma (DOID:0070004)
• Leukemia, Acute lymphoblastic (DOID:9952)
• Lymphoma (DOID:0060058)
• Hyperimmune condition
• Waldenstrom Macroglobulinaemia (DOID:0060901)
• Prostate cancer (DOID:10283)
• Cancer, breast (DOID:1612)
• Erythroleukemia with associated Polycythemia
• Carcinoma, Hepatocellular (DOID:684)
• Healthy

Reported glycosite

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus :
  •        Asn-442
• Dickkopf-related protein 3 / Mus musculus :
  •        Asn-106
• Neuronal growth regulator 1 / Mus musculus :
  •        Asn-67
• Signal-regulatory protein alpha / Mus musculus :
  •        Asn-92
  •        Asn-246
  •        Asn-271
  •        Asn-312
• Lysosomal alpha-mannosidase / Homo sapiens :
  •        Asn-367
  •        Asn-692
  •        Asn-832
• UPF0577 protein KIAA1324-like homolog / Mus musculus :
  •        Asn-715
• Protein FAM234B / Mus musculus :
  •        Asn-239
• Recombinant plasminogen - [r580e] / Homo sapiens :
  •        Undefined site
• Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus :
  •        Asn-590
• Immunoglobulin superfamily member 8 / Mus musculus :
  •        Asn-48
• Leishmanolysin c1 / Leishmania mexicana :
  •        Undefined site
• Neurofascin / Homo sapiens :
  •        Asn-446
  •        Asn-973
• Art v II / Artemisia vulgaris :
  •        Undefined site
• Protocadherin-16 / Mus musculus :
  •        Asn-1989
• Plexin-C1 / Mus musculus :
  •        Asn-86
  •        Asn-717
  •        Asn-877
• Neuroplastin / Mus musculus :
  •        Asn-196
  •        Asn-228
  •        Asn-283
• Ig epsilon chain c region / Homo sapiens :
  •        Asn-275
• Uncharacterized protein from Leaf / Arabidopsis thaliana :
  •        Undefined site
• Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus :
  •        Asn-911
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus :
  •        Asn-236
• Complement c4-a / Homo sapiens :
  •        Asn-226
• Uncharacterized protein from Whole Organism / Trichinella spiralis :
  •        Undefined site
• Contactin-associated protein-like 2 / Mus musculus :
  •        Asn-289
  •        Asn-346
  •        Asn-436
  •        Asn-546
  •        Asn-1117
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus :
  •        Undefined site
• Clusterin / Homo sapiens :
  •        Asn-86
  •        Asn-103
  •        Asn-374
• Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens :
  •        Asn-291
• Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens :
  •        Asn-197
• Plexin-B1 / Mus musculus :
  •        Asn-31
• Mucin-5B / Homo sapiens :
  •        Asn-5046
• Fibrillin-3 / Homo sapiens :
  •        Asn-1025
• Uncharacterized protein from Seed / Vigna radiata var. radiata :
  •        Undefined site
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus :
  •        Asn-295
• Protein OS-9 / Homo sapiens :
  •        Asn-177
• Thyroglobulin / Homo sapiens :
  •        Asn-1365
• Aminopeptidase n / Homo sapiens :
  •        Asn-234
• Uncharacterized protein from Serum / Homo sapiens :
  •        Undefined site
• Neurocan core protein / Mus musculus :
  •        Asn-121
• Hyaluronidase-4 / Homo sapiens :
  •        Asn-368
• Collagen alpha-1(VI) chain / Homo sapiens :
  •        Asn-804
• Leucyl-cystinyl aminopeptidase / Mus musculus :
  •        Asn-145
  •        Asn-215
• Tetratricopeptide repeat protein 17 / Homo sapiens :
  •        Asn-634
• Carboxypeptidase Q / Homo sapiens :
  •        Asn-179
• Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus :
  •        Asn-206
• Uncharacterized protein from Whole Organism / Caenorhabditis elegans :
  •        Undefined site
• Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris :
  •        Undefined site
• Uncharacterized protein from Endosperm / Ricinus communis :
  •        Undefined site
• Ascorbate oxidase / Acremonium sp :
  •        Undefined site
• SUN domain-containing ossification factor / Mus musculus :
  •        Asn-529
• CD166 antigen / Homo sapiens :
  •        Asn-480
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus :
  •        Asn-136
  •        Asn-324
  •        Asn-764
  •        Asn-807
  •        Asn-968
• Fibrillin-1 / Homo sapiens :
  •        Asn-1067
• Neuronal pentraxin-1 / Mus musculus :
  •        Asn-154
  •        Asn-193
• ERO1-like protein alpha / Mus musculus :
  •        Asn-276
• GPI inositol-deacylase / Mus musculus :
  •        Asn-234
  •        Asn-558
• Synaptic vesicle glycoprotein 2A / Mus musculus :
  •        Asn-573
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) :
  •        Undefined site
• Tripeptidyl-peptidase 1 / Mus musculus :
  •        Asn-209
  •        Asn-221
• Protein FAM171A2 / Mus musculus :
  •        Asn-265
• Ceramide synthase 2 / Homo sapiens :
  •        Asn-19
• Coagulation factor VIII / Sus scrofa :
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Asparagus officinalis :
  •        Undefined site
• Transmembrane protein 106C / Mus musculus :
  •        Asn-184
• Semaphorin-3E / Mus musculus :
  •        Asn-126
• Prosaposin / Mus musculus :
  •        Asn-80
  •        Asn-214
  •        Asn-459
• Retinal-specific ATP-binding cassette transporter / Mus musculus :
  •        Asn-1932
• Isoform 2 of TM2 domain-containing protein 1 / Mus musculus :
  •        Asn-92
• Receptor tyrosine-protein kinase erbB-3 / Homo sapiens :
  •        Asn-250
  •        Asn-353
• Epidermal growth factor receptor / Homo sapiens :
  •        Undefined site
  •        Asn-352
  •        Asn-361
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens :
  •        Asn-178
• Uncharacterized protein from Seed / Phaseolus vulgaris :
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera :
  •        Undefined site
• Plexin-A4 / Mus musculus :
  •        Asn-1006
  •        Asn-1179
• Transmembrane prolyl 4-hydroxylase / Mus musculus :
  •        Asn-349
• Uncharacterized protein from Seed / Pistacia vera :
  •        Undefined site
• Tetraspanin-3 / Mus musculus :
  •        Asn-167
• Aminopeptidase N / Mus musculus :
  •        Asn-106
  •        Asn-128
• Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus :
  •        Asn-144
• Phosphatidylcholine-sterol acyltransferase / Mus musculus :
  •        Asn-44
  •        Asn-108
• Leishmanolysin / Leishmania amazonensis :
  •        Undefined site
• Protein sel-1 homolog 1 / Mus musculus :
  •        Asn-427
• Gp55 / Friend spleen focus-forming virus (anemia inducing strain) :
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) :
  •        Undefined site
• CD109 antigen / Homo sapiens :
  •        Undefined site
  •        Asn-247
  •        Asn-337
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei :
  •        Undefined site
• Hypoxia up-regulated protein 1 / Homo sapiens :
  •        Asn-222
  •        Asn-515
  •        Asn-596
  •        Asn-830
  •        Asn-862
  •        Asn-869
  •        Asn-931
• Endopolygalacturonase II / Aspergillus niger :
  •        Undefined site
• Sulfatase-modifying factor 1 / Homo sapiens :
  •        Asn-141
• Fibroblast growth factor receptor / Mus musculus :
  •        Asn-96
• Laminin subunit alpha-5 / Mus musculus :
  •        Asn-3261
  •        Asn-3291
• Glucosidase 2 subunit beta / Homo sapiens :
  •        Asn-476
• Carboxypeptidase D / Homo sapiens :
  •        Asn-811
  •        Asn-867
• Cathepsin L1 / Mus musculus :
  •        Asn-221
• Contactin-1 / Mus musculus :
  •        Asn-457
  •        Asn-593
  •        Asn-935
• Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus :
  •        Asn-128
  •        Asn-246
• Cation-independent mannose-6-phosphate receptor / Mus musculus :
  •        Asn-395
  •        Asn-575
• Endoplasmin / Mus musculus :
  •        Asn-62
  •        Asn-217
  •        Asn-502
• TM2 domain-containing protein 3 / Homo sapiens :
  •        Asn-87
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus :
  •        Asn-551
• Uncharacterized protein from Whole Cell / Kinetoplastids :
  •        Undefined site
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens :
  •        Asn-106
• Ribonuclease s-7 / Nicotiana alata :
  •        Asn-49
• Neuroendocrine convertase 2 / Mus musculus :
  •        Asn-523
• Ig alpha-1 chain c region / Homo sapiens :
  •        Undefined site
  •        Asn-144
  •        Asn-340
• Glutamate receptor ionotropic, kainate 3 / Mus musculus :
  •        Asn-381
• Translocon-associated protein subunit alpha / Mus musculus :
  •        Asn-136
• Cathepsin Z / Homo sapiens :
  •        Asn-184
• Lysosomal protective protein / Homo sapiens :
  •        Asn-145
  •        Asn-333
• Hepatocyte cell adhesion molecule / Mus musculus :
  •        Asn-189
• Pro-neuregulin-2, membrane-bound isoform / Mus musculus :
  •        Asn-186
• Insulin receptor / Homo sapiens :
  •        Asn-541
• Neurofascin / Mus musculus :
  •        Asn-305
  •        Asn-409
  •        Asn-446
  •        Asn-483
  •        Asn-866
• Uncharacterized protein from Fruit / Malus domestica var. golden delicious :
  •        Undefined site
• Heat shock 70 kDa protein 13 / Homo sapiens :
  •        Asn-184
• Metal transporter CNNM4 / Mus musculus :
  •        Asn-119
• Beta-hexosaminidase subunit alpha / Homo sapiens :
  •        Asn-157
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus :
  •        Asn-350
  •        Asn-368
  •        Asn-440
  •        Asn-471
  •        Asn-771
• Melanoma inhibitory activity protein 3 / Homo sapiens :
  •        Asn-250
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens :
  •        Asn-299
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate) :
  •        Undefined site
• Semaphorin-7A / Mus musculus :
  •        Asn-256
• Ephrin-A3 / Mus musculus :
  •        Asn-38
• Nuclear pore membrane glycoprotein 210 / Homo sapiens :
  •        Asn-44
  •        Asn-1441
• Complement c3 / Homo sapiens :
  •        Undefined site
  •        Asn-85
• Phaseolin, alpha-type / Phaseolus vulgaris :
  •        Asn-258
• Epithelial cell adhesion molecule / Homo sapiens :
  •        Asn-111
• G-protein coupled receptor 98 / Homo sapiens :
  •        Asn-3224
• Twisted gastrulation protein homolog 1 / Homo sapiens :
  •        Asn-81
• Uncharacterized protein from Seed / Corylus avellana :
  •        Undefined site
• Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris :
  •        Undefined site
• Isoform 2 of Integrin alpha-3 / Mus musculus :
  •        Asn-606
• Immunoglobulin superfamily member 8 / Homo sapiens :
  •        Asn-327
• Apolipoprotein b-100 / Homo sapiens :
  •        Undefined site
  •        Asn-185
• Uncharacterized protein from Floret / Brassica oleracea var. botrytis :
  •        Undefined site
• Glutamate receptor ionotropic, kainate 2 / Mus musculus :
  •        Asn-378
  •        Asn-751
• Laminin subunit alpha-5 / Homo sapiens :
  •        Asn-95
  •        Asn-2707
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus :
  •        Asn-96
  •        Asn-118
  •        Asn-153
  •        Asn-197
  •        Asn-238
• Tyrosine-protein kinase Mer / Mus musculus :
  •        Asn-202
• Ribonuclease s-3 / Nicotiana alata :
  •        Undefined site
• Cadherin-4 / Mus musculus :
  •        Asn-658
• Cystatin-C / Mus musculus :
  •        Asn-99
• Cysteine-rich with EGF-like domain protein 2 / Homo sapiens :
  •        Asn-251
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus :
  •        Asn-193
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus :
  •        Asn-474
  •        Asn-505
  •        Asn-752
• Oligodendrocyte-myelin glycoprotein / Mus musculus :
  •        Asn-103
  •        Asn-152
• Lipase member K / Homo sapiens :
  •        Asn-271
• Gamma-glutamyl hydrolase / Homo sapiens :
  •        Asn-203
  •        Asn-307
• Siglec-8 / Homo sapiens :
  •        Undefined site
• Leukocyte surface antigen CD47 / Mus musculus :
  •        Asn-61
  •        Asn-109
• Multiple epidermal growth factor-like domains protein 8 / Mus musculus :
  •        Asn-1115
• Dystroglycan / Homo sapiens :
  •        Asn-661
• Uncharacterized protein from Seed / Arachis hypogaea :
  •        Undefined site
• Opioid-binding protein/cell adhesion molecule / Mus musculus :
  •        Asn-70
• Neurocan core protein / Homo sapiens :
  •        Asn-122
• Transmembrane protein 245 / Homo sapiens :
  •        Asn-551
• Hemocyanin / Megathura crenulata :
  •        Undefined site
• Alpha-glucosidase / Aspergillus niger :
  •        Undefined site
• Mucolipin-3 / Homo sapiens :
  •        Asn-205
• Protein OS-9 / Mus musculus :
  •        Asn-177
• Uncharacterized protein from Hemolymph / Antheraea pernyi :
  •        Undefined site
• Integrin beta-2 / Homo sapiens :
  •        Asn-642
• Cation-independent mannose-6-phosphate receptor / Homo sapiens :
  •        Asn-400
  •        Asn-581
  •        Asn-1312
• Uncharacterized protein from Whole Plant / Physomitrella patens :
  •        Undefined site
• Prostaglandin g/h synthase 2 / Mus musculus :
  •        Asn-53
  •        Asn-130
  •        Asn-396
  •        Asn-580
• Phospholipase D3 / Homo sapiens :
  •        Asn-284
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus :
  •        Asn-137
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens :
  •        Asn-641
• Prenylcysteine oxidase 1 / Homo sapiens :
  •        Asn-196
  •        Asn-353
• Collagen alpha-2(I) chain / Homo sapiens :
  •        Asn-1267
• Cadherin-2 / Mus musculus :
  •        Asn-651
• Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens :
  •        Asn-270
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus :
  •        Asn-341
  •        Asn-348
  •        Asn-688
• Probable C-mannosyltransferase DPY19L4 / Mus musculus :
  •        Asn-122
• Collagen alpha-1(I) chain / Homo sapiens :
  •        Asn-1365
• Uncharacterized protein from Tuber / Allium cepa :
  •        Undefined site
• Aspartyl/asparaginyl beta-hydroxylase / Mus musculus :
  •        Asn-102
• Uncharacterized protein from Seed / Pisum sativum :
  •        Undefined site
• Cleft lip and palate transmembrane protein 1 / Homo sapiens :
  •        Asn-295
• Ribonuclease pancreatic [b] / Bos taurus :
  •        Undefined site
  •        Asn-60
• Lysosomal acid phosphatase / Mus musculus :
  •        Asn-167
• Glutamate receptor 1 / Mus musculus :
  •        Asn-363
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens :
  •        Asn-174
  •        Asn-397
• Uromodulin / Homo sapiens :
  •        Undefined site
  •        Asn-275
• Trophoblast glycoprotein / Mus musculus :
  •        Asn-124
• ER membrane protein complex subunit 1 / Mus musculus :
  •        Asn-917
• Galectin-3-binding protein / Homo sapiens :
  •        Asn-69
  •        Asn-398
  •        Asn-551
• Sodium channel subunit beta-1 / Mus musculus :
  •        Asn-93
  •        Asn-135
• Clusterin / Mus musculus :
  •        Asn-327
• Serum paraoxonase/arylesterase 2 / Mus musculus :
  •        Asn-254
• Ig gamma-1 chain c region / Homo sapiens :
  •        Asn-180
• Ceramide synthase 6 / Mus musculus :
  •        Asn-18
• Matrix-remodeling-associated protein 5 / Homo sapiens :
  •        Asn-2203
• Follistatin-related protein 1 / Homo sapiens :
  •        Asn-144
• Netrin receptor DCC / Mus musculus :
  •        Asn-94
• Pre-B-cell leukemia transcription factor-interacting protein 1 / Mus musculus :
  •        Asn-455
• Palmitoyl-protein thioesterase 1 / Homo sapiens :
  •        Asn-197
  •        Asn-212
  •        Asn-232
• Pituitary tumor-transforming gene 1 protein-interacting protein / Homo sapiens :
  •        Asn-54
• Tumor-associated calcium signal transducer 2 / Homo sapiens :
  •        Asn-120
• V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens :
  •        Asn-112
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus :
  •        Undefined site
• Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 / Homo sapiens :
  •        Asn-534
• Adipocyte plasma membrane-associated protein / Homo sapiens :
  •        Asn-160
  •        Asn-196
• Amphoterin-induced protein 2 / Homo sapiens :
  •        Asn-288
• Transmembrane protein 106B / Mus musculus :
  •        Asn-184
• Nucleotide exchange factor SIL1 / Mus musculus :
  •        Asn-197
• Hemopexin / Homo sapiens :
  •        Asn-64
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus :
  •        Asn-104
• Protein EVI2A / Mus musculus :
  •        Asn-55
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens :
  •        Undefined site
• Adhesion G protein-coupled receptor L1 / Mus musculus :
  •        Asn-821
• Uncharacterized protein from Supernatant / Nicotiana tabacum :
  •        Undefined site
• Gamma-glutamyltransferase 7 / Mus musculus :
  •        Asn-198
  •        Asn-523
  •        Asn-586
• Tsl-1 antigens / Trichinella spiralis :
  •        Undefined site
• N-acetylgalactosamine-6-sulfatase / Homo sapiens :
  •        Asn-204
• Group XV phospholipase A2 / Mus musculus :
  •        Asn-289
  •        Asn-398
• Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus :
  •        Undefined site
• CUB and sushi domain-containing protein 1 / Mus musculus :
  •        Asn-1572
  •        Asn-3086
  •        Asn-3386
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus :
  •        Asn-404
• Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus :
  •        Asn-279
• Hemoglobin extracellular / Riftia pachyptila :
  •        Undefined site
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens :
  •        Asn-341
• Cerebellin-2 / Mus musculus :
  •        Asn-110
• Olfactomedin-4 / Homo sapiens :
  •        Asn-352
• Alpha-n-acetylglucosaminidase / Homo sapiens :
  •        Asn-503
• Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens :
  •        Asn-162
• Uncharacterized protein from Root / Daucus carota :
  •        Undefined site
• Neural cell adhesion molecule L1 / Mus musculus :
  •        Asn-293
  •        Asn-478
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens :
  •        Asn-696
• Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus :
  •        Undefined site
• Uncharacterized protein from Fruit / Persea americana :
  •        Undefined site
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus :
  •        Undefined site
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens :
  •        Asn-63
• ER membrane protein complex subunit 10 / Mus musculus :
  •        Asn-182
• Aggrecan core protein / Mus musculus :
  •        Asn-126
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens :
  •        Undefined site
  •        Asn-103
  •        Asn-181
  •        Asn-261
  •        Asn-293
  •        Asn-322
• Neural cell adhesion molecule L1-like protein / Mus musculus :
  •        Asn-476
• Metal transporter CNNM4 / Homo sapiens :
  •        Asn-122
• Cadherin-11 / Mus musculus :
  •        Asn-540
• Thioredoxin domain-containing protein 15 / Mus musculus :
  •        Asn-262
  •        Asn-277
• Adenosine receptor A1 / Homo sapiens :
  •        Asn-159
• BDNF/NT-3 growth factors receptor / Mus musculus :
  •        Asn-95
  •        Asn-121
  •        Asn-241
  •        Asn-338
• Apisin / Apis mellifera :
  •        Undefined site
• Sodium channel subunit beta-4 / Mus musculus :
  •        Asn-113
• Endothelin-converting enzyme 1 / Mus musculus :
  •        Asn-165
• Neuronal pentraxin receptor / Mus musculus :
  •        Asn-42
• Cation-dependent mannose-6-phosphate receptor / Mus musculus :
  •        Asn-58
• Prostaglandin G/H synthase 2 / Homo sapiens :
  •        Asn-130
• Transmembrane glycoprotein NMB / Homo sapiens :
  •        Asn-93
  •        Asn-200
• Uncharacterized protein from Whole Organism / Schistosoma mansoni :
  •        Undefined site
• Laminin subunit gamma-1 / Homo sapiens :
  •        Asn-650
  •        Asn-1205
• Delta and Notch-like epidermal growth factor-related receptor / Mus musculus :
  •        Asn-223
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus :
  •        Undefined site
• Glutamate receptor 2 / Mus musculus :
  •        Asn-256
• Periostin / Homo sapiens :
  •        Asn-599
• Integrin beta-6 / Homo sapiens :
  •        Asn-463
• Transmembrane protein 131 / Mus musculus :
  •        Asn-288
• Erlin-2 / Homo sapiens :
  •        Asn-106
• Thrombospondin-1 / Homo sapiens :
  •        Asn-360
• Inactive dipeptidyl peptidase 10 / Mus musculus :
  •        Asn-749
• Leukocyte surface antigen CD47 / Homo sapiens :
  •        Asn-73
• Translocon-associated protein subunit alpha / Homo sapiens :
  •        Asn-136
  •        Asn-191
• Mannosyl-oligosaccharide glucosidase / Homo sapiens :
  •        Asn-657
• Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens :
  •        Asn-439
• Major prion protein / Mus musculus :
  •        Asn-196
• Uncharacterized protein from Fruit / Lycopersicon esculentum :
  •        Undefined site
• Invertase [secreted form] / Saccharomyces cerevisiae :
  •        Undefined site
• Proenkephalin-A / Mus musculus :
  •        Asn-152
• Membrane glycoproteins / Mamestra brassicae :
  •        Undefined site
• Legumain / Homo sapiens :
  •        Asn-167
• P2X purinoceptor 4 / Homo sapiens :
  •        Asn-184
• Signal peptide, CUB and EGF-like domain-containing protein 1 / Mus musculus :
  •        Asn-780
• Neural cell adhesion molecule 1 / Mus musculus :
  •        Asn-450
• Membralin / Mus musculus :
  •        Asn-180
• SPARC / Mus musculus :
  •        Asn-115
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) :
  •        Undefined site
• Membrane glycoproteins / Bombyx mori :
  •        Undefined site
• Basal cell adhesion molecule / Homo sapiens :
  •        Asn-439
• Lumican / Homo sapiens :
  •        Asn-88
  •        Asn-160
• Uncharacterized protein from Undefined tissue / Agaricus bisporus :
  •        Undefined site
• SUN domain-containing protein 2 / Mus musculus :
  •        Asn-650
• Coagulation factor VIII / Homo sapiens :
  •        Undefined site
• Peroxidasin homolog / Homo sapiens :
  •        Asn-731
  •        Asn-1280
• Complement C1q subcomponent subunit A / Mus musculus :
  •        Asn-146
• Receptor-type tyrosine-protein phosphatase kappa / Mus musculus :
  •        Asn-139
• Dyslexia-associated protein KIAA0319-like protein / Mus musculus :
  •        Asn-889
• Integrin alpha-V / Homo sapiens :
  •        Asn-615
  •        Asn-945
• Galactose-binding lectin / Trimeresurus stejnegeri :
  •        Asn-28
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus :
  •        Asn-627
• Hemagglutinin-neuraminidase / Sendai virus (strain hvj) :
  •        Undefined site
• Tumor necrosis factor receptor superfamily member 5 / Homo sapiens :
  •        Asn-180
• CUB and sushi domain-containing protein 3 / Mus musculus :
  •        Asn-2711
  •        Asn-2932
• Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens :
  •        Asn-113
• Dipeptidyl peptidase 1 / Homo sapiens :
  •        Asn-29
  •        Asn-53
  •        Asn-119
  •        Asn-276
• Prorenin / Homo sapiens :
  •        Undefined site
• Synaptophysin-like protein 1 / Homo sapiens :
  •        Asn-71
• Embigin / Mus musculus :
  •        Asn-62
  •        Asn-70
  •        Asn-118
• Protein CREG1 / Homo sapiens :
  •        Asn-160
• Immunoglobulin gamma-2a heavy chain / Mus musculus :
  •        Undefined site
• Secretogranin-3 / Homo sapiens :
  •        Asn-346
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens :
  •        Asn-452
• Immunoglobulin m / Homo sapiens :
  •        Undefined site
• Brevican core protein / Mus musculus :
  •        Asn-336
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus :
  •        Undefined site
• Siglec-5 / Homo sapiens :
  •        Undefined site
• Integrin alpha-V / Mus musculus :
  •        Asn-74
  •        Asn-615
  •        Asn-869
  •        Asn-941
• L-amino-acid oxidase / Homo sapiens :
  •        Asn-54
  •        Asn-134
• SPARC-like protein 1 / Mus musculus :
  •        Asn-462
• Iduronate 2-sulfatase / Mus musculus :
  •        Asn-117
• Phaseolin, beta-type / Phaseolus vulgaris :
  •        Asn-252
• Lysosomal acid phosphatase / Homo sapiens :
  •        Asn-167
  •        Asn-267
• Neuronal cell adhesion molecule / Mus musculus :
  •        Asn-77
  •        Asn-217
  •        Asn-427
  •        Asn-501
• Lysosome-associated membrane glycoprotein 1 / Mus musculus :
  •        Asn-115
• Uncharacterized protein from Cotyledon / Ricinus communis :
  •        Undefined site
• Lysosomal alpha-glucosidase / Mus musculus :
  •        Asn-140
  •        Asn-470
• Fibronectin / Homo sapiens :
  •        Asn-430
  •        Asn-1236
• Cathepsin D / Homo sapiens :
  •        Asn-134
  •        Asn-263
• Beta-secretase / Homo sapiens :
  •        Undefined site
• Knob protein gp70 / Friend mink cell focus-forming virus :
  •        Undefined site
• Semaphorin-4D / Mus musculus :
  •        Asn-191
• Ig alpha-2 chain c region / Homo sapiens :
  •        Asn-131
  •        Asn-205
• Immunoglobulin y / Gallus gallus :
  •        Undefined site
• Collagen alpha-1(XII) chain / Homo sapiens :
  •        Asn-1763
  •        Asn-2206
  •        Asn-2528
• Endoplasmin / Homo sapiens :
  •        Asn-62
  •        Asn-217
  •        Asn-502
• E3 ubiquitin-protein ligase RNF130 / Mus musculus :
  •        Asn-135
• Major protein allergan / Olea europaea :
  •        Asn-111
• Melanoma inhibitory activity protein 3 / Mus musculus :
  •        Asn-252
  •        Asn-631
• HLA class II histocompatibility antigen gamma chain / Homo sapiens :
  •        Asn-130
• ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens :
  •        Asn-195
• Uncharacterized protein from Seed / Prunus dulcis var. sativa :
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Glycine max :
  •        Undefined site
• Uncharacterized protein from Tuber / Solanum tuberosum :
  •        Undefined site
• Reticulocalbin-1 / Mus musculus :
  •        Asn-47
• Serpin h1 / Homo sapiens :
  •        Undefined site
  •        Asn-120
  •        Asn-125
• Protein FAM171A2 / Homo sapiens :
  •        Asn-265
• Gamma-glutamyl hydrolase / Mus musculus :
  •        Asn-162
• Uncharacterized protein from Fruit / Pyrus communis var. williams :
  •        Undefined site
• HLA class II histocompatibility antigen, DQ alpha 1 chain / Homo sapiens :
  •        Asn-103
• Sortilin-related receptor / Homo sapiens :
  •        Asn-1608
  •        Asn-1854
• Vitronectin / Homo sapiens :
  •        Asn-169
• Cell cycle control protein 50A / Mus musculus :
  •        Asn-297
• Plexin-B2 / Homo sapiens :
  •        Asn-528
  •        Asn-1049
• Uncharacterized protein from Seed / Cocos nucifera :
  •        Undefined site
• ATP-binding cassette sub-family A member 2 / Mus musculus :
  •        Asn-432
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens :
  •        Asn-548
• Protein disulfide-isomerase TMX3 / Mus musculus :
  •        Asn-261
• Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei :
  •        Asn-456
• Sialate O-acetylesterase / Homo sapiens :
  •        Asn-267
• C-type lectin domain family 4 member A / Mus musculus :
  •        Asn-91
• Cobra venom factor / Naja kaouthia :
  •        Undefined site
• Lactosylceramide alpha-2,3-sialyltransferase / Mus musculus :
  •        Asn-235
• Protein NOV homolog / Mus musculus :
  •        Asn-277
• Synaptotagmin-1 / Mus musculus :
  •        Asn-24
• Nicastrin / Homo sapiens :
  •        Asn-264
  •        Asn-506
• Tenascin / Homo sapiens :
  •        Asn-1018
• Plexin-A2 / Mus musculus :
  •        Asn-163
• Integrin alpha-1 / Mus musculus :
  •        Asn-459
  •        Asn-882
  •        Asn-1102
• Variant surface glycoprotein mitat 1.4a / Trypansoma brucei :
  •        Undefined site
• Carbonic anhydrase 4 / Mus musculus :
  •        Asn-214
• Membrane glycoproteins / Spodoptera frugiperda :
  •        Undefined site
• Neutrophil gelatinase-associated lipocalin / Homo sapiens :
  •        Asn-85
• Trophoblast glycoprotein / Homo sapiens :
  •        Asn-124
• Lysosome-associated membrane glycoprotein 5 / Mus musculus :
  •        Asn-127
• Ephrin type-B receptor 3 / Homo sapiens :
  •        Asn-445
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei :
  •        Undefined site
• Uncharacterized protein from Seed / Fagopyrum esculentum :
  •        Undefined site
• Fibrillin-2 / Homo sapiens :
  •        Asn-1112
• Uncharacterized protein from Fruit / Musa acuminata :
  •        Undefined site
• Myelin-associated glycoprotein / Mus musculus :
  •        Asn-99
• Integrin alpha 7 / Mus musculus :
  •        Asn-1042
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus :
  •        Asn-1512
  •        Asn-1559
  •        Asn-1576
  •        Asn-1646
  •        Asn-1764
  •        Asn-1826
  •        Asn-2128
  •        Asn-3840
  •        Asn-3954
  •        Asn-4076
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens :
  •        Asn-443
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens :
  •        Asn-70
  •        Asn-294
  •        Asn-310
  •        Asn-393
  •        Asn-407
• Pre-B-cell leukemia transcription factor-interacting protein 1 / Homo sapiens :
  •        Asn-455
• Transmembrane and TPR repeat-containing protein 4 / Mus musculus :
  •        Asn-497
• Immunoglobulin heavy constant mu / Homo sapiens :
  •        Undefined site
  •        Asn-209
  •        Asn-378
  •        Asn-279 in UniProt (402 in publication)
  •        Asn-440
  •        Asn-440 in UniProt (563 in publication)
• Vasorin / Homo sapiens :
  •        Asn-500
• Collagen alpha-1(III) chain / Homo sapiens :
  •        Asn-1367
• Semaphorin-4A / Mus musculus :
  •        Asn-496
• Integrin beta-8 / Mus musculus :
  •        Asn-402
  •        Asn-456
• Basigin / Mus musculus :
  •        Asn-270
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) :
  •        Undefined site
• Palmitoyl-protein thioesterase 1 / Mus musculus :
  •        Asn-197
  •        Asn-212
  •        Asn-232
• VIP36-like protein / Mus musculus :
  •        Asn-180
• Sortilin / Mus musculus :
  •        Asn-580
• Transmembrane protein 106B / Homo sapiens :
  •        Asn-183
• Mast/stem cell growth factor receptor Kit / Homo sapiens :
  •        Asn-130
• Seipin / Mus musculus :
  •        Asn-88
• Sortilin-related receptor / Mus musculus :
  •        Asn-1608
  •        Asn-1895
  •        Asn-2011
• Beta-hexosaminidase subunit beta / Homo sapiens :
  •        Asn-84
  •        Asn-190
• Siglec-7 / Homo sapiens :
  •        Undefined site
• Torsin-1B / Mus musculus :
  •        Asn-64
• Zinc transporter ZIP10 / Mus musculus :
  •        Asn-191
• Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus :
  •        Asn-83
  •        Asn-439
  •        Asn-501
• Immunoglobulin j chain / Homo sapiens :
  •        Asn-71
• Prolyl 3-hydroxylase 1 / Homo sapiens :
  •        Asn-467
• Hypoxia up-regulated protein 1 / Mus musculus :
  •        Asn-515
  •        Asn-830
  •        Asn-862
  •        Asn-869
  •        Asn-931
• Uncharacterized protein from Seed / Juglans regia :
  •        Undefined site
• Solute carrier family 12 member 5 / Mus musculus :
  •        Asn-314
  •        Asn-351
  •        Asn-362
• Prenylcysteine oxidase / Mus musculus :
  •        Asn-196
  •        Asn-323
• Glutamate carboxypeptidase 2 / Mus musculus :
  •        Asn-640
• Calreticulin / Spinacia oleracea :
  •        Undefined site
• Transmembrane protein 178B / Mus musculus :
  •        Asn-12
• Sulfatase-modifying factor 1 / Mus musculus :
  •        Asn-139
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens :
  •        Asn-57
• Torsin-1B / Homo sapiens :
  •        Asn-64
• N-acetylglucosamine-6-sulfatase / Homo sapiens :
  •        Undefined site
  •        Asn-279
  •        Asn-362
  •        Asn-405
• Uncharacterized protein (gene name abca4) / Bos taurus :
  •        Undefined site
• Uncharacterized protein from Seed / Pinus pinea :
  •        Undefined site
• Laminin subunit gamma-1 / Mus musculus :
  •        Asn-1105
  •        Asn-1203
  •        Asn-1393
• Laminin subunit beta-1 / Homo sapiens :
  •        Asn-677
  •        Asn-1279
• Transmembrane emp24 domain-containing protein 9 / Mus musculus :
  •        Asn-125
• Uncharacterized protein from Undefined tissue / Nicotiana tabacum :
  •        Undefined site
• Lysosomal thioesterase PPT2 / Mus musculus :
  •        Asn-289
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens :
  •        Asn-1575
  •        Asn-1825
  •        Asn-1995
• Collagen alpha-2(V) chain / Homo sapiens :
  •        Asn-1400
• SID1 transmembrane family member 1 / Mus musculus :
  •        Asn-83
• Putative phospholipase B-like 2 / Homo sapiens :
  •        Asn-465
• Stromal interaction molecule 1 / Mus musculus :
  •        Asn-171
• Glucosylceramidase / Homo sapiens :
  •        Asn-58
• Decorin / Homo sapiens :
  •        Asn-211
• Protocadherin-9 / Mus musculus :
  •        Asn-754
• Low-density lipoprotein receptor-related protein 1B / Mus musculus :
  •        Asn-725
  •        Asn-3164
• Ovalbumin / Gallus gallus :
  •        Undefined site
• Sacsin / Mus musculus :
  •        Asn-1911
• Collagen alpha-1(V) chain / Homo sapiens :
  •        Asn-1672
• Probable lysosomal cobalamin transporter / Homo sapiens :
  •        Asn-78
• Complement C4-B / Homo sapiens :
  •        Asn-226
• Integrin alpha-6 / Homo sapiens :
  •        Asn-323
  •        Asn-966
• Structural glycoprotein / Marburg virus (strain musoke) :
  •        Undefined site
• Integrin alpha-2 / Homo sapiens :
  •        Asn-1074
• Pro-epidermal growth factor / Homo sapiens :
  •        Asn-104
• Collagen alpha-2(VI) chain / Homo sapiens :
  •        Asn-140
  •        Asn-785
• Serotransferrin / Homo sapiens :
  •        Undefined site
• Cadherin-10 / Mus musculus :
  •        Asn-534
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) :
  •        Undefined site
• Ribonuclease s-6 / Nicotiana alata :
  •        Undefined site
• CD166 antigen / Mus musculus :
  •        Asn-480
• Arylsulfatase a / Homo sapiens :
  •        Undefined site
• N-acylethanolamine-hydrolyzing acid amidase / Homo sapiens :
  •        Asn-37
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens :
  •        Asn-140
• Tetraspanin-3 / Homo sapiens :
  •        Asn-167
• Hemocyanin / Pontastacus leptodactylus :
  •        Undefined site
• Integrin beta-3 / Homo sapiens :
  •        Asn-680
• Beta-galactosidase / Homo sapiens :
  •        Asn-247
  •        Asn-464
• Leishmanolysin / Leishmania tropica :
  •        Undefined site
• Alpha-n-acetylgalactosaminidase / Homo sapiens :
  •        Undefined site
  •        Asn-124
• Carcinoembryonic antigen-related cell adhesion molecule 1 or 5 / Homo sapiens :
  •        Asn-378
  •        Asn-553
• Arylphorin / Antheraea pernyi :
  •        Undefined site
• Erlin-1 / Homo sapiens :
  •        Asn-106
• Zona pellucida sperm-binding protein matrix / Mus musculus :
  •        Undefined site
• Seipin / Homo sapiens :
  •        Asn-88
• Neuronal cell adhesion molecule / Homo sapiens :
  •        Asn-223
• Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens :
  •        Asn-381
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus :
  •        Asn-548
• ATP-binding cassette sub-family A member 7 / Mus musculus :
  •        Asn-1471
  •        Asn-1532
• Thy-1 membrane glycoprotein / Mus musculus :
  •        Asn-42
  •        Asn-94
• Desmocollin-2 / Homo sapiens :
  •        Asn-546
  •        Asn-629
• Leucine-rich repeat-containing protein 55 / Mus musculus :
  •        Asn-82
• Protocadherin Fat 2 / Mus musculus :
  •        Asn-2183
• Neutral cholesterol ester hydrolase 1 / Mus musculus :
  •        Asn-270
• Uncharacterized protein from Mononuclear Leukocyte / Mus musculus :
  •        Undefined site
• Integrin beta-1 / Homo sapiens :
  •        Asn-50
  •        Asn-212
  •        Asn-520
  •        Asn-669
• Zinc finger protein 521 / Mus musculus :
  •        Asn-763
• Apolipoprotein d / Homo sapiens :
  •        Asn-65
• Semaphorin-4D / Homo sapiens :
  •        Asn-419
• Uncharacterized protein from Fruit / Carica papaya :
  •        Undefined site
• Protein kinase C-binding protein NELL2 / Mus musculus :
  •        Asn-56
• Plexin-B2 / Mus musculus :
  •        Asn-761
  •        Asn-1005
  •        Asn-1072
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens :
  •        Asn-274
• Interferon beta / Mus musculus :
  •        Undefined site
• Thrombospondin-3 / Homo sapiens :
  •        Asn-407
• CUB domain-containing protein 1 / Homo sapiens :
  •        Asn-310
  •        Asn-512
• Leishmanolysin / Leishmania major :
  •        Undefined site
• Uncharacterized protein from Leaf / Arabidopsis thaliana :
  •        Undefined site
• Zinc transporter ZIP6 / Homo sapiens :
  •        Asn-266
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens :
  •        Asn-78
  •        Asn-333
  •        Asn-442
• Excitatory amino acid transporter 2 / Mus musculus :
  •        Asn-205
• Acid ceramidase / Mus musculus :
  •        Asn-341
  •        Asn-347
• Uncharacterized protein C11orf87 homolog / Mus musculus :
  •        Asn-26
• Leishmanolysin / Leishmania donovani :
  •        Undefined site
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus :
  •        Asn-91
  •        Asn-101
  •        Asn-230
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus :
  •        Asn-2502
• Collagen alpha-3(VI) chain / Homo sapiens :
  •        Asn-3037
• Cathepsin D / Mus musculus :
  •        Asn-134
  •        Asn-261
• Dopamine beta-hydroxylase / Mus musculus :
  •        Asn-570
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens :
  •        Asn-197
  •        Asn-538
• Isoform 2 of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 / Mus musculus :
  •        Asn-330
• Transmembrane protein 87A / Homo sapiens :
  •        Asn-62
• Lipase member J / Homo sapiens :
  •        Asn-240
• Gp120 / Human immunodeficiency virus :
  •        Undefined site
• Reelin / Mus musculus :
  •        Asn-3016
• HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens :
  •        Asn-143
• T-cell surface antigen cd2 / Homo sapiens :
  •        Undefined site
• Integrin beta-1 / Mus musculus :
  •        Asn-669
• Integrin alpha-M / Homo sapiens :
  •        Asn-391
  •        Asn-900
  •        Asn-1044
• C-type mannose receptor 2 / Mus musculus :
  •        Asn-1133
• Transferrin receptor protein 1 / Homo sapiens :
  •        Asn-727
• Protein sel-1 homolog 1 / Homo sapiens :
  •        Asn-195
  •        Asn-608
• Alpha-amylase / Oryza sativa :
  •        Undefined site
• Acid ceramidase / Homo sapiens :
  •        Asn-259
  •        Asn-286
  •        Asn-342
• Cadherin-13 / Mus musculus :
  •        Asn-638
• Nuclear pore membrane glycoprotein 210 / Mus musculus :
  •        Asn-1135
  •        Asn-1441
• Transmembrane emp24 domain-containing protein 4 / Mus musculus :
  •        Asn-117
• Contactin-2 / Mus musculus :
  •        Asn-78
• Heat shock 70 kDa protein 13 / Mus musculus :
  •        Asn-184
• SUN domain-containing protein 2 / Homo sapiens :
  •        Asn-636
• Dipeptidyl peptidase 2 / Homo sapiens :
  •        Asn-315
  •        Asn-428
• UPF0577 protein KIAA1324 / Homo sapiens :
  •        Asn-672
  •        Asn-717
• Contactin-associated protein 1 / Mus musculus :
  •        Asn-500
  •        Asn-519
  •        Asn-764
  •        Asn-805
  •        Asn-1148
• Myelin protein zero-like protein 2 / Homo sapiens :
  •        Asn-118
• Translocon-associated protein subunit beta / Mus musculus :
  •        Asn-88
  •        Asn-104
• Transferrin receptor protein 1 / Mus musculus :
  •        Asn-725
  •        Asn-730
• Uncharacterized protein from Fruit / Fragaria x ananassa :
  •        Undefined site
• Arylsulfatase B / Homo sapiens :
  •        Asn-426
• Uncharacterized family 31 glucosidase KIAA1161 / Mus musculus :
  •        Asn-455
• Leucine zipper protein 2 / Mus musculus :
  •        Asn-301
• Suppressor of tumorigenicity 14 protein / Homo sapiens :
  •        Asn-772
• Translocon-associated protein subunit beta / Homo sapiens :
  •        Asn-88
  •        Asn-104
• Cartilage intermediate layer protein 1 / Homo sapiens :
  •        Asn-550
  •        Asn-631
• Interferon gamma / Homo sapiens :
  •        Undefined site
• Mucin / Mus musculus :
  •        Undefined site
• Lysosome membrane protein 2 / Mus musculus :
  •        Asn-122
• C-type mannose receptor 2 / Homo sapiens :
  •        Asn-497
• BTB/POZ domain-containing protein 17 / Mus musculus :
  •        Asn-61
  •        Asn-307
• Keratin, type II cytoskeletal 8 / Homo sapiens :
  •        Asn-408
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens :
  •        Asn-273
• Protein O-mannosyl-transferase 1 / Mus musculus :
  •        Asn-471
• Phospholipase D3 / Mus musculus :
  •        Asn-282
  •        Asn-385
• Choline transporter-like protein 1 / Mus musculus :
  •        Asn-134
• Transmembrane protein 62 / Mus musculus :
  •        Asn-223
• Platelet glycoprotein IV / Bos taurus :
  •        Undefined site
• Testican-2 / Mus musculus :
  •        Asn-225
• Angiotensin-converting enzyme / Mus musculus :
  •        Asn-514
  •        Asn-719
• Signal peptide peptidase-like 2A / Homo sapiens :
  •        Asn-149
• Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei :
  •        Undefined site
• Tissue-type plasminogen activator / Homo sapiens :
  •        Undefined site
• Cadherin-12 / Mus musculus :
  •        Asn-537
• Protein O-glucosyltransferase 1 / Mus musculus :
  •        Asn-204
• Endoplasmic reticulum aminopeptidase 2 / Homo sapiens :
  •        Asn-85
  •        Asn-219
• Niemann-Pick C1 protein / Homo sapiens :
  •        Asn-222
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus :
  •        Asn-174
• Microfibril-associated glycoprotein 4 / Homo sapiens :
  •        Asn-87
• UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens :
  •        Asn-269
• V-type proton ATPase subunit S1 / Mus musculus :
  •        Asn-255
  •        Asn-267
• Lysosomal alpha-glucosidase / Homo sapiens :
  •        Asn-470
• Nicastrin / Mus musculus :
  •        Asn-44
  •        Asn-434
  •        Asn-529
• Uncharacterized protein from Fruit / Actinidia chinensis :
  •        Undefined site
• Receptor tyrosine-protein kinase erbB-2 / Homo sapiens :
  •        Asn-259
  •        Asn-530
• Isoform 2 of Teneurin-3 / Mus musculus :
  •        Asn-860
• Thrombospondin type-1 domain-containing protein 4 / Mus musculus :
  •        Asn-441
• Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans :
  •        Undefined site
• T-cell surface glycoprotein cd4 / Homo sapiens :
  •        Undefined site
• N-acetylglucosamine-6-sulfatase / Mus musculus :
  •        Asn-354
• Von willebrand factor / Homo sapiens :
  •        Undefined site
• Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus :
  •        Asn-140
• Serpin H1 / Mus musculus :
  •        Asn-124
• Integrin beta-2 / Mus musculus :
  •        Asn-626
  •        Asn-644
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster :
  •        Undefined site
• Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens :
  •        Asn-229
• Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus :
  •        Asn-145
• Protein O-mannose kinase / Homo sapiens :
  •        Asn-67
• Calreticulin / Homo sapiens :
  •        Asn-344
• Interleukin-1 receptor accessory protein-like 1 / Mus musculus :
  •        Asn-213
• Insulin receptor / Mus musculus :
  •        Asn-242
  •        Asn-910
• Uncharacterized protein from Tuber / Apium graveolens var. oulce :
  •        Undefined site
• MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus :
  •        Asn-307
• Receptor-type tyrosine-protein phosphatase delta / Mus musculus :
  •        Asn-724
• Protocadherin Fat 1 / Mus musculus :
  •        Asn-41
  •        Asn-2327
• Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus :
  •        Asn-72
• Basigin / Homo sapiens :
  •        Asn-268
• Fibroleukin / Homo sapiens :
  •        Asn-263
• Immunoglobulin mu / Homo sapiens :
  •        Undefined site
• Glycerophosphodiester phosphodiesterase 1 / Mus musculus :
  •        Asn-168
  •        Asn-198
• G-protein coupled receptor 56 / Mus musculus :
  •        Asn-234
• Complement C2 / Homo sapiens :
  •        Asn-621
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus :
  •        Asn-517
• Low-density lipoprotein receptor-related protein 2 / Homo sapiens :
  •        Asn-4068
• Prostaglandin-H2 D-isomerase / Mus musculus :
  •        Asn-51
• Lactadherin / Homo sapiens :
  •        Asn-238
• Uncharacterized protein from Leaf / Carica papaya :
  •        Undefined site
• Myeloperoxidase / Homo sapiens :
  •        Asn-323
• Isoform 2 of Catenin delta-1 / Mus musculus :
  •        Asn-434
• Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus :
  •        Asn-1345
• Immunoglobulin y / Coturnix coturnix japonica :
  •        Undefined site
• P2X purinoceptor 7 / Mus musculus :
  •        Asn-202
• Vitellogenin / Cherax quadricarinatus :
  •        Undefined site
• Uncharacterized protein from Fruit / Citrus sinensis :
  •        Undefined site
• Attractin / Mus musculus :
  •        Asn-415
  •        Asn-427
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens :
  •        Asn-197
• Leukemia inhibitory factor receptor / Mus musculus :
  •        Asn-476
• Extracellular sulfatase Sulf-1 / Homo sapiens :
  •        Asn-111
  •        Asn-197
• Cadherin-18 / Mus musculus :
  •        Asn-536
• Teneurin-2 / Mus musculus :
  •        Asn-915
  •        Asn-1702
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens :
  •        Asn-49
  •        Asn-58
  •        Asn-242
  •        Asn-275
  •        Asn-300
  •        Asn-356
• Signal-regulatory protein beta-1 isoform 3 / Homo sapiens :
  •        Asn-269
• Torsin-1A-interacting protein 1 / Mus musculus :
  •        Asn-411
• Zinc-alpha-2-glycoprotein / Homo sapiens :
  •        Asn-128
• Alpha-1-antichymotrypsin / Homo sapiens :
  •        Asn-106
  •        Asn-127
• V-type proton ATPase subunit S1 / Homo sapiens :
  •        Asn-273
• Claudin domain-containing protein 1 / Mus musculus :
  •        Asn-72
• Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus :
  •        Asn-64
• HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens :
  •        Asn-48
• Torsin-1A-interacting protein 1 / Homo sapiens :
  •        Asn-399
• Thrombospondin type-1 domain-containing protein 7B / Mus musculus :
  •        Asn-1457
• Knob protein gp70 / Friend murine leukemia virus :
  •        Asn-410
• Cartilage-associated protein / Homo sapiens :
  •        Asn-363
• Lactotransferrin / Bos taurus :
  •        Undefined site
  •        Asn-252
  •        Asn-564
• Melanoma-associated antigen 2 / Homo sapiens :
  •        Asn-76
• Cadherin EGF LAG seven-pass G-type receptor 2 / Mus musculus :
  •        Asn-1566
  •        Asn-2062
• Phospholipase B-like 1 / Homo sapiens :
  •        Asn-71
  •        Asn-366
  •        Asn-411
• Procollagen galactosyltransferase 1 / Homo sapiens :
  •        Asn-96
• Alpha-galactosidase A / Homo sapiens :
  •        Asn-192
• Mammaglobin-A / Homo sapiens :
  •        Asn-53
• Thyroglobulin / Sus scrofa :
  •        Undefined site
• Lysosomal Pro-X carboxypeptidase / Homo sapiens :
  •        Asn-47
  •        Asn-415
• Ephrin type-a receptor 2 / Homo sapiens :
  •        Asn-435
• Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus :
  •        Asn-63
  •        Asn-163
• Glutamate receptor 3 / Mus musculus :
  •        Asn-260
• Low-density lipoprotein receptor-related protein 1B / Homo sapiens :
  •        Asn-1983
• Integrin beta-5 / Homo sapiens :
  •        Asn-586
• Serum paraoxonase/arylesterase 2 / Homo sapiens :
  •        Asn-254
  •        Asn-311
  •        Asn-323
  •        Asn-344
• Alpha-L-iduronidase / Mus musculus :
  •        Asn-362
• Prosaposin / Homo sapiens :
  •        Asn-332
  •        Asn-426
• Tetraspanin-1 / Homo sapiens :
  •        Asn-141
  •        Asn-154
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus :
  •        Asn-300
• Receptor tyrosine-protein kinase erbB-3 / Mus musculus :
  •        Asn-250
• Isoform 2 of Adhesion G protein-coupled receptor L2 / Mus musculus :
  •        Asn-817

Mass spectrometry validated peptide

• QYNSTNMGLWR (11aa)
  •    M0QWJ9    Asn-12
• FWLPHNVTWADLK (13aa)
  •    Q8C172    Asn-18
• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19
• VSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSK (40aa)
  •    P46096    Asn-24
• TFASHNASGGSSAGLR (16aa)
  •    Q32M26    Asn-26
• DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
  •    P53634    Asn-29
• SPLPAAFTANGTHLQHLAR (19aa)
  •    Q8CJH3    Asn-31
• FNVSIDSVPEIR (12aa)
  •    Q02083    Asn-37
• HAVYWNSSNQHLR (13aa)
  •    O08545    Asn-38
• LEPTPPIQFTHFQYNVTVHENSAAK (25aa)
  •    F2Z4A3    Asn-41
• ALPGGTDNASAASAAGGSGPQR (22aa)
  •    Q99J85    Asn-42
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• VNFTIEASEGCYR (13aa)
  •    Q8TEM1    Asn-44
• AELSNHTRPVILVPGCLGNR (20aa)
  •    P16301    Asn-44
• KIYIPLNK (8aa)
  •    P57716    Asn-44
• KNYSVLYFQQK (11aa)
  •    P42785    Asn-47
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q05186    Asn-47
• QECYAFNGTQR (11aa)
  •    P04440    Asn-48
• VAGTAVSISCNVSDYEGPAQQDFEWFMYRPEAPATSLGIVSTK (43aa)
  •    Q8R366    Asn-48
• WQMNFTVR (8aa)
  •    P13473    Asn-49
• SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
  •    P05556    Asn-50
• WYSAGLASNSSWFR (14aa)
  •    O09114    Asn-51
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53
• NVSCLW (6aa)
  •    P53801    Asn-54
• TCEECIKNVSCIWCNTNK (18aa)
  •    P53801    Asn-54
• NVSCLWCNTNK (11aa)
  •    P53801    Asn-54
• VVTWGINR (8aa)
  •    Q96RQ9    Asn-54
• HPSDNNTNLVTPAVGHK (17aa)
  •    P20934    Asn-55
• QVPGLHNGTK (10aa)
  •    Q61220    Asn-56
• LKPLFNK (7aa)
  •    P20645    Asn-57
• SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
  •    P04062    Asn-58
• LRPLFNK (7aa)
  •    P24668    Asn-58
• YETTNK (6aa)
  •    P13473    Asn-58
• QGNASDVILR (10aa)
  •    Q9DB72    Asn-61
• WKLNK (5aa)
  •    Q61735    Asn-61
• EEEAIQLDGLNASQIR (16aa)
  •    P14625    Asn-62
• EEEAIQLDGLNASQIR (16aa)
  •    P08113    Asn-62
• TDDEVVQREEEAIQIDGINASQIR (24aa)
  •    P14625    Asn-62
• NTTIFLK (7aa)
  •    Q8NBN3    Asn-62
• TDDEVVQREEEAIQLDGLNASQIR (24aa)
  •    P08113    Asn-62
• EGSRTDDEVVQREEEAIQLDGLNASQIR (28aa)
  •    P08113    Asn-62
• SCNISVTEK (9aa)
  •    P21995    Asn-62
• NAPLVNVTLYYEALCGGCR (19aa)
  •    P13284    Asn-63
• APLVNVTLYYEALCGGCR (18aa)
  •    P13284    Asn-63
• SNAPIVNVTIYYEAICGGCR (20aa)
  •    P13284    Asn-63
• HAPDIPDDSTDNITIFTR (18aa)
  •    P26049    Asn-63
• EERPINASAIK (11aa)
  •    O14657    Asn-64
• WPADKENDTGIVGQHSSCDVR (21aa)
  •    O55026    Asn-64
• FTECCHEERPLNTSALK (17aa)
  •    Q9ER41    Asn-64
• ATTLDDNGTMLFFKGE (16aa)
  •    P02790    Asn-64
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65
• NCSPWLSCEELR (12aa)
  •    Q9H5K3    Asn-67
• GAWLNR (6aa)
  •    Q80Z24    Asn-67
• AIGFENATQAIGR (13aa)
  •    Q08380    Asn-69
• YHYNGTFEDGKK (12aa)
  •    Q96AY3    Asn-70
• YHYNGTFEDGK (11aa)
  •    Q96AY3    Asn-70
• SNVSVEENVILEKPSHVELK (20aa)
  •    P21995    Asn-70
• VAWLNR (6aa)
  •    G5E8G3    Asn-70
• NGDAYGFYNNSVK (13aa)
  •    Q6P4A8    Asn-71
• GQTEIQVNCPPAVTENK (17aa)
  •    Q16563    Asn-71
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71
• GAAAPSAPHWNETAEK (16aa)
  •    Q9R1V7    Asn-72
• YNGSLGLWR (9aa)
  •    Q9CQX5    Asn-72
• DIYTFDGAINK (11aa)
  •    Q08722    Asn-73
• GRDIYTFDGAINK (13aa)
  •    Q08722    Asn-73
• ANTTQPGIVEGGQVLK (16aa)
  •    P43406    Asn-74
• NYTLWR (6aa)
  •    P43356    Asn-76
• NYTLWR (6aa)
  •    Q9UBR2    Asn-184
• NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK (31aa)
  •    Q810U4    Asn-77
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78
• MNGTEMNLEPGSR (13aa)
  •    Q61330    Asn-78
• YPGIFNSTTSDAFIQSK (17aa)
  •    Q16880    Asn-78
• STNHEPSEMSNR (12aa)
  •    Q8BGU2    Asn-110
• DNATQEEILHYLEK (14aa)
  •    Q61207    Asn-80
• TVLTPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85
• NYSDTPPTSK (10aa)
  •    Q9GZX9    Asn-81
• NLSLAHNR (8aa)
  •    Q3UY51    Asn-82
• KCLANGSWTDMDTPSR (16aa)
  •    Q9WV18    Asn-83
• VHVNSSSDNLDYPVLVVVR (19aa)
  •    Q6AXF6    Asn-83
• MTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFR (35aa)
  •    P07686    Asn-84
• MTPNIIHIAPENFYISHSPNSTAGPSCTIIEEAFRR (36aa)
  •    P07686    Asn-84
• IPSVVIPIHYDIFVHPNITSIDFVASEK (28aa)
  •    Q6P179    Asn-85
• HMGNVTFTIPANR (13aa)
  •    P01024    Asn-85
• TVLTPATNHMGNVTF (15aa)
  •    P01024    Asn-85
• TVITPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85
• TNHMGNVTFTIPANR (15aa)
  •    P01024    Asn-85
• TVLTPATNHMGNVTFTIPANREFK (24aa)
  •    P01024    Asn-85
• SYNVTSVIFR (10aa)
  •    P80188    Asn-85
• DQAGNCTEPVSLAPPAR (17aa)
  •    Q9QZC2    Asn-86
• DQAGNCTEPVSLAPPARPRPGSSFSK (26aa)
  •    Q9QZC2    Asn-86
• KEDALNETR (9aa)
  •    P10909    Asn-86
• FNGSVSFFR (9aa)
  •    P55083    Asn-87
• LPADCIDCTTNFSCTYGK (18aa)
  •    Q9BRN9    Asn-87
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88
• IAPASNVSH (9aa)
  •    P43308    Asn-88
• IAPASNVSHTVVIRPIK (17aa)
  •    P43308    Asn-88
• TDCDSSTTSICSFPVANVSITK (22aa)
  •    Q96G97    Asn-88
• IAPASNVSHTVVLRPLK (17aa)
  •    Q9CPW5    Asn-88
• TDCDSSTASLCSFPVANVSLAK (22aa)
  •    Q9Z2E9    Asn-88
• NIMHNELNCTK (11aa)
  •    Q9QZ15    Asn-91
• TVNVSVPKK (9aa)
  •    Q8BXA5    Asn-91
• DLSGNETHFTGSEVGFLKPISCR (23aa)
  •    Q99MB3-2    Asn-92
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92
• VQAVLTSDSPALVGSNITF (19aa)
  •    Q14956    Asn-93
• VQAVLTSDSPALVGSNITFAVNLIFPR (27aa)
  •    Q14956    Asn-93
• VVWNGSR (7aa)
  •    P97952    Asn-93
• KQQLPNGSLLIQNILHSR (18aa)
  •    P70211    Asn-94
• VLTLANFTTK (10aa)
  •    P01831    Asn-94
• IVGGPVAGGDPNQTIR (16aa)
  •    O15230    Asn-95
• NLTIVDSGLK (10aa)
  •    P15209    Asn-95
• TAIWVATDHNMDNTSTVIR (19aa)
  •    Q8NBJ5    Asn-96
• LQVLNASHEDAGVYSCQHR (19aa)
  •    Q61851    Asn-96
• TENLDVIVNISDTESWGQHVQK (22aa)
  •    P14231    Asn-96
• SQTNLTDCPFHDQPHLMR (18aa)
  •    P21460    Asn-99
• NCTLLLSTLSPELGGK (16aa)
  •    P20917    Asn-99
• LLGDLGLRNCTLLLSTLSPELGGK (24aa)
  •    P20917    Asn-99
• NNGTLYAYIFLHHAGILPWQDGK (23aa)
  •    Q8BXA5    Asn-101
• YNLSEVLQGK (10aa)
  •    Q8BSY0    Asn-102
  •    A2AL83    Asn-102
• RYNSTAATNEVPEVTVFSK (19aa)
  •    P01909    Asn-103
  •    VAR_050384   102:S→Y   dbSNP:rs1129808
• SLWNMSAANNNIK (13aa)
  •    Q63912    Asn-103
• TLTLNFTR (8aa)
  •    P11279    Asn-103
• GHTITINFTR (10aa)
  •    P11279    Asn-103
• GHTLTLNFT (9aa)
  •    P11279    Asn-103
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104
• RLSYNVIPLNLTLDNR (16aa)
  •    P63137    Asn-104
• LSYNVIPLNLTLDNR (15aa)
  •    P63137    Asn-104
• AGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQR (38aa)
  •    Q9CPW5    Asn-104
• VFLNGSR (7aa)
  •    P01133    Asn-104
• NYTADYDK (8aa)
  •    O94905    Asn-106
• NYTADYDK (8aa)
  •    O75477    Asn-106
• SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
  •    P04844    Asn-106
• VILRPYLTPNNQGLYIFQGNSTVR (24aa)
  •    P97449    Asn-106
• FNITETSEAEIHQSFQHIIR (20aa)
  •    P01011    Asn-106
• VGNNTVHVHQEVHK (14aa)
  •    Q9QUN9    Asn-106
• IVYNHSSGR (9aa)
  •    P16301    Asn-108
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109
• YVHNHNVYTNNENCSSPSWQAMHEPR (26aa)
  •    Q8IWU6    Asn-111
• QCNGTSMCWCVNTAGVR (17aa)
  •    P16422    Asn-111
• TAVFADQVIVGNASLR (16aa)
  •    Q7Z7D3    Asn-112
• ANATIEVK (8aa)
  •    P97300    Asn-228
• DMSDGFISNITIQR (14aa)
  •    P13674    Asn-113
• TNNISILLSDLEFSDTGR (18aa)
  •    Q7M729    Asn-113
• EKTNNISILLSDLEFSDTGR (20aa)
  •    Q7M729    Asn-113
• YSVQHMYFTYNLSDTEHFPNAISK (24aa)
  •    P11438    Asn-115
• VCSNDNKTFDSSCHFFATK (19aa)
  •    P07214    Asn-115
• VHSGNFSTIPQYFK (14aa)
  •    Q08890    Asn-117
• FTFTSHTPGDHQICLHSNSTR (21aa)
  •    Q8R1V4    Asn-117
• IQFDDNGTYTCQVK (14aa)
  •    O60487    Asn-118
• KDDEPLETTGDFNTTK (16aa)
  •    P21995    Asn-118
• FLEPYNDSIQAQKNDVCRPGR (21aa)
  •    P14231    Asn-118
• FLEPYNDSIQAQK (13aa)
  •    P14231    Asn-118
• VTTYCNETMTGWVHDVLG (18aa)
  •    P53634    Asn-119
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119
• LVNVSR (6aa)
  •    Q69ZF7    Asn-119
• QCNQTSVCWCVNSVGVR (17aa)
  •    P09758    Asn-120
• SISNSTAR (8aa)
  •    P50454    Asn-120
• ANATLLLGPLR (11aa)
  •    O14594    Asn-122
• HINFTR (6aa)
  •    P15209    Asn-121
• HRANATLLLGPLR (13aa)
  •    P55066    Asn-121
• DIVVQQIVNVSR (12aa)
  •    Q6P4Q7    Asn-122
• AYVFERNQSVGDPNVDLIR (19aa)
  •    O35114    Asn-122
• NQSVGDPNVDLIR (13aa)
  •    O35114    Asn-122
• GVYELTHNNK (10aa)
  •    A2AJQ3    Asn-122
• RPPLAELAALNLSGSR (16aa)
  •    Q13641    Asn-124
• NVTWK (5aa)
  •    P19324    Asn-124
• LGIYADMGNFTCMGYPGTTLDK (22aa)
  •    P17050    Asn-124
• QPPLADLEALNLSGNHLK (18aa)
  •    Q9Z0L0    Asn-124
• FTFTSHTPGEHQICLHSNSTK (21aa)
  •    Q99KF1    Asn-125
• SNDSGIYR (8aa)
  •    Q61282    Asn-126
• VLHHYNR (7aa)
  •    P70275    Asn-126
• TINQSSDEIQISMGNAMFVK (20aa)
  •    P01011    Asn-127
• SIAHNMTTPNK (11aa)
  •    Q8BHJ7    Asn-145
• ESHNTSKGPEATWNLNK (17aa)
  •    Q9D387    Asn-127
• KLNYTLK (7aa)
  •    P97449    Asn-128
• LKFNSTIK (8aa)
  •    P22723    Asn-128
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• EDNDTLVR (8aa)
  •    P10721    Asn-130
• SWEAFSNLSYYTR (13aa)
  •    P35354    Asn-130
• MATPIIMQAIPMGAIPQGPMQNATK (25aa)
  •    P04233    Asn-130
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQS (29aa)
  •    P07339    Asn-134
• NGTSFDIHY (9aa)
  •    P07339    Asn-134
• ICQGIGINITK (11aa)
  •    Q96RQ9    Asn-134
• FAEINGSALCSYNIKPSEYTLTSK (24aa)
  •    Q6X893    Asn-134
• NGTSFDIHYGSGSLSGYLSQDTVSVPCK (28aa)
  •    P18242    Asn-134
• AAFHNAVAVVIYNNK (15aa)
  •    Q8VEM1    Asn-135
• LLFFDNYEHNTSVVKK (16aa)
  •    P97952    Asn-135
• LLFFDNYEHNTSVVK (15aa)
  •    P97952    Asn-135
• YPQDYQFYIQNF (12aa)
  •    P43307    Asn-136
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136
• QDYQFYIQNFTALPLNTVVPPQR (23aa)
  •    P43307    Asn-136
• GPLANPIWNVTGFTGR (16aa)
  •    P35822    Asn-139
• GPLANPIWNVTGFTGR (16aa)
  •    Q15262    Asn-140
• DDLDPERNESEPGSQR (16aa)
  •    O08532-4    Asn-136
• YPQDYQFYIQNFTALPLNTVVPPQR (25aa)
  •    Q9CY50    Asn-136
• SVAHNMTMPNK (11aa)
  •    P62812    Asn-137
• FVNSTGYLTEAEK (13aa)
  •    Q8R0F3    Asn-139
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140
• DTGLNYTHLHVETPR (15aa)
  •    Q9CW73    Asn-140
• LENLSSTESGYTATLTR (17aa)
  •    P70699    Asn-140
• DYGSQEDFTQVWNTTMK (17aa)
  •    O60635    Asn-141
• FVNSTGYITEAEK (13aa)
  •    Q8NBK3    Asn-141
• FTPPVVNVTWIR (12aa)
  •    P01903    Asn-143
• GSNYSEILDK (10aa)
  •    Q12841    Asn-144
• SVSHNMTAPNK (11aa)
  •    Q9D6F4    Asn-144
• FYATNDTEVAQSNFEAIQDFFR (22aa)
  •    P10619    Asn-145
• TNQSAELIQPVATNGK (16aa)
  •    Q8C129    Asn-145
• VLTNQESPYQNHTGR (15aa)
  •    P98086    Asn-146
• DMNQTIGDNITVK (13aa)
  •    Q8TCT8    Asn-149
• SLEVLNLSSNK (11aa)
  •    Q63912    Asn-152
• KDADEGDTLANSSDLLK (17aa)
  •    P22005    Asn-152
• RACQFNR (7aa)
  •    P14231    Asn-153
• ACQFNR (6aa)
  •    P14231    Asn-153
• CCGFTNYTDFEDSPYFK (17aa)
  •    O60635    Asn-154
• LNSSSQTNSLK (11aa)
  •    Q62443    Asn-154
• SAEGTFFINK (10aa)
  •    P06865    Asn-157
• NGSMGEPVIK (10aa)
  •    P30542    Asn-159
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160
• VNETEMDIAK (10aa)
  •    O75629    Asn-160
• FGEFGNYSIIVK (12aa)
  •    Q68CP4    Asn-162
• KLPLNFTEGAR (11aa)
  •    Q9Z0L8    Asn-162
• SVAHNMTTPNK (11aa)
  •    P26049    Asn-163
• EHYLSSVNK (9aa)
  •    P70207    Asn-163
• HLLENATASVSEAER (15aa)
  •    Q4PZA2    Asn-165
• YEQIQNETR (9aa)
  •    P11117    Asn-167
• DINETIHYMYK (11aa)
  •    Q99538    Asn-167
• YEQLQNETR (9aa)
  •    P24638    Asn-167
• NQSVPLSCCR (10aa)
  •    Q9QY33    Asn-167
• NQSVPISCCR (10aa)
  •    O60637    Asn-167
• HNLTIFFDVK (10aa)
  •    Q9JL56    Asn-168
• NGSLFAFR (8aa)
  •    P04004    Asn-169
• LAVTNTTMTGTVLK (14aa)
  •    P70302    Asn-171
• IVVYNQPYINYSR (13aa)
  •    Q9Y646    Asn-179
• YHYNGTFIDGTIFDSSHNR (19aa)
  •    O95302    Asn-174
• YHYNGTFLDGTLFDSSHNR (19aa)
  •    Q9Z247    Asn-174
• RYHSQTYGNGSK (12aa)
  •    Q13438    Asn-177
• YHSQTYGNGSK (11aa)
  •    Q8K2C7    Asn-177
• YHSQTYGNGSK (11aa)
  •    Q13438    Asn-177
• ENGTIVQVATISGNMFNQMAK (21aa)
  •    O75503    Asn-178
• DLVVQQAGTNK (11aa)
  •    P25942    Asn-180
• VFKPQSGADALNDSQDFPFPETPAK (25aa)
  •    Q8CIV2    Asn-180
• VFPYISAMVNNGSLSYDHER (20aa)
  •    P59481    Asn-180
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• LSNSSFSR (8aa)
  •    P11279    Asn-181
• GSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIER (35aa)
  •    Q3TAS6    Asn-182
• LNNISIIGPLDMK (13aa)
  •    Q9NUM4    Asn-183
  •    VAR_026849   185:T→S   dbSNP:rs3173615
• NSTIEAANIAGIK (13aa)
  •    P48723    Asn-184
• AAENFTIIVK (10aa)
  •    Q99571    Asn-184
• NSTIQAANLAGLK (13aa)
  •    Q8BM72    Asn-184
• SEHLVNFTVK (10aa)
  •    Q80VP8    Asn-184
• LNNITNIGPLDMK (13aa)
  •    Q80X71    Asn-184
• ARLNNITNIGPLDMK (15aa)
  •    Q80X71    Asn-184
• QVLFLDTVYGNCSTHFTVK (19aa)
  •    P04114    Asn-185
• QVIFIDTVYGNCSTHFTVK (19aa)
  •    P04114    Asn-185
• ELNRSR (6aa)
  •    P56974    Asn-186
• DGKPLLNDSR (10aa)
  •    Q640R3    Asn-189
• TINESTIIDSPR (12aa)
  •    P07686    Asn-190
• DINGNVFQDAVFNQTVTVIER (21aa)
  •    P43307    Asn-191
• NSSHSPLR (8aa)
  •    O09126    Asn-191
• LHHHLDHNTTR (11aa)
  •    Q6P5F6    Asn-191
• HMSIAINR (8aa)
  •    P06280    Asn-192
• VNTLEEGKGGPKNDTEER (18aa)
  •    Q62443    Asn-193
• VINFYAGANQSMNVTCVGK (19aa)
  •    P14231    Asn-197
• PKPPKNESLETYPLMMK (17aa)
  •    P14094    Asn-193
• VLGFKPKPPKNESLETYPLMMK (22aa)
  •    P14094    Asn-193
• IIPAFNTTSGIPYPR (15aa)
  •    Q9BZQ6    Asn-195
• IINGSNK (7aa)
  •    Q9UBV2    Asn-195
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196
• KNASNMEYR (9aa)
  •    P97300    Asn-196
• NASNMEYR (8aa)
  •    P97300    Asn-196
• QHTVTTTTKGENFTETDVK (19aa)
  •    P04925    Asn-196
• LLNQTLRENLKK (12aa)
  •    Q9CQF9    Asn-196
• NMSFVNDLTVTQDGR (15aa)
  •    Q9HDC9    Asn-196
• NMSFVNDITVTQDGRK (16aa)
  •    Q9HDC9    Asn-196
• DYFTDLITNESINYFK (16aa)
  •    Q8IWU6    Asn-197
• IQISNGNR (8aa)
  •    P06731    Asn-197
• IQISNGNR (8aa)
  •    P13688    Asn-553
  •    P06731    Asn-553
• IQISNGNR (8aa)
  •    P31997    Asn-197
  •    P13688    Asn-197
• EQINITIDHR (10aa)
  •    Q02809    Asn-197
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197
• EDVYRNHSIFIADINQER (18aa)
  •    P50897    Asn-197
• NYSIFLADINQER (13aa)
  •    O88531    Asn-197
• LINKFNSSSSSLEEK (15aa)
  •    Q9EPK6    Asn-197
• VINFYAGANQSMNVTCVGKR (20aa)
  •    P14231    Asn-197
• NIYTEFPQLYNNSMVCSFLPEVIYK (25aa)
  •    Q9JL56    Asn-198
• RNESHLIDFR (10aa)
  •    Q99JP7    Asn-198
• NESHLIDFR (9aa)
  •    Q99JP7    Asn-198
• VSVNTANVTIGPQIMEVTVYR (21aa)
  •    Q14956    Asn-200
• NNIHFPGHNYTTR (13aa)
  •    Q9Z1M0    Asn-202
• QPESVNVTR (9aa)
  •    Q60805    Asn-202
• NFTMNEK (7aa)
  •    Q92820    Asn-203
• TGEANLTQIYLQEALDFIK (19aa)
  •    P34059    Asn-204
• KNSTAYFR (8aa)
  •    Q8BYB9    Asn-204
• NLTLDFHR (8aa)
  •    Q8TDD5    Asn-205
• VLVAPPSEEANTTK (14aa)
  •    P43006    Asn-205
• TPLTANITK (9aa)
  •    P01877    Asn-205
• KTNLTTFNPSILEK (14aa)
  •    Q64689    Asn-206
• QRYNLTAK (8aa)
  •    O89023    Asn-209
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• GINESYK (7aa)
  •    P50897    Asn-212
• GINESYKK (8aa)
  •    P50897    Asn-212
• LRNPCTSEQNCTSPFSYK (18aa)
  •    P05556    Asn-212
• NPCTSEQNCTSPFSYK (16aa)
  •    P05556    Asn-212
• CVNESYKK (8aa)
  •    O88531    Asn-212
• DTLLIKEVKEDDIGNYTCELK (21aa)
  •    P59823    Asn-213
• YNGSLTTPNCDETVIWTVYK (20aa)
  •    Q64444    Asn-214
• TNSSFIQGFVDHVKEDCDR (19aa)
  •    Q61207    Asn-214
• DIILHSTGHNISR (13aa)
  •    Q8C129    Asn-215
• HNNDTQHIWESDSNEFSVIADPR (23aa)
  •    P14625    Asn-217
• HNNDTQHIWESDSNEFSVIADPR (23aa)
  •    P08113    Asn-217
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217
• FNHTQTIQQK (10aa)
  •    Q92823    Asn-223
• ANFSIK (6aa)
  •    Q6P179    Asn-219
• YRAEFAVANDTGFVDIPQQEK (21aa)
  •    P06797    Asn-221
• DVGSGTTNNSQACAQFLEQYFHNSDLTEFMR (31aa)
  •    O89023    Asn-221
• GMEPMNNATK (10aa)
  •    O15118    Asn-222
• DINTTAQNIMFYDMGSGSTVCTIVTYQMVK (30aa)
  •    Q9Y4L1    Asn-222
• LVSFEVPQNTSVK (13aa)
  •    Q8JZM4    Asn-223
• SSQSNQTIWFGHFTTSTIMSPSPGIR (26aa)
  •    Q8BXJ9    Asn-223
• ENSKQNGSANSATNPAGLDK (20aa)
  •    Q9ER58    Asn-225
• QNGSANSATNPAGLDK (16aa)
  •    Q9ER58    Asn-225
• FSDGIESNSSTQFEVK (16aa)
  •    P0C0L4    Asn-226
• FSDGIESNSSTQFEVK (16aa)
  •    P0C0L5    Asn-226
• FSDGLESNSSTQFEVK (16aa)
  •    P0C0L5    Asn-226
• FSDGLESNSSTQFEVK (16aa)
  •    P0C0L4    Asn-226
• FSDGLESNSSTQFEVKK (17aa)
  •    P0C0L4    Asn-226
• FSDGLESNSSTQFEVKK (17aa)
  •    P0C0L5    Asn-226
• DLMVINR (7aa)
  •    Q96KA5    Asn-229
• VKDLMVINR (9aa)
  •