taxonomy (90)
protein (632)
source (77)
structure (30)
composition (1)
disease (19)
reference (127)
site (903)
peptide (838)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Felis catus (Cat)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Acremonium sp. HI-25
- Actinidia chinensis (Kiwi fruit)
- Apium graveolens var. oulce (Celery)
- Artemisia vulgaris (Mugwort)
- Daucus carota (Carrot)
- Lycopersicon esculentum (Tomato)
- Nicotiana alata (Persian tobacco)
- Nicotiana tabacum (Common tobacco)
- Olea europaea (Common olive)
- Solanum tuberosum (Potato)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Physomitrella patens
- Spinacia oleracea (Spinach)
- Fagopyrum esculentum (Common buckwheat)
- Caenorhabditis elegans
- Pinus pinea (Italian stone pine)
- Trichinella spiralis
- Aspergillus niger
- Megathura crenulata (Californian giant keyhole limpet)
- Agaricus bisporus (Common mushroom)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Leishmania amazonensis
- Leishmania donovani
- Leishmania major
- Leishmania mexicana
- Leishmania tropica
- Leptomonas Samueli
- Trypanosoma brucei brucei
- Trypansoma brucei
- Persea americana (Avocado)
- Naja kaouthia (Monocled cobra)
- Trimeresurus stejnegeri (Chinese green tree viper)
- Allium cepa (Onion)
- Asparagus officinalis (Garden asparagus)
- Cocos nucifera (Coconut)
- Musa acuminata (Banana)
- Oryza sativa (Rice)
- Cherax quadricarinatus (Australian red claw crayfish)
- Pontastacus leptodactylus (Narrow-clawed crayfish)
- Friend mink cell focus-forming virus
- Friend murine leukemia virus (F-mulv)
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (anemia inducing strain)
- Friend spleen focus-forming virus (gm1 mutant)
- Friend spleen focus-forming virus (gm1.2 mutant)
- Friend spleen focus-forming virus (gm1.2.3 mutant)
- Friend spleen focus-forming virus (gm3.4 mutant)
- Human immunodeficiency virus (Hiv)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Arabidopsis thaliana (Thale cress)
- Arachis hypogaea (Peanut)
- Brassica oleracea var. botrytis (Cauliflower)
- Carica papaya (Papaya)
- Citrus sinensis (Orange)
- Corylus avellana (Hazelnut)
- Fragaria x ananassa (Strawberry)
- Glycine max (Soybean)
- Juglans regia (English walnut)
- Lupinus luteus (Yellow lupine)
- Malus domestica var. golden delicious (Cultivated apple - golden delicious)
- Phaseolus vulgaris (Kidney bean)
- Pistacia vera (Pistachio)
- Pisum sativum (Pea)
- Prunus dulcis var. sativa (Sweet almond)
- Pyrus communis var. williams (Pear)
- Ricinus communis (Castor bean)
- Vigna radiata var. radiata (Mung bean)
- Saccharomyces cerevisiae (Baker's yeast)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Marburg virus (strain musoke)
- Sendai virus (strain hvj)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
- Riftia pachyptila (Giant tubeworm)
Taxonomy
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- Acid ceramidase / Homo sapiens Q13510
- Adenosine receptor A1 / Homo sapiens P30542
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Aminopeptidase n / Homo sapiens P15144
- Amphoterin-induced protein 2 / Homo sapiens Q86SJ2
- Apolipoprotein b-100 / Homo sapiens P04114
- Apolipoprotein d / Homo sapiens P05090
- Arylsulfatase a / Homo sapiens P15289
- Arylsulfatase B / Homo sapiens P15848
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Attractin / Homo sapiens O75882
- Basal cell adhesion molecule / Homo sapiens P50895
- Basigin / Homo sapiens P35613
- Beta-galactosidase / Homo sapiens P16278
- Beta-hexosaminidase subunit alpha / Homo sapiens P06865
- Beta-hexosaminidase subunit beta / Homo sapiens P07686
- Beta-secretase / Homo sapiens P56817
- C-type mannose receptor 2 / Homo sapiens Q9UBG0
- Calreticulin / Homo sapiens P27797
- Carboxypeptidase D / Homo sapiens O75976
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens P13688
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens P31997
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Cartilage-associated protein / Homo sapiens O75718
- Cathepsin D / Homo sapiens P07339
- Cathepsin Z / Homo sapiens Q9UBR2
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens P20645
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD109 antigen / Homo sapiens Q6YHK3
- CD166 antigen / Homo sapiens Q13740
- Ceramide synthase 2 / Homo sapiens Q96G23
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Cleft lip and palate transmembrane protein 1 / Homo sapiens O96005
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Coagulation factor VIII / Homo sapiens P00451
- Collagen alpha-1(I) chain / Homo sapiens P02452
- Collagen alpha-1(III) chain / Homo sapiens P02461
- Collagen alpha-1(V) chain / Homo sapiens P20908
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(I) chain / Homo sapiens P08123
- Collagen alpha-2(V) chain / Homo sapiens P05997
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement C2 / Homo sapiens P06681
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- CUB domain-containing protein 1 / Homo sapiens Q9H5V8
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens Q6UXH1
- Decorin / Homo sapiens P07585
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 2 / Homo sapiens Q9UHL4
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens O14672
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens Q13443
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Dystroglycan / Homo sapiens Q14118
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens P22413
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens Q6P179
- Endoplasmin / Homo sapiens P14625
- Ephrin type-a receptor 2 / Homo sapiens P29317
- Ephrin type-B receptor 3 / Homo sapiens P54753
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens Q9BZQ6
- Erlin-1 / Homo sapiens O75477
- Erlin-2 / Homo sapiens O94905
- Extracellular sulfatase Sulf-1 / Homo sapiens Q8IWU6
- Fibrillin-1 / Homo sapiens P35555
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Fibroleukin / Homo sapiens Q14314
- Fibronectin / Homo sapiens P02751
- Follistatin-related protein 1 / Homo sapiens Q12841
- G-protein coupled receptor 98 / Homo sapiens Q8WXG9
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glucosylceramidase / Homo sapiens P04062
- Heat shock 70 kDa protein 13 / Homo sapiens P48723
- Hemopexin / Homo sapiens P02790
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens Q68CP4
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens P04440
- HLA class II histocompatibility antigen, DQ alpha 1 chain / Homo sapiens P01909
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- Hyaluronidase-4 / Homo sapiens Q2M3T9
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
- Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 / Homo sapiens Q58DX5
- Insulin receptor / Homo sapiens P06213
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-6 / Homo sapiens P23229
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Integrin beta-1 / Homo sapiens P05556
- Integrin beta-2 / Homo sapiens P05107
- Integrin beta-3 / Homo sapiens P05106
- Integrin beta-5 / Homo sapiens P18084
- Integrin beta-6 / Homo sapiens P18564
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon gamma / Homo sapiens P01579
- Keratin, type II cytoskeletal 8 / Homo sapiens P05787
- L-amino-acid oxidase / Homo sapiens Q96RQ9
- Lactadherin / Homo sapiens Q08431
- Lactoperoxidase / Homo sapiens P22079
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit gamma-1 / Homo sapiens P11047
- Legumain / Homo sapiens Q99538
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Lipase member J / Homo sapiens Q5W064
- Lipase member K / Homo sapiens Q5VXJ0
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens Q9NZR2
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens P98164
- Lumican / Homo sapiens P51884
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal acid phosphatase / Homo sapiens P11117
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosomal protective protein / Homo sapiens P10619
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mammaglobin-A / Homo sapiens Q13296
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Mast/stem cell growth factor receptor Kit / Homo sapiens P10721
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Melanoma inhibitory activity protein 3 / Homo sapiens Q5JRA6
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Metal transporter CNNM4 / Homo sapiens Q6P4Q7
- Microfibril-associated glycoprotein 4 / Homo sapiens P55083
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Mucin-5B / Homo sapiens Q9HC84
- Mucolipin-3 / Homo sapiens Q8TDD5
- Myelin protein zero-like protein 2 / Homo sapiens O60487
- Myeloperoxidase / Homo sapiens P05164
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- N-acylethanolamine-hydrolyzing acid amidase / Homo sapiens Q02083
- Neurocan core protein / Homo sapiens O14594
- Neurofascin / Homo sapiens O94856
- Neuronal cell adhesion molecule / Homo sapiens Q92823
- Neutrophil gelatinase-associated lipocalin / Homo sapiens P80188
- Nicastrin / Homo sapiens Q92542
- Niemann-Pick C1 protein / Homo sapiens O15118
- Nuclear pore membrane glycoprotein 210 / Homo sapiens Q8TEM1
- Olfactomedin-4 / Homo sapiens Q6UX06
- P2X purinoceptor 4 / Homo sapiens Q99571
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens P55259
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens O95302
- Periostin / Homo sapiens Q15063
- Peroxidasin homolog / Homo sapiens Q92626
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Phospholipase D3 / Homo sapiens Q8IV08
- Pituitary tumor-transforming gene 1 protein-interacting protein / Homo sapiens P53801
- Plasminogen / Homo sapiens P00747
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Homo sapiens Q96AQ6
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Pro-epidermal growth factor / Homo sapiens P01133
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostaglandin G/H synthase 2 / Homo sapiens P35354
- Protein CREG1 / Homo sapiens O75629
- Protein FAM171A2 / Homo sapiens A8MVW0
- Protein O-mannose kinase / Homo sapiens Q9H5K3
- Protein OS-9 / Homo sapiens Q13438
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Putative phospholipase B-like 2 / Homo sapiens Q8NHP8
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens P21860
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Secretogranin-3 / Homo sapiens Q8WXD2
- Seipin / Homo sapiens Q96G97
- Semaphorin-4D / Homo sapiens Q92854
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- Signal peptide peptidase-like 2A / Homo sapiens Q8TCT8
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens Q5TFQ8
- Sortilin-related receptor / Homo sapiens Q92673
- Sulfatase-modifying factor 1 / Homo sapiens Q8NBK3
- SUN domain-containing protein 2 / Homo sapiens Q9UH99
- Suppressor of tumorigenicity 14 protein / Homo sapiens Q9Y5Y6
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- T-cell surface antigen cd2 / Homo sapiens P06729
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Tenascin / Homo sapiens P24821
- Tetraspanin-1 / Homo sapiens O60635
- Tetraspanin-3 / Homo sapiens O60637
- Tetratricopeptide repeat protein 17 / Homo sapiens Q96AE7
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-3 / Homo sapiens P49746
- Thyroglobulin / Homo sapiens P01266
- Tissue-type plasminogen activator / Homo sapiens P00750
- TM2 domain-containing protein 3 / Homo sapiens Q9BRN9
- Torsin-1A-interacting protein 1 / Homo sapiens Q5JTV8
- Torsin-1B / Homo sapiens O14657
- Transferrin receptor protein 1 / Homo sapiens P02786
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Transmembrane protein 245 / Homo sapiens Q9H330
- Transmembrane protein 87A / Homo sapiens Q8NBN3
- Trophoblast glycoprotein / Homo sapiens Q13641
- Tumor necrosis factor receptor superfamily member 5 / Homo sapiens P25942
- Tumor-associated calcium signal transducer 2 / Homo sapiens P09758
- Twisted gastrulation protein homolog 1 / Homo sapiens Q9GZX9
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens P78324
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized protein from Blood Serum / Homo sapiens
- UPF0577 protein KIAA1324 / Homo sapiens Q6UXG2
- Uromodulin / Homo sapiens P07911
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens Q7Z7D3
- V-type proton ATPase subunit S1 / Homo sapiens Q15904
- Vasorin / Homo sapiens Q6EMK4
- Vitronectin / Homo sapiens P04004
- Von willebrand factor / Homo sapiens P04275
- Zinc transporter ZIP6 / Homo sapiens Q13433
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Lactotransferrin / Bos taurus P24627
- Platelet glycoprotein IV / Bos taurus P26201
- Ribonuclease pancreatic [b] / Bos taurus P61823
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Acid ceramidase / Mus musculus Q9WV54
- Adhesion G protein-coupled receptor L1 / Mus musculus Q80TR1
- Aggrecan core protein / Mus musculus Q61282
- Alpha-L-iduronidase / Mus musculus P48441
- Aminopeptidase N / Mus musculus P97449
- Angiotensin-converting enzyme / Mus musculus P09470
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus A2AL83 Q8BSY0
- ATP-binding cassette sub-family A member 2 / Mus musculus P41234
- ATP-binding cassette sub-family A member 7 / Mus musculus Q91V24
- Attractin / Mus musculus Q9WU60
- Basigin / Mus musculus P18572
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- C-type lectin domain family 4 member A / Mus musculus Q9QZ15
- C-type mannose receptor 2 / Mus musculus Q64449
- Cadherin EGF LAG seven-pass G-type receptor 2 / Mus musculus Q9R0M0
- Cadherin-10 / Mus musculus P70408
- Cadherin-11 / Mus musculus P55288
- Cadherin-12 / Mus musculus Q5RJH3
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-18 / Mus musculus E9Q941 E9Q9Q6
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Carbonic anhydrase 4 / Mus musculus Q64444
- Cathepsin D / Mus musculus P18242
- Cathepsin L1 / Mus musculus P06797
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Ceramide synthase 6 / Mus musculus Q8C172
- Cerebellin-2 / Mus musculus Q8BGU2
- Choline transporter-like protein 1 / Mus musculus Q6X893
- Claudin domain-containing protein 1 / Mus musculus Q9CQX5
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus Q8VBZ3
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus Q8BXA5
- Clusterin / Mus musculus Q06890
- Complement C1q subcomponent subunit A / Mus musculus P98086
- Contactin-1 / Mus musculus P12960
- Contactin-2 / Mus musculus Q61330
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- CUB and sushi domain-containing protein 1 / Mus musculus Q923L3
- CUB and sushi domain-containing protein 3 / Mus musculus Q80T79
- Cystatin-C / Mus musculus P21460
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus Q8JZM4
- Dickkopf-related protein 3 / Mus musculus Q9QUN9
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus O35598
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus Q9R1V7
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus Q91YQ5
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus P46978
- Dopamine beta-hydroxylase / Mus musculus Q64237
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus Q4VA61
- Dyslexia-associated protein KIAA0319-like protein / Mus musculus Q8K135
- E3 ubiquitin-protein ligase RNF130 / Mus musculus Q8VEM1
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus O55026
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus Q8BGN3
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Endothelin-converting enzyme 1 / Mus musculus Q4PZA2
- Ephrin-A3 / Mus musculus O08545
- ER membrane protein complex subunit 1 / Mus musculus Q8C7X2
- ER membrane protein complex subunit 10 / Mus musculus Q3TAS6
- ERO1-like protein alpha / Mus musculus Q8R180
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Fibroblast growth factor receptor / Mus musculus Q61851
- G-protein coupled receptor 56 / Mus musculus Q8K209
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus Q9CW73
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus Q9D6F4
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus Q8BHJ7
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus P63137
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyl hydrolase / Mus musculus Q9Z0L8
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Glutamate receptor 1 / Mus musculus P23818
- Glutamate receptor 2 / Mus musculus P23819
- Glutamate receptor 3 / Mus musculus Q9Z2W9
- Glutamate receptor ionotropic, kainate 2 / Mus musculus P39087
- Glutamate receptor ionotropic, kainate 3 / Mus musculus B1AS29
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- GPI inositol-deacylase / Mus musculus Q3UUQ7
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Heat shock 70 kDa protein 13 / Mus musculus Q8BM72
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Iduronate 2-sulfatase / Mus musculus Q08890
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Insulin receptor / Mus musculus P15208
- Integrin alpha 7 / Mus musculus Q61738
- Integrin alpha-1 / Mus musculus Q3V3R4
- Integrin alpha-V / Mus musculus P43406
- Integrin beta-1 / Mus musculus P09055
- Integrin beta-2 / Mus musculus P11835
- Integrin beta-8 / Mus musculus Q0VBD0
- Interferon beta / Mus musculus P01575
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus P59823
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Isoform 2 of Adhesion G protein-coupled receptor L2 / Mus musculus Q8JZZ7-2
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2 of Catenin delta-1 / Mus musculus P30999-2
- Isoform 2 of Integrin alpha-3 / Mus musculus Q62470-2
- Isoform 2 of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 / Mus musculus Q8BXA0-2
- Isoform 2 of Teneurin-3 / Mus musculus Q9WTS6-2
- Isoform 2 of TM2 domain-containing protein 1 / Mus musculus Q99MB3-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Lactosylceramide alpha-2,3-sialyltransferase / Mus musculus O88829
- Laminin subunit alpha-5 / Mus musculus Q61001
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucine zipper protein 2 / Mus musculus Q8BGY3
- Leucine-rich repeat-containing protein 55 / Mus musculus Q3UY51
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukemia inhibitory factor receptor / Mus musculus P42703
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal thioesterase PPT2 / Mus musculus O35448
- Lysosome membrane protein 2 / Mus musculus O35114
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 5 / Mus musculus Q9D387
- Major prion protein / Mus musculus P04925
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus Q0PMG2
- Melanoma inhibitory activity protein 3 / Mus musculus Q8BI84
- Membralin / Mus musculus Q8CIV2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Mucin / Mus musculus
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus P60882
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus Q9Z2L6
- Myelin-associated glycoprotein / Mus musculus P20917
- N-acetylglucosamine-6-sulfatase / Mus musculus Q8BFR4
- Netrin receptor DCC / Mus musculus P70211
- Neural cell adhesion molecule 1 / Mus musculus P13595
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurocan core protein / Mus musculus P55066
- Neuroendocrine convertase 2 / Mus musculus P21661
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal growth regulator 1 / Mus musculus Q80Z24
- Neuronal pentraxin receptor / Mus musculus Q99J85
- Neuronal pentraxin-1 / Mus musculus Q62443
- Neuroplastin / Mus musculus P97300
- Neutral cholesterol ester hydrolase 1 / Mus musculus Q8BLF1
- Nicastrin / Mus musculus P57716
- Nuclear pore membrane glycoprotein 210 / Mus musculus Q9QY81
- Nucleotide exchange factor SIL1 / Mus musculus Q9EPK6
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- P2X purinoceptor 7 / Mus musculus Q9Z1M0
- Palmitoyl-protein thioesterase 1 / Mus musculus O88531
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus Q9Z247
- Phosphatidylcholine-sterol acyltransferase / Mus musculus P16301
- Phospholipase D3 / Mus musculus O35405
- Plexin-A2 / Mus musculus P70207
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Mus musculus Q3TVI8
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Pro-neuregulin-2, membrane-bound isoform / Mus musculus P56974
- Probable C-mannosyltransferase DPY19L4 / Mus musculus A2AJQ3
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus Q9R0E1
- Proenkephalin-A / Mus musculus P22005
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin g/h synthase 2 / Mus musculus Q05769
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Protein EVI2A / Mus musculus P20934
- Protein FAM171A2 / Mus musculus A2A699
- Protein FAM234B / Mus musculus Q8BYI8
- Protein kinase C-binding protein NELL2 / Mus musculus Q61220
- Protein NOV homolog / Mus musculus Q64299
- Protein O-glucosyltransferase 1 / Mus musculus Q8BYB9
- Protein O-mannosyl-transferase 1 / Mus musculus Q8R2R1
- Protein OS-9 / Mus musculus Q8K2C7
- Protein sel-1 homolog 1 / Mus musculus Q9Z2G6
- Protocadherin Fat 1 / Mus musculus F2Z4A3
- Protocadherin Fat 2 / Mus musculus Q5F226
- Protocadherin-16 / Mus musculus E9PVD3
- Protocadherin-9 / Mus musculus A0A0A6YY09
- Receptor tyrosine-protein kinase erbB-3 / Mus musculus Q61526
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus Q64487
- Receptor-type tyrosine-protein phosphatase kappa / Mus musculus P35822
- Reelin / Mus musculus Q60841
- Reticulocalbin-1 / Mus musculus Q05186
- Retinal-specific ATP-binding cassette transporter / Mus musculus O35600
- Sacsin / Mus musculus Q9JLC8
- Seipin / Mus musculus Q9Z2E9
- Semaphorin-3E / Mus musculus P70275
- Semaphorin-4A / Mus musculus Q62178
- Semaphorin-4D / Mus musculus O09126
- Semaphorin-7A / Mus musculus Q9QUR8
- Serpin H1 / Mus musculus P19324
- Serum paraoxonase/arylesterase 2 / Mus musculus Q62086
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus Q64689
- SID1 transmembrane family member 1 / Mus musculus Q6AXF6
- Signal peptide, CUB and EGF-like domain-containing protein 1 / Mus musculus Q6NZL8
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium channel subunit beta-4 / Mus musculus Q7M729
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Solute carrier family 12 member 5 / Mus musculus Q91V14
- Sortilin / Mus musculus Q6PHU5
- Sortilin-related receptor / Mus musculus O88307
- SPARC / Mus musculus P07214
- SPARC-like protein 1 / Mus musculus P70663
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus Q6GQT6
- Stromal interaction molecule 1 / Mus musculus P70302
- Sulfatase-modifying factor 1 / Mus musculus Q8R0F3
- SUN domain-containing ossification factor / Mus musculus Q8C341
- SUN domain-containing protein 2 / Mus musculus Q8BJS4
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- Synaptotagmin-1 / Mus musculus P46096
- Teneurin-2 / Mus musculus Q9WTS5
- Testican-2 / Mus musculus Q9ER58
- Tetraspanin-3 / Mus musculus Q9QY33
- Thioredoxin domain-containing protein 15 / Mus musculus Q6P6J9
- Thrombospondin type-1 domain-containing protein 4 / Mus musculus Q3UTY6
- Thrombospondin type-1 domain-containing protein 7B / Mus musculus Q6P4U0
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Torsin-1A-interacting protein 1 / Mus musculus Q921T2
- Torsin-1B / Mus musculus Q9ER41
- Transferrin receptor protein 1 / Mus musculus Q62351
- Translocon-associated protein subunit alpha / Mus musculus Q9CY50
- Translocon-associated protein subunit beta / Mus musculus Q9CPW5
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus Q8BG19
- Transmembrane emp24 domain-containing protein 4 / Mus musculus Q8R1V4
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane prolyl 4-hydroxylase / Mus musculus Q8BG58
- Transmembrane protein 106B / Mus musculus Q80X71
- Transmembrane protein 106C / Mus musculus Q80VP8
- Transmembrane protein 131 / Mus musculus O70472
- Transmembrane protein 178B / Mus musculus M0QWJ9
- Transmembrane protein 62 / Mus musculus Q8BXJ9
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Trophoblast glycoprotein / Mus musculus Q9Z0L0
- Tyrosine-protein kinase Mer / Mus musculus Q60805
- Uncharacterized family 31 glucosidase KIAA1161 / Mus musculus Q69ZQ1
- Uncharacterized protein / Mus musculus
- Uncharacterized protein C11orf87 homolog / Mus musculus Q32M26
- UPF0577 protein KIAA1324-like homolog / Mus musculus Q3UZV7
- V-type proton ATPase subunit S1 / Mus musculus Q9R1Q9
- VIP36-like protein / Mus musculus P59481
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Zinc finger protein 521 / Mus musculus Q6KAS7
- Zinc transporter ZIP10 / Mus musculus Q6P5F6
- Zona pellucida sperm-binding protein matrix / Mus musculus Q62005 P10761 P20239
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Uncharacterized protein / Rattus norvegicus
- Coagulation factor VIII / Sus scrofa P12263
- Thyroglobulin / Sus scrofa
- Ascorbate oxidase / Acremonium sp. HI-25
- Uncharacterized protein / Actinidia chinensis
- Uncharacterized protein / Apium graveolens var. oulce
- Art v II / Artemisia vulgaris
- Uncharacterized protein / Daucus carota
- Uncharacterized protein / Lycopersicon esculentum
- Ribonuclease s-3 / Nicotiana alata O24103
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ribonuclease s-7 / Nicotiana alata Q40381
- Uncharacterized protein / Nicotiana tabacum
- Uncharacterized protein / Nicotiana tabacum
- Major protein allergan / Olea europaea P19963
- Uncharacterized protein / Solanum tuberosum
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin y / Gallus gallus
- Ovalbumin / Gallus gallus P01012
- Uncharacterized protein / Physomitrella patens
- Calreticulin / Spinacia oleracea A0A0K9QF27
- Uncharacterized protein / Fagopyrum esculentum
- Uncharacterized protein / Caenorhabditis elegans
- Uncharacterized protein / Caenorhabditis elegans
- Uncharacterized protein / Pinus pinea
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Alpha-glucosidase / Aspergillus niger P56526
- Endopolygalacturonase II / Aspergillus niger P26214
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Uncharacterized protein / Agaricus bisporus
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Apisin / Apis mellifera O18330
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Leishmanolysin / Leishmania amazonensis Q27673
- Leishmanolysin / Leishmania donovani P23223
- Leishmanolysin / Leishmania major P08148
- Leishmanolysin c1 / Leishmania mexicana P43150
- Leishmanolysin / Leishmania tropica Q8MNZ1
- Uncharacterized protein / Leptomonas Samueli
- Uncharacterized protein / Trypanosoma brucei brucei
- Uncharacterized protein / Trypanosoma brucei brucei
- Uncharacterized protein / Trypanosoma brucei brucei
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei P26334
- Variant surface glycoprotein mitat 1.4a / Trypansoma brucei P02896
- Uncharacterized protein / Persea americana
- Cobra venom factor / Naja kaouthia Q91132
- Galactose-binding lectin / Trimeresurus stejnegeri Q9YGP1
- Uncharacterized protein / Allium cepa
- Uncharacterized protein / Asparagus officinalis
- Uncharacterized protein / Cocos nucifera
- Uncharacterized protein / Musa acuminata
- Alpha-amylase / Oryza sativa P17654
- Vitellogenin / Cherax quadricarinatus Q9GSG2
- Hemocyanin / Pontastacus leptodactylus P83180
- Envelope glycoprotein / Friend mink cell focus-forming virus
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus P03393
- Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) P03393
- Surface protein gp120 / Human immunodeficiency virus
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Uncharacterized protein / Arabidopsis thaliana
- Uncharacterized protein / Arabidopsis thaliana
- Uncharacterized protein / Arachis hypogaea
- Uncharacterized protein / Brassica oleracea var. botrytis
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Citrus sinensis
- Uncharacterized protein / Corylus avellana
- Uncharacterized protein / Fragaria x ananassa
- Uncharacterized protein / Glycine max
- Uncharacterized protein / Juglans regia
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Uncharacterized protein / Malus domestica var. golden delicious
- Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris P02873
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Phaseolin, alpha-type / Phaseolus vulgaris P07219
- Phaseolin, beta-type / Phaseolus vulgaris P02853
- Uncharacterized protein / Phaseolus vulgaris
- Uncharacterized protein / Pistacia vera
- Uncharacterized protein / Pisum sativum
- Uncharacterized protein / Prunus dulcis var. sativa
- Uncharacterized protein / Pyrus communis var. williams
- Uncharacterized protein / Ricinus communis
- Uncharacterized protein / Ricinus communis
- Uncharacterized protein / Vigna radiata var. radiata
- Invertase [secreted form] / Saccharomyces cerevisiae
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Hemagglutinin-neuraminidase / Sendai virus (strain hvj) P04853
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Uncharacterized protein / Schistosoma mansoni
- Hemoglobin extracellular / Riftia pachyptila
Protein
- Allantois (UBERON_0004340)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Coelomic Fluid (UBERON_0036217)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113) NRK (CVCL_3758) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992) Lec1 (CVCL_3440)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966)
- Royal Jelly
- Submandibular Gland (UBERON_0001736)
- Thyroid (UBERON_0002046)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- BW5147 (CVCL_3896) Leukocyte (CL_0000738)
- BW5147.PHAR2.7 (CVCL_VT60) Leukocyte (CL_0000738)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Jurkat (CVCL_0065)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- NS0 (CVCL_3940)
- Rat1 (CVCL_0492)
- SPC-Mb-92-C6 (CVCL_VT62)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Delipidated Cell
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Cotyledon (BTO_0000300)
- Endosperm (BTO_0000390)
- Floret (BTO_0000468)
- Fruit (BTO_0000486)
- Leaf (BTO_0000713)
- Pollen (BTO_0001097)
- Root (BTO_0001188)
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Tuber (BTO_0001400)
- Low-Density Lipoprotein Particle (GO_0034362)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / High-Mannose / Structure 314
- N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Galf(b1-2)[Man(a1-3)][Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(?1-?)[Man(?1-?)]Man(a1-6)[Man(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(?1-?)"
- N-Linked / High-Mannose / Man(?1-?)[Man(?1-?)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 979
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)[Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-?)"
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 3542
- N-Linked / High-Mannose / Structure 3572
- N-Linked / High-Mannose / Structure 9623
- N-Linked / Undefined core / Structure 9584
- N-Linked / Undefined core / Structure 9822
- N-Linked / Undefined core / Structure 9886
Reported structure
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Erythroleukemia with associated Polycythemia
- Esophageal cancer (DOID:5041)
- Healthy
- Hypercholesterolemia, Familial (DOID:13810)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Lymphoma (DOID:0060058)
- Mannosidosis, alpha (DOID:3413)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Prostate cancer (DOID:10283)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Structural characterization of the N-glycan moiety and site of glycosylation in vitellogenin from the decapod crustacean Cherax quadricarinatus. (2004 - Khalaila I, Peter-Katalinic J, Tsang C, Radcliffe CM, Aflalo ED, Harvey DJ, Dwek RA, Rudd PM, Sagi A) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Tandem mass spectrometry of ribonuclease A and B: N-linked glycosylation site analysis of whole protein ions (2002 - Reid, Stephenson, McLuckey) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
- Glycoproteins secreted from suspension-cultured tobacco BY2 cells have distinct glycan structures from intracellular glycoproteins. (2001 - Misaki R, Kimura Y, Fujiyama K, Seki T) / Status : Reviewed
- N-linked oligosaccharides of cobra venom factor contain novel alpha(1-3)galactosylated Le(x) structures. (2001 - Gowda DC, Glushka J, van-Halbeek H , Thotakura RN, Bredehorst R, Vogel C-W) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- The nematode Caenorhabditis elegans synthesizes unusual O-linked glycans: identification of glucose-substituted mucin-type O-glycans and short chondroitin-like oligosaccharides (2001 - Guerardel, Balanzino, Maes, Leroy, Coddeville, Oriol, Strecker) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- N-Glycan analysis by matrix-assisted laser desorption/ionization mass spectrometry of electrophoretically separated nonmammalian proteins: application to peanut allergen Ara h 1 and olive pollen allergen Ole e 1. (2000 - Kolarich D, Altmann F) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Analysis of carbohydrate heterogeneity in a glycoprotein using liquid chromatography/mass spectrometry and liquid chromatography with tandem mass spectrometry. (1999 - Kawasaki N, Ohta M, Hyuga S, Hashimoto O, Hayakawa T) / Status : Reviewed
- Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
- Characterization and analysis of a novel glycoprotein from snake venom using liquid chromatography-electrospray mass spectrometry and Edman degradation. (1999 - Zeng R, Xu Q, Shao X, Wang K, Xia Q) / Status : Reviewed
- Glycosylation sites and site-specific glycosylation in human Tamm-Horsfall glycoprotein. (1999 - van Rooijen J, Voskamp A, Kamerling J, Vliegenthart J) / Status : Reviewed
- Characterization of N-glycans from Arabidopsis. Application to a fucose-deficient mutant. (1999 - Rayon C, Cabanes-Macheteau M, Loutelier-Bourhis C, Salliot-Maire I, Lemoine J, Reiter W, Lerouge P, Faye L) / Status : Reviewed
- Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
- Structure and distribution of N-glycans on the S7-allele stylar self-incompatibility ribonuclease of Nicotiana alata. (1998 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- A unique, terminally glucosylated oligosaccharide is a common feature on Leishmania cell surfaces (1997 - Funk VA, Thomas-Oates JE, Kielland SL, Bates PA, Olafson RW) / Status : Reviewed
- Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Primary structure of the N-linked carbohydrate chains of Calreticulin from spinach leaves. (1996 - Navazio L, Baldan B, Mariani P, Gerwig G, Vliegenthart J) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
- The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
- Characterization of asparagine-linked oligosaccharides on a mouse submandibular mucin. (1995 - Denny P, Hong-Le N) / Status : Reviewed
- N-linked sugar chains of 350-kDa royal jelly glycoprotein. (1995 - Kimura Y, Washino N, Yonekura M) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
- Glycosylation of glycoprotein 55 encoded by the anaemia-inducing strain of Friend spleen focus-forming virus. (1994 - Volker J, Geyer H, Geyer R) / Status : Reviewed
- A detailed structural characterization of ribonuclease B oligosaccharides by 1H NMR spectroscopy and mass spectrometry. (1994 - Fu D, Chen L, O'Neill R) / Status : Reviewed
- Novel structures of N-linked high-mannose type oligosaccharides containing alpha-D-galactofuranosyl linkages in Aspergillus niger alpha-D-glucosidase. (1994 - Takayanagi T, Kimura A, Chiba S, Ajisaka K) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- The carbohydrate structures of Trypanosoma brucei brucei MITat 1.6 variant surface glycoprotein. A re-investigation of the C-terminal glycan. (1993 - Strang A, Allen A, Holder A, van Halbeek H) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Isolation of oligomannose-type glycans from bean glycoproteins. (1993 - Lu Y, Ye J, Wold F) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- The conformational effects of N-glycosylation on the tailpiece from serum IgM. (1991 - Wormald M, Wooten E, Bazzo R, Edge C, Feinstein A, Rademacher T, Dwek R) / Status : Reviewed
- Structural analysis of the glycoprotein allergen Art v II from the pollen of mugwort (Artemisia vulgaris L.). (1991 - Nilsen B, Sletten K, Paulsen B, O'Neill M, van Halbeek H) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structure and biosynthesis of the xylose-containing carbohydrate moiety of rice alpha-amylase. (1990 - Hayashi M, Tsuru A, Mitsui T, Takahashi N, Hanzawa H, Arata Y, Akazawa T) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Structures of sugar chains of water-soluble glycoproteins in developing castor bean cotyledons. (1990 - Kimura Y, Suehisa H, Yamaguchi O, Nakajima S, Takagi S) / Status : Reviewed
- Pregnancy-associated changes in oligomannose oligosaccharides of human and bovine uromodulin (Tamm-Horsfall glycoprotein). (1990 - Smagula R, Van Halbeek H, Decker J, Muchmore A, Moody C, Sherblom A) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Characterisation of the asparagine-linked oligosaccharides from Trypanosoma brucei type-I variant surface glycoproteins. (1990 - Zamze SE, Wooten EW, Ashford DA, Ferguson MA, Dwek RA, Rademacher TW) / Status : Reviewed
- Structures of the N-linked oligosaccharides of Gp63, the major surface glycoprotein, from Leishmania mexicana amazonensis. (1990 - Olafson R, Thomas J, Ferguson M, Dwek R, Chaudhuri M, Chang K, Rademacher T) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
- Characterization of the high mannose asparagine-linked oligosaccharides synthesized by Schistosoma mansoni adult male worms. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
- Structure, position, and biosynthesis of the high mannose and the complex oligosaccharide side chains of the bean storage protein phaseolin. (1987 - Sturm A, Van Kuik J, Vliegenthart J, Chrispeels M) / Status : Reviewed
- Identification method for twelve oligomannose-type sugar chains thought to be processing intermediates of glycoproteins. (1987 - Hase S, Natsuka S, Oku H, Ikenaka T) / Status : Reviewed
- High-mannose structure of apolipoprotein-B from low-density lipoproteins of human plasma. (1985 - Vauhkonen M, Viitala J, Parkkinen J, Rauvala H) / Status : Reviewed
- The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
- Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
Reference
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- Acid ceramidase / Homo sapiens
- Adenosine receptor A1 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Amphoterin-induced protein 2 / Homo sapiens
-
Apolipoprotein b-100 / Homo sapiens
- Undefined site
- Asn-185
- Apolipoprotein d / Homo sapiens
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Arylsulfatase B / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Attractin / Homo sapiens
- Basal cell adhesion molecule / Homo sapiens
- Basigin / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Beta-hexosaminidase subunit alpha / Homo sapiens
- Beta-hexosaminidase subunit beta / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- C-type mannose receptor 2 / Homo sapiens
- Calreticulin / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cartilage-associated protein / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin Z / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Cleft lip and palate transmembrane protein 1 / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Collagen alpha-1(I) chain / Homo sapiens
- Collagen alpha-1(III) chain / Homo sapiens
- Collagen alpha-1(V) chain / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(I) chain / Homo sapiens
- Collagen alpha-2(V) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement C2 / Homo sapiens
-
Complement c3 / Homo sapiens
- Undefined site
- Asn-85
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- CUB domain-containing protein 1 / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Dystroglycan / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens
- Erlin-1 / Homo sapiens
- Erlin-2 / Homo sapiens
- Extracellular sulfatase Sulf-1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- G-protein coupled receptor 98 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Heat shock 70 kDa protein 13 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
- HLA class II histocompatibility antigen, DQ alpha 1 chain / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- Hyaluronidase-4 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
- Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 / Homo sapiens
- Insulin receptor / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-6 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Integrin beta-3 / Homo sapiens
- Integrin beta-5 / Homo sapiens
- Integrin beta-6 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Keratin, type II cytoskeletal 8 / Homo sapiens
- L-amino-acid oxidase / Homo sapiens
- Lactadherin / Homo sapiens
- Lactoperoxidase / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Legumain / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lipase member J / Homo sapiens
- Lipase member K / Homo sapiens
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens
- Lumican / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Mast/stem cell growth factor receptor Kit / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Melanoma inhibitory activity protein 3 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Metal transporter CNNM4 / Homo sapiens
- Microfibril-associated glycoprotein 4 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Mucin-5B / Homo sapiens
- Mucolipin-3 / Homo sapiens
- Myelin protein zero-like protein 2 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- N-acylethanolamine-hydrolyzing acid amidase / Homo sapiens
- Neurocan core protein / Homo sapiens
- Neurofascin / Homo sapiens
- Neuronal cell adhesion molecule / Homo sapiens
- Neutrophil gelatinase-associated lipocalin / Homo sapiens
- Nicastrin / Homo sapiens
- Niemann-Pick C1 protein / Homo sapiens
- Nuclear pore membrane glycoprotein 210 / Homo sapiens
- Olfactomedin-4 / Homo sapiens
- P2X purinoceptor 4 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
- Periostin / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- Pituitary tumor-transforming gene 1 protein-interacting protein / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Pro-epidermal growth factor / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl 3-hydroxylase 1 / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Prostaglandin G/H synthase 2 / Homo sapiens
- Protein CREG1 / Homo sapiens
- Protein FAM171A2 / Homo sapiens
- Protein O-mannose kinase / Homo sapiens
- Protein OS-9 / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Putative phospholipase B-like 2 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Asn-470
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Seipin / Homo sapiens
- Semaphorin-4D / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sialate O-acetylesterase / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Signal peptide peptidase-like 2A / Homo sapiens
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens
- Sortilin-related receptor / Homo sapiens
- Sulfatase-modifying factor 1 / Homo sapiens
- SUN domain-containing protein 2 / Homo sapiens
- Suppressor of tumorigenicity 14 protein / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
-
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Tenascin / Homo sapiens
- Tetraspanin-1 / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Tetratricopeptide repeat protein 17 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-3 / Homo sapiens
- Thyroglobulin / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- TM2 domain-containing protein 3 / Homo sapiens
- Torsin-1A-interacting protein 1 / Homo sapiens
- Torsin-1B / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Transmembrane protein 245 / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
- Trophoblast glycoprotein / Homo sapiens
- Tumor necrosis factor receptor superfamily member 5 / Homo sapiens
- Tumor-associated calcium signal transducer 2 / Homo sapiens
- Twisted gastrulation protein homolog 1 / Homo sapiens
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- UPF0577 protein KIAA1324 / Homo sapiens
-
Uromodulin / Homo sapiens
- Undefined site
- Asn-275
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens
- V-type proton ATPase subunit S1 / Homo sapiens
- Vasorin / Homo sapiens
- Vitronectin / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc transporter ZIP6 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Ribonuclease pancreatic [b] / Bos taurus
- Undefined site
- Asn-60
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor L1 / Mus musculus
- Aggrecan core protein / Mus musculus
- Alpha-L-iduronidase / Mus musculus
- Aminopeptidase N / Mus musculus
- Angiotensin-converting enzyme / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- ATP-binding cassette sub-family A member 2 / Mus musculus
- ATP-binding cassette sub-family A member 7 / Mus musculus
- Attractin / Mus musculus
- Basigin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- C-type lectin domain family 4 member A / Mus musculus
- C-type mannose receptor 2 / Mus musculus
- Cadherin EGF LAG seven-pass G-type receptor 2 / Mus musculus
- Cadherin-10 / Mus musculus
- Cadherin-11 / Mus musculus
- Cadherin-12 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-18 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Carbonic anhydrase 4 / Mus musculus
- Cathepsin D / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Ceramide synthase 6 / Mus musculus
- Cerebellin-2 / Mus musculus
- Choline transporter-like protein 1 / Mus musculus
- Claudin domain-containing protein 1 / Mus musculus
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
- Clusterin / Mus musculus
- Complement C1q subcomponent subunit A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- CUB and sushi domain-containing protein 1 / Mus musculus
- CUB and sushi domain-containing protein 3 / Mus musculus
- Cystatin-C / Mus musculus
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus
- Dickkopf-related protein 3 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus
- Dopamine beta-hydroxylase / Mus musculus
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus
- Dyslexia-associated protein KIAA0319-like protein / Mus musculus
- E3 ubiquitin-protein ligase RNF130 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Endothelin-converting enzyme 1 / Mus musculus
- Ephrin-A3 / Mus musculus
- ER membrane protein complex subunit 1 / Mus musculus
- ER membrane protein complex subunit 10 / Mus musculus
- ERO1-like protein alpha / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Fibroblast growth factor receptor / Mus musculus
- G-protein coupled receptor 56 / Mus musculus
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyl hydrolase / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor 1 / Mus musculus
- Glutamate receptor 2 / Mus musculus
- Glutamate receptor 3 / Mus musculus
- Glutamate receptor ionotropic, kainate 2 / Mus musculus
- Glutamate receptor ionotropic, kainate 3 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI inositol-deacylase / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Heat shock 70 kDa protein 13 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Hypoxia up-regulated protein 1 / Mus musculus
- Iduronate 2-sulfatase / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Insulin receptor / Mus musculus
- Integrin alpha 7 / Mus musculus
- Integrin alpha-1 / Mus musculus
- Integrin alpha-V / Mus musculus
- Integrin beta-1 / Mus musculus
- Integrin beta-2 / Mus musculus
- Integrin beta-8 / Mus musculus
-
Interferon beta / Mus musculus
- Undefined site
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L2 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2 of Catenin delta-1 / Mus musculus
- Isoform 2 of Integrin alpha-3 / Mus musculus
- Isoform 2 of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 / Mus musculus
- Isoform 2 of Teneurin-3 / Mus musculus
- Isoform 2 of TM2 domain-containing protein 1 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Lactosylceramide alpha-2,3-sialyltransferase / Mus musculus
- Laminin subunit alpha-5 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine zipper protein 2 / Mus musculus
- Leucine-rich repeat-containing protein 55 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukemia inhibitory factor receptor / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal thioesterase PPT2 / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 5 / Mus musculus
- Major prion protein / Mus musculus
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus
- Melanoma inhibitory activity protein 3 / Mus musculus
- Membralin / Mus musculus
- Metal transporter CNNM4 / Mus musculus
-
Mucin / Mus musculus
- Undefined site
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- N-acetylglucosamine-6-sulfatase / Mus musculus
- Netrin receptor DCC / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neuroendocrine convertase 2 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Neuronal pentraxin receptor / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Neuroplastin / Mus musculus
- Neutral cholesterol ester hydrolase 1 / Mus musculus
- Nicastrin / Mus musculus
- Nuclear pore membrane glycoprotein 210 / Mus musculus
- Nucleotide exchange factor SIL1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- P2X purinoceptor 7 / Mus musculus
- Palmitoyl-protein thioesterase 1 / Mus musculus
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus
- Phosphatidylcholine-sterol acyltransferase / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A2 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Pro-neuregulin-2, membrane-bound isoform / Mus musculus
- Probable C-mannosyltransferase DPY19L4 / Mus musculus
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus
- Proenkephalin-A / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin g/h synthase 2 / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protein EVI2A / Mus musculus
- Protein FAM171A2 / Mus musculus
- Protein FAM234B / Mus musculus
- Protein kinase C-binding protein NELL2 / Mus musculus
- Protein NOV homolog / Mus musculus
- Protein O-glucosyltransferase 1 / Mus musculus
- Protein O-mannosyl-transferase 1 / Mus musculus
- Protein OS-9 / Mus musculus
- Protein sel-1 homolog 1 / Mus musculus
- Protocadherin Fat 1 / Mus musculus
- Protocadherin Fat 2 / Mus musculus
- Protocadherin-16 / Mus musculus
- Protocadherin-9 / Mus musculus
- Receptor tyrosine-protein kinase erbB-3 / Mus musculus
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus
- Receptor-type tyrosine-protein phosphatase kappa / Mus musculus
- Reelin / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Retinal-specific ATP-binding cassette transporter / Mus musculus
- Sacsin / Mus musculus
- Seipin / Mus musculus
- Semaphorin-3E / Mus musculus
- Semaphorin-4A / Mus musculus
- Semaphorin-4D / Mus musculus
- Semaphorin-7A / Mus musculus
- Serpin H1 / Mus musculus
- Serum paraoxonase/arylesterase 2 / Mus musculus
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus
- SID1 transmembrane family member 1 / Mus musculus
- Signal peptide, CUB and EGF-like domain-containing protein 1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 5 / Mus musculus
- Sortilin / Mus musculus
- Sortilin-related receptor / Mus musculus
- SPARC / Mus musculus
- SPARC-like protein 1 / Mus musculus
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus
- Stromal interaction molecule 1 / Mus musculus
- Sulfatase-modifying factor 1 / Mus musculus
- SUN domain-containing ossification factor / Mus musculus
- SUN domain-containing protein 2 / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- Synaptotagmin-1 / Mus musculus
- Teneurin-2 / Mus musculus
- Testican-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thioredoxin domain-containing protein 15 / Mus musculus
- Thrombospondin type-1 domain-containing protein 4 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7B / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Torsin-1A-interacting protein 1 / Mus musculus
- Torsin-1B / Mus musculus
- Transferrin receptor protein 1 / Mus musculus
- Translocon-associated protein subunit alpha / Mus musculus
- Translocon-associated protein subunit beta / Mus musculus
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane prolyl 4-hydroxylase / Mus musculus
- Transmembrane protein 106B / Mus musculus
- Transmembrane protein 106C / Mus musculus
- Transmembrane protein 131 / Mus musculus
- Transmembrane protein 178B / Mus musculus
- Transmembrane protein 62 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Trophoblast glycoprotein / Mus musculus
- Tyrosine-protein kinase Mer / Mus musculus
- Uncharacterized family 31 glucosidase KIAA1161 / Mus musculus
-
Uncharacterized protein / Mus musculus
- Undefined site
- Uncharacterized protein C11orf87 homolog / Mus musculus
- UPF0577 protein KIAA1324-like homolog / Mus musculus
- V-type proton ATPase subunit S1 / Mus musculus
- VIP36-like protein / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Zinc finger protein 521 / Mus musculus
- Zinc transporter ZIP10 / Mus musculus
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Thyroglobulin / Sus scrofa
- Undefined site
-
Ascorbate oxidase / Acremonium sp. HI-25
- Undefined site
-
Uncharacterized protein / Actinidia chinensis
- Undefined site
-
Uncharacterized protein / Apium graveolens var. oulce
- Undefined site
-
Art v II / Artemisia vulgaris
- Undefined site
-
Uncharacterized protein / Daucus carota
- Undefined site
-
Uncharacterized protein / Lycopersicon esculentum
- Undefined site
-
Ribonuclease s-3 / Nicotiana alata
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
- Ribonuclease s-7 / Nicotiana alata
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
- Major protein allergan / Olea europaea
-
Uncharacterized protein / Solanum tuberosum
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Calreticulin / Spinacia oleracea
- Undefined site
-
Uncharacterized protein / Fagopyrum esculentum
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein / Pinus pinea
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Alpha-glucosidase / Aspergillus niger
- Undefined site
-
Endopolygalacturonase II / Aspergillus niger
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Uncharacterized protein / Agaricus bisporus
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Apisin / Apis mellifera
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Leishmanolysin / Leishmania amazonensis
- Undefined site
-
Leishmanolysin / Leishmania donovani
- Undefined site
-
Leishmanolysin / Leishmania major
- Undefined site
-
Leishmanolysin c1 / Leishmania mexicana
- Undefined site
-
Leishmanolysin / Leishmania tropica
- Undefined site
-
Uncharacterized protein / Leptomonas Samueli
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei
-
Variant surface glycoprotein mitat 1.4a / Trypansoma brucei
- Undefined site
-
Uncharacterized protein / Persea americana
- Undefined site
-
Cobra venom factor / Naja kaouthia
- Undefined site
- Galactose-binding lectin / Trimeresurus stejnegeri
-
Uncharacterized protein / Allium cepa
- Undefined site
-
Uncharacterized protein / Asparagus officinalis
- Undefined site
-
Uncharacterized protein / Cocos nucifera
- Undefined site
-
Uncharacterized protein / Musa acuminata
- Undefined site
-
Alpha-amylase / Oryza sativa
- Undefined site
-
Vitellogenin / Cherax quadricarinatus
- Undefined site
-
Hemocyanin / Pontastacus leptodactylus
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
- Undefined site
-
Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Uncharacterized protein / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein / Arachis hypogaea
- Undefined site
-
Uncharacterized protein / Brassica oleracea var. botrytis
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Citrus sinensis
- Undefined site
-
Uncharacterized protein / Corylus avellana
- Undefined site
-
Uncharacterized protein / Fragaria x ananassa
- Undefined site
-
Uncharacterized protein / Glycine max
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Malus domestica var. golden delicious
- Undefined site
-
Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
- Phaseolin, alpha-type / Phaseolus vulgaris
- Phaseolin, beta-type / Phaseolus vulgaris
-
Uncharacterized protein / Phaseolus vulgaris
- Undefined site
-
Uncharacterized protein / Pistacia vera
- Undefined site
-
Uncharacterized protein / Pisum sativum
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
-
Uncharacterized protein / Pyrus communis var. williams
- Undefined site
-
Uncharacterized protein / Ricinus communis
- Undefined site
-
Uncharacterized protein / Ricinus communis
- Undefined site
-
Uncharacterized protein / Vigna radiata var. radiata
- Undefined site
-
Invertase [secreted form] / Saccharomyces cerevisiae
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
Hemagglutinin-neuraminidase / Sendai virus (strain hvj)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Uncharacterized protein / Schistosoma mansoni
- Undefined site
-
Hemoglobin extracellular / Riftia pachyptila
- Undefined site
Reported glycosite
- QYNSTNMGLWR (11aa)
- QCVNLTTR (8aa)
- FWLPHNVTWADLK (13aa)
- IWIPVNITWADIEDRDGR (18aa)
- VSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSK (40aa)
- TFASHNASGGSSAGLR (16aa)
- DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- FNVSIDSVPEIR (12aa)
- HAVYWNSSNQHLR (13aa)
- LEPTPPIQFTHFQYNVTVHENSAAK (25aa)
- HENNTKDNSIQHEFSLTR (18aa)
- ALPGGTDNASAASAAGGSGPQR (22aa)
- AELSNHTRPVILVPGCLGNR (20aa)
- VNFTIEASEGCYR (13aa)
- KIYIPLNK (8aa)
- KNYSVLYFQQK (11aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VAGTAVSISCNVSDYEGPAQQDFEWFMYRPEAPATSLGIVSTK (43aa)
- QECYAFNGTQR (11aa)
- WQMNFTVR (8aa)
- SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
- WYSAGLASNSSWFR (14aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- NVSCLWCNTNK (11aa)
- TCEECIKNVSCIWCNTNK (18aa)
- NVSCLW (6aa)
- VVTWGINR (8aa)
- HPSDNNTNLVTPAVGHK (17aa)
- QVPGLHNGTK (10aa)
- LKPLFNK (7aa)
- SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
- YETTNK (6aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- P0DTC2 Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-61     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- WKLNK (5aa)
- QGNASDVILR (10aa)
- FSNVTW (6aa)
- SNVTWF (6aa)
- SCNISVTEK (9aa)
- EEEAIQLDGLNASQIR (16aa)
- NTTIFLK (7aa)
- TDDEVVQREEEAIQLDGLNASQIR (24aa)
- EGSRTDDEVVQREEEAIQLDGLNASQIR (28aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- APLVNVTLYYEALCGGCR (18aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- HAPDIPDDSTDNITIFTR (18aa)
- SNAPIVNVTIYYEAICGGCR (20aa)
- EERPINASAIK (11aa)
- ATTLDDNGTMLFFKGE (16aa)
- FTECCHEERPLNTSALK (17aa)
- WPADKENDTGIVGQHSSCDVR (21aa)
- CIQANYSIMENGK (13aa)
- GAWLNR (6aa)
- NCSPWLSCEELR (12aa)
- AIGFENATQAIGR (13aa)
- NLSLAHNR (8aa)
- YHYNGTFEDGKK (12aa)
- YHYNGTFEDGK (11aa)
- SNVSVEENVILEKPSHVELK (20aa)
- VAWLNR (6aa)
- NGDAYGFYNNSVK (13aa)
- GQTEIQVNCPPAVTENK (17aa)
- IIVPINNRENISDPTSPIR (19aa)
- GAAAPSAPHWNETAEK (16aa)
- YNGSLGLWR (9aa)
- GRDIYTFDGAINK (13aa)
- DIYTFDGAINK (11aa)
- FHAIHVSGTNGTK (13aa)
- ANTTQPGIVEGGQVLK (16aa)
- HAIHVSGTNGTK (12aa)
- NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK (31aa)
- YPGIFNSTTSDAFIQSK (17aa)
- MNGTEMNLEPGSR (13aa)
- NQNGTFK (7aa)
- DNATQEEILHYLEK (14aa)
- NYSDTPPTSK (10aa)
- VHVNSSSDNLDYPVLVVVR (19aa)
- KCLANGSWTDMDTPSR (16aa)
- MTPNIIHIAPENFYISHSPNSTAGPSCTIIEEAFRR (36aa)
- MTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFR (35aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- TVLTPATNHMGNVTF (15aa)
- HMGNVTFTIPANR (13aa)
- SYNVTSVIFR (10aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- TVLTPATNHMGNVTFTIPANREFK (24aa)
- KTVLTPATNHMGNVTFTIPANREFKS (26aa)
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- IPSVVIPIHYDIFVHPNITSIDFVASEK (28aa)
- TNHMGNVTFTIPANR (15aa)
- KEDALNETR (9aa)
- DQAGNCTEPVSLAPPARPRPGSSFSK (26aa)
- DQAGNCTEPVSLAPPAR (17aa)
- LPADCIDCTTNFSCTYGK (18aa)
- FNGSVSFFR (9aa)
- TDCDSSTTSICSFPVANVSITK (22aa)