taxonomy (92)
protein (647)
source (100)
structure (37)
composition (1)
disease (28)
reference (157)
site (926)
peptide (851)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Felis catus (Cat)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Acremonium sp. HI-25
- Actinidia chinensis (Kiwi fruit)
- Apium graveolens var. oulce (Celery)
- Artemisia vulgaris (Mugwort)
- Daucus carota (Carrot)
- Lycopersicon esculentum (Tomato)
- Nicotiana alata (Persian tobacco)
- Nicotiana tabacum (Common tobacco)
- Olea europaea (Common olive)
- Solanum tuberosum (Potato)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Physomitrella patens
- Spinacia oleracea (Spinach)
- Fagopyrum esculentum (Common buckwheat)
- Caenorhabditis elegans
- Pinus pinea (Italian stone pine)
- Trichinella spiralis
- Aspergillus niger
- Megathura crenulata (Californian giant keyhole limpet)
- Agaricus bisporus (Common mushroom)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Leishmania amazonensis
- Leishmania donovani
- Leishmania major
- Leishmania mexicana
- Leishmania tropica
- Leptomonas Samueli
- Trypanosoma brucei brucei
- Trypansoma brucei
- Persea americana (Avocado)
- Naja kaouthia (Monocled cobra)
- Trimeresurus stejnegeri (Chinese green tree viper)
- Allium cepa (Onion)
- Asparagus officinalis (Garden asparagus)
- Cocos nucifera (Coconut)
- Musa acuminata (Banana)
- Oryza sativa (Rice)
- Cherax quadricarinatus (Australian red claw crayfish)
- Pontastacus leptodactylus (Narrow-clawed crayfish)
- Friend mink cell focus-forming virus
- Friend murine leukemia virus (F-mulv)
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (anemia inducing strain)
- Friend spleen focus-forming virus (gm1 mutant)
- Friend spleen focus-forming virus (gm1.2 mutant)
- Friend spleen focus-forming virus (gm1.2.3 mutant)
- Friend spleen focus-forming virus (gm3.4 mutant)
- Human immunodeficiency virus (Hiv)
- Human immunodeficiency virus type 1 (HIV-1)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Arabidopsis thaliana (Thale cress)
- Arachis hypogaea (Peanut)
- Brassica oleracea var. botrytis (Cauliflower)
- Carica papaya (Papaya)
- Citrus sinensis (Orange)
- Corylus avellana (Hazelnut)
- Fragaria x ananassa (Strawberry)
- Glycine max (Soybean)
- Juglans regia (English walnut)
- Lupinus luteus (Yellow lupine)
- Malus domestica var. golden delicious (Cultivated apple - golden delicious)
- Phaseolus vulgaris (Kidney bean)
- Pistacia vera (Pistachio)
- Pisum sativum (Pea)
- Prunus dulcis var. sativa (Sweet almond)
- Pyrus communis var. williams (Pear)
- Ricinus communis (Castor bean)
- Vigna radiata var. radiata (Mung bean)
- Saccharomyces cerevisiae (Baker's yeast)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Marburg virus (strain musoke)
- Sendai virus (strain hvj)
- Human betacoronavirus 2c EMC/2012
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
- Riftia pachyptila (Giant tubeworm)
Taxonomy
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- Acid ceramidase / Homo sapiens Q13510
- Adenosine receptor A1 / Homo sapiens P30542
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-1-antichymotrypsin / Homo sapiens P01011
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Aminopeptidase n / Homo sapiens P15144
- Amphoterin-induced protein 2 / Homo sapiens Q86SJ2
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Arylsulfatase a / Homo sapiens P15289
- Arylsulfatase B / Homo sapiens P15848
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Attractin / Homo sapiens O75882
- Basal cell adhesion molecule / Homo sapiens P50895
- Basigin / Homo sapiens P35613
- Beta-galactosidase / Homo sapiens P16278
- Beta-hexosaminidase subunit alpha / Homo sapiens P06865
- Beta-hexosaminidase subunit beta / Homo sapiens P07686
- Beta-secretase / Homo sapiens P56817
- C-type mannose receptor 2 / Homo sapiens Q9UBG0
- Calreticulin / Homo sapiens P27797
- Carboxypeptidase D / Homo sapiens O75976
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens P13688
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens P31997
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Cartilage-associated protein / Homo sapiens O75718
- Cathepsin D / Homo sapiens P07339
- Cathepsin Z / Homo sapiens Q9UBR2
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens P20645
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD109 antigen / Homo sapiens Q6YHK3
- CD166 antigen / Homo sapiens Q13740
- Ceramide synthase 2 / Homo sapiens Q96G23
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Cleft lip and palate transmembrane protein 1 / Homo sapiens O96005
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Coagulation factor VIII / Homo sapiens P00451
- Collagen alpha-1(I) chain / Homo sapiens P02452
- Collagen alpha-1(III) chain / Homo sapiens P02461
- Collagen alpha-1(V) chain / Homo sapiens P20908
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(I) chain / Homo sapiens P08123
- Collagen alpha-2(V) chain / Homo sapiens P05997
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement C2 / Homo sapiens P06681
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- CUB domain-containing protein 1 / Homo sapiens Q9H5V8
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens Q6UXH1
- Decorin / Homo sapiens P07585
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Dipeptidyl peptidase 2 / Homo sapiens Q9UHL4
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens O14672
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens Q13443
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Dystroglycan / Homo sapiens Q14118
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens P22413
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens Q6P179
- Endoplasmin / Homo sapiens P14625
- Ephrin type-a receptor 2 / Homo sapiens P29317
- Ephrin type-B receptor 3 / Homo sapiens P54753
- Epidermal growth factor receptor / Homo sapiens P00533
- Epithelial cell adhesion molecule / Homo sapiens P16422
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens Q9BZQ6
- Erlin-1 / Homo sapiens O75477
- Erlin-2 / Homo sapiens O94905
- Extracellular sulfatase Sulf-1 / Homo sapiens Q8IWU6
- Fibrillin-1 / Homo sapiens P35555
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Fibroleukin / Homo sapiens Q14314
- Fibronectin / Homo sapiens P02751
- Follistatin-related protein 1 / Homo sapiens Q12841
- G-protein coupled receptor 98 / Homo sapiens Q8WXG9
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glucosylceramidase / Homo sapiens P04062
- Heat shock 70 kDa protein 13 / Homo sapiens P48723
- Hemopexin / Homo sapiens P02790
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens Q68CP4
- High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens P12314-2
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens P04440
- HLA class II histocompatibility antigen, DQ alpha 1 chain / Homo sapiens P01909
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- Hyaluronidase-4 / Homo sapiens Q2M3T9
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
- Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 / Homo sapiens Q58DX5
- Insulin receptor / Homo sapiens P06213
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-6 / Homo sapiens P23229
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Integrin beta-1 / Homo sapiens P05556
- Integrin beta-2 / Homo sapiens P05107
- Integrin beta-3 / Homo sapiens P05106
- Integrin beta-5 / Homo sapiens P18084
- Integrin beta-6 / Homo sapiens P18564
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon gamma / Homo sapiens P01579
- Keratin, type II cytoskeletal 8 / Homo sapiens P05787
- L-amino-acid oxidase / Homo sapiens Q96RQ9
- Lactadherin / Homo sapiens Q08431
- Lactoperoxidase / Homo sapiens P22079
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit gamma-1 / Homo sapiens P11047
- Legumain / Homo sapiens Q99538
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Lipase member J / Homo sapiens Q5W064
- Lipase member K / Homo sapiens Q5VXJ0
- Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens P12318-1
- Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens P31994-3
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens O75015
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens Q9NZR2
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens P98164
- Lumican / Homo sapiens P51884
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal acid phosphatase / Homo sapiens P11117
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal alpha-mannosidase / Homo sapiens O00754
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosomal protective protein / Homo sapiens P10619
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mammaglobin-A / Homo sapiens Q13296
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Mast/stem cell growth factor receptor Kit / Homo sapiens P10721
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Melanoma inhibitory activity protein 3 / Homo sapiens Q5JRA6
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Metal transporter CNNM4 / Homo sapiens Q6P4Q7
- Microfibril-associated glycoprotein 4 / Homo sapiens P55083
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Mucin-5B / Homo sapiens Q9HC84
- Mucolipin-3 / Homo sapiens Q8TDD5
- Myelin protein zero-like protein 2 / Homo sapiens O60487
- Myeloperoxidase / Homo sapiens P05164
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- N-acylethanolamine-hydrolyzing acid amidase / Homo sapiens Q02083
- Neurocan core protein / Homo sapiens O14594
- Neurofascin / Homo sapiens O94856
- Neuronal cell adhesion molecule / Homo sapiens Q92823
- Neutrophil gelatinase-associated lipocalin / Homo sapiens P80188
- Nicastrin / Homo sapiens Q92542
- Niemann-Pick C1 protein / Homo sapiens O15118
- Nuclear pore membrane glycoprotein 210 / Homo sapiens Q8TEM1
- Olfactomedin-4 / Homo sapiens Q6UX06
- P2X purinoceptor 4 / Homo sapiens Q99571
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens P55259
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens O95302
- Periostin / Homo sapiens Q15063
- Peroxidasin homolog / Homo sapiens Q92626
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Phospholipase D3 / Homo sapiens Q8IV08
- Pituitary tumor-transforming gene 1 protein-interacting protein / Homo sapiens P53801
- Plasminogen / Homo sapiens P00747
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Homo sapiens Q96AQ6
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Pro-epidermal growth factor / Homo sapiens P01133
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostaglandin G/H synthase 2 / Homo sapiens P35354
- Protein CREG1 / Homo sapiens O75629
- Protein FAM171A2 / Homo sapiens A8MVW0
- Protein O-mannose kinase / Homo sapiens Q9H5K3
- Protein OS-9 / Homo sapiens Q13438
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Putative phospholipase B-like 2 / Homo sapiens Q8NHP8
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens P21860
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens Q15262
- Secretogranin-3 / Homo sapiens Q8WXD2
- Seipin / Homo sapiens Q96G97
- Semaphorin-4D / Homo sapiens Q92854
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- Signal peptide peptidase-like 2A / Homo sapiens Q8TCT8
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens Q5TFQ8
- Sortilin-related receptor / Homo sapiens Q92673
- Sulfatase-modifying factor 1 / Homo sapiens Q8NBK3
- SUN domain-containing protein 2 / Homo sapiens Q9UH99
- Suppressor of tumorigenicity 14 protein / Homo sapiens Q9Y5Y6
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- T-cell surface antigen cd2 / Homo sapiens P06729
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Tenascin / Homo sapiens P24821
- Tetraspanin-1 / Homo sapiens O60635
- Tetraspanin-3 / Homo sapiens O60637
- Tetratricopeptide repeat protein 17 / Homo sapiens Q96AE7
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-3 / Homo sapiens P49746
- Thyroglobulin / Homo sapiens P01266
- Tissue-type plasminogen activator / Homo sapiens P00750
- TM2 domain-containing protein 3 / Homo sapiens Q9BRN9
- Torsin-1A-interacting protein 1 / Homo sapiens Q5JTV8
- Torsin-1B / Homo sapiens O14657
- Transferrin receptor protein 1 / Homo sapiens P02786
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Transmembrane protein 245 / Homo sapiens Q9H330
- Transmembrane protein 87A / Homo sapiens Q8NBN3
- Trophoblast glycoprotein / Homo sapiens Q13641
- Tumor necrosis factor receptor superfamily member 17 / Homo sapiens Q02223
- Tumor necrosis factor receptor superfamily member 5 / Homo sapiens P25942
- Tumor-associated calcium signal transducer 2 / Homo sapiens P09758
- Twisted gastrulation protein homolog 1 / Homo sapiens Q9GZX9
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens P78324
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized protein from Blood Serum / Homo sapiens
- UPF0577 protein KIAA1324 / Homo sapiens Q6UXG2
- Uromodulin / Homo sapiens P07911
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens Q7Z7D3
- V-type proton ATPase subunit S1 / Homo sapiens Q15904
- Vasorin / Homo sapiens Q6EMK4
- Vitronectin / Homo sapiens P04004
- Von willebrand factor / Homo sapiens P04275
- Zinc transporter ZIP6 / Homo sapiens Q13433
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Lactotransferrin / Bos taurus P24627
- Platelet glycoprotein IV / Bos taurus P26201
- Ribonuclease pancreatic [b] / Bos taurus P61823
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Acid ceramidase / Mus musculus Q9WV54
- Adhesion G protein-coupled receptor L1 / Mus musculus Q80TR1
- Aggrecan core protein / Mus musculus Q61282
- Alpha-L-iduronidase / Mus musculus P48441
- Aminopeptidase N / Mus musculus P97449
- Angiotensin-converting enzyme / Mus musculus P09470
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus Q8BSY0-3
- ATP-binding cassette sub-family A member 2 / Mus musculus P41234
- ATP-binding cassette sub-family A member 7 / Mus musculus Q91V24
- Attractin / Mus musculus Q9WU60
- Basigin / Mus musculus P18572
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Brevican core protein / Mus musculus Q61361
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- C-type lectin domain family 4 member A / Mus musculus Q9QZ15
- C-type mannose receptor 2 / Mus musculus Q64449
- Cadherin EGF LAG seven-pass G-type receptor 2 / Mus musculus Q9R0M0
- Cadherin-10 / Mus musculus P70408
- Cadherin-11 / Mus musculus P55288
- Cadherin-12 / Mus musculus Q5RJH3
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-18 / Mus musculus E9Q9Q6 E9Q941
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Carbonic anhydrase 4 / Mus musculus Q64444
- Cathepsin D / Mus musculus P18242
- Cathepsin L1 / Mus musculus P06797
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Ceramide synthase 6 / Mus musculus Q8C172
- Cerebellin-2 / Mus musculus Q8BGU2
- Choline transporter-like protein 1 / Mus musculus Q6X893
- Claudin domain-containing protein 1 / Mus musculus Q9CQX5
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus Q8VBZ3
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus Q8BXA5
- Clusterin / Mus musculus Q06890
- Complement C1q subcomponent subunit A / Mus musculus P98086
- Contactin-1 / Mus musculus P12960
- Contactin-2 / Mus musculus Q61330
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- CUB and sushi domain-containing protein 1 / Mus musculus Q923L3
- CUB and sushi domain-containing protein 3 / Mus musculus Q80T79
- Cystatin-C / Mus musculus P21460
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus Q8JZM4
- Dickkopf-related protein 3 / Mus musculus Q9QUN9
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus O35598
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus Q9R1V7
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus Q91YQ5
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus P46978
- Dopamine beta-hydroxylase / Mus musculus Q64237
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus Q4VA61
- Dyslexia-associated protein KIAA0319-like protein / Mus musculus Q8K135
- E3 ubiquitin-protein ligase RNF130 / Mus musculus Q8VEM1
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus O55026
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus Q8BGN3
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus Q3UZV7
- Endothelin-converting enzyme 1 / Mus musculus Q4PZA2
- Ephrin-A3 / Mus musculus O08545
- ER membrane protein complex subunit 1 / Mus musculus Q8C7X2
- ER membrane protein complex subunit 10 / Mus musculus Q3TAS6
- ERO1-like protein alpha / Mus musculus Q8R180
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Fibroblast growth factor receptor / Mus musculus Q61851
- G-protein coupled receptor 56 / Mus musculus Q8K209
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus Q9CW73
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus Q9D6F4
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus Q8BHJ7
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus P63137
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyl hydrolase / Mus musculus Q9Z0L8
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Glutamate receptor 1 / Mus musculus P23818
- Glutamate receptor 2 / Mus musculus P23819
- Glutamate receptor 3 / Mus musculus Q9Z2W9
- Glutamate receptor ionotropic, kainate 2 / Mus musculus P39087
- Glutamate receptor ionotropic, kainate 3 / Mus musculus B1AS29
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- GPI inositol-deacylase / Mus musculus Q3UUQ7
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Heat shock 70 kDa protein 13 / Mus musculus Q8BM72
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Iduronate 2-sulfatase / Mus musculus Q08890
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Insulin receptor / Mus musculus P15208
- Integrin alpha 7 / Mus musculus Q61738
- Integrin alpha-1 / Mus musculus Q3V3R4
- Integrin alpha-V / Mus musculus P43406
- Integrin beta-1 / Mus musculus P09055
- Integrin beta-2 / Mus musculus P11835
- Integrin beta-8 / Mus musculus Q0VBD0
- Interferon beta / Mus musculus P01575
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus P59823
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Isoform 2 of Adhesion G protein-coupled receptor L2 / Mus musculus Q8JZZ7-2
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2 of Catenin delta-1 / Mus musculus P30999-2
- Isoform 2 of Integrin alpha-3 / Mus musculus Q62470-2
- Isoform 2 of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 / Mus musculus Q8BXA0-2
- Isoform 2 of Teneurin-3 / Mus musculus Q9WTS6-2
- Isoform 2 of TM2 domain-containing protein 1 / Mus musculus Q99MB3-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Lactosylceramide alpha-2,3-sialyltransferase / Mus musculus O88829
- Laminin subunit alpha-5 / Mus musculus Q61001
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucine zipper protein 2 / Mus musculus Q8BGY3
- Leucine-rich repeat-containing protein 55 / Mus musculus Q3UY51
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukemia inhibitory factor receptor / Mus musculus P42703
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal thioesterase PPT2 / Mus musculus O35448
- Lysosome membrane protein 2 / Mus musculus O35114
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 5 / Mus musculus Q9D387
- Major prion protein / Mus musculus P04925
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus Q0PMG2
- Melanoma inhibitory activity protein 3 / Mus musculus Q8BI84
- Membralin / Mus musculus Q8CIV2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Mucin / Mus musculus
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus P60882
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus Q9Z2L6
- Myelin-associated glycoprotein / Mus musculus P20917
- N-acetylglucosamine-6-sulfatase / Mus musculus Q8BFR4
- Netrin receptor DCC / Mus musculus P70211
- Neural cell adhesion molecule 1 / Mus musculus P13595
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurocan core protein / Mus musculus P55066
- Neuroendocrine convertase 2 / Mus musculus P21661
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal growth regulator 1 / Mus musculus Q80Z24
- Neuronal pentraxin receptor / Mus musculus Q99J85
- Neuronal pentraxin-1 / Mus musculus Q62443
- Neuroplastin / Mus musculus P97300
- Neutral cholesterol ester hydrolase 1 / Mus musculus Q8BLF1
- Nicastrin / Mus musculus P57716
- Nuclear pore membrane glycoprotein 210 / Mus musculus Q9QY81
- Nucleotide exchange factor SIL1 / Mus musculus Q9EPK6
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- P2X purinoceptor 7 / Mus musculus Q9Z1M0
- Palmitoyl-protein thioesterase 1 / Mus musculus O88531
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus Q9Z247
- Phosphatidylcholine-sterol acyltransferase / Mus musculus P16301
- Phospholipase D3 / Mus musculus O35405
- Plexin-A2 / Mus musculus P70207
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Mus musculus Q3TVI8
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Pro-neuregulin-2, membrane-bound isoform / Mus musculus P56974
- Probable C-mannosyltransferase DPY19L4 / Mus musculus A2AJQ3
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus Q9R0E1
- Proenkephalin-A / Mus musculus P22005
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin g/h synthase 2 / Mus musculus Q05769
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Protein EVI2A / Mus musculus P20934
- Protein FAM171A2 / Mus musculus A2A699
- Protein FAM234B / Mus musculus Q8BYI8
- Protein kinase C-binding protein NELL2 / Mus musculus Q61220
- Protein NOV homolog / Mus musculus Q64299
- Protein O-glucosyltransferase 1 / Mus musculus Q8BYB9
- Protein O-mannosyl-transferase 1 / Mus musculus Q8R2R1
- Protein OS-9 / Mus musculus Q8K2C7
- Protein sel-1 homolog 1 / Mus musculus Q9Z2G6
- Protocadherin Fat 1 / Mus musculus F2Z4A3
- Protocadherin Fat 2 / Mus musculus Q5F226
- Protocadherin-16 / Mus musculus E9PVD3
- Protocadherin-9 / Mus musculus A0A0A6YY09
- Receptor tyrosine-protein kinase erbB-3 / Mus musculus Q61526
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus Q64487
- Receptor-type tyrosine-protein phosphatase kappa / Mus musculus P35822
- Reelin / Mus musculus Q60841
- Reticulocalbin-1 / Mus musculus Q05186
- Retinal-specific ATP-binding cassette transporter / Mus musculus O35600
- Sacsin / Mus musculus Q9JLC8
- Seipin / Mus musculus Q9Z2E9
- Semaphorin-3E / Mus musculus P70275
- Semaphorin-4A / Mus musculus Q62178
- Semaphorin-4D / Mus musculus O09126
- Semaphorin-7A / Mus musculus Q9QUR8
- Serpin H1 / Mus musculus P19324
- Serum paraoxonase/arylesterase 2 / Mus musculus Q62086
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus Q64689
- SID1 transmembrane family member 1 / Mus musculus Q6AXF6
- Signal peptide, CUB and EGF-like domain-containing protein 1 / Mus musculus Q6NZL8
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium channel subunit beta-4 / Mus musculus Q7M729
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Solute carrier family 12 member 5 / Mus musculus Q91V14
- Sortilin / Mus musculus Q6PHU5
- Sortilin-related receptor / Mus musculus O88307
- SPARC / Mus musculus P07214
- SPARC-like protein 1 / Mus musculus P70663
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus Q6GQT6
- Stromal interaction molecule 1 / Mus musculus P70302
- Sulfatase-modifying factor 1 / Mus musculus Q8R0F3
- SUN domain-containing ossification factor / Mus musculus Q8C341
- SUN domain-containing protein 2 / Mus musculus Q8BJS4
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- Synaptotagmin-1 / Mus musculus P46096
- Teneurin-2 / Mus musculus Q9WTS5
- Testican-2 / Mus musculus Q9ER58
- Tetraspanin-3 / Mus musculus Q9QY33
- Thioredoxin domain-containing protein 15 / Mus musculus Q6P6J9
- Thrombospondin type-1 domain-containing protein 4 / Mus musculus Q3UTY6
- Thrombospondin type-1 domain-containing protein 7B / Mus musculus Q6P4U0
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Torsin-1A-interacting protein 1 / Mus musculus Q921T2
- Torsin-1B / Mus musculus Q9ER41
- Transferrin receptor protein 1 / Mus musculus Q62351
- Translocon-associated protein subunit alpha / Mus musculus Q9CY50
- Translocon-associated protein subunit beta / Mus musculus Q9CPW5
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus Q8BG19
- Transmembrane emp24 domain-containing protein 4 / Mus musculus Q8R1V4
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane prolyl 4-hydroxylase / Mus musculus Q8BG58
- Transmembrane protein 106B / Mus musculus Q80X71
- Transmembrane protein 106C / Mus musculus Q80VP8
- Transmembrane protein 131 / Mus musculus O70472
- Transmembrane protein 178B / Mus musculus M0QWJ9
- Transmembrane protein 62 / Mus musculus Q8BXJ9
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Trophoblast glycoprotein / Mus musculus Q9Z0L0
- Tyrosine-protein kinase Mer / Mus musculus Q60805
- Uncharacterized family 31 glucosidase KIAA1161 / Mus musculus Q69ZQ1
- Uncharacterized protein / Mus musculus
- Uncharacterized protein C11orf87 homolog / Mus musculus Q32M26
- V-type proton ATPase subunit S1 / Mus musculus Q9R1Q9
- VIP36-like protein / Mus musculus P59481
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Zinc finger protein 521 / Mus musculus Q6KAS7
- Zinc transporter ZIP10 / Mus musculus Q6P5F6
- Zona pellucida sperm-binding protein matrix / Mus musculus Q62005 P10761 P20239
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Uncharacterized protein / Rattus norvegicus
- Coagulation factor VIII / Sus scrofa P12263
- Thyroglobulin / Sus scrofa
- Ascorbate oxidase / Acremonium sp. HI-25
- Uncharacterized protein / Actinidia chinensis
- Uncharacterized protein / Apium graveolens var. oulce
- Art v II / Artemisia vulgaris
- Uncharacterized protein / Daucus carota
- Uncharacterized protein / Lycopersicon esculentum
- Ribonuclease s-3 / Nicotiana alata O24103
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ribonuclease s-7 / Nicotiana alata Q40381
- Uncharacterized protein / Nicotiana tabacum
- Uncharacterized protein / Nicotiana tabacum
- Major protein allergan / Olea europaea P19963
- Uncharacterized protein / Solanum tuberosum
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin y / Gallus gallus
- Ovalbumin / Gallus gallus P01012
- Uncharacterized protein / Physomitrella patens
- Calreticulin / Spinacia oleracea A0A0K9QF27
- Uncharacterized protein / Fagopyrum esculentum
- Uncharacterized protein / Caenorhabditis elegans
- Uncharacterized protein / Caenorhabditis elegans
- Uncharacterized protein / Pinus pinea
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Alpha-glucosidase / Aspergillus niger P56526
- Endopolygalacturonase II / Aspergillus niger P26214
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Uncharacterized protein / Agaricus bisporus
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Apisin / Apis mellifera O18330
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Leishmanolysin / Leishmania amazonensis Q27673
- Leishmanolysin / Leishmania donovani P23223
- Leishmanolysin / Leishmania major P08148
- Leishmanolysin c1 / Leishmania mexicana P43150
- Leishmanolysin / Leishmania tropica Q8MNZ1
- Uncharacterized protein / Leptomonas Samueli
- Uncharacterized protein / Trypanosoma brucei brucei
- Uncharacterized protein / Trypanosoma brucei brucei
- Uncharacterized protein / Trypanosoma brucei brucei
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei P26334
- Variant surface glycoprotein mitat 1.4a / Trypansoma brucei P02896
- Uncharacterized protein / Persea americana
- Cobra venom factor / Naja kaouthia Q91132
- Galactose-binding lectin / Trimeresurus stejnegeri Q9YGP1
- Uncharacterized protein / Allium cepa
- Uncharacterized protein / Asparagus officinalis
- Uncharacterized protein / Cocos nucifera
- Uncharacterized protein / Musa acuminata
- Alpha-amylase / Oryza sativa P17654
- Vitellogenin / Cherax quadricarinatus Q9GSG2
- Hemocyanin / Pontastacus leptodactylus P83180
- Envelope glycoprotein / Friend mink cell focus-forming virus
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus P03393
- Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) P03393
- Surface protein gp120 / Human immunodeficiency virus
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Uncharacterized protein / Arabidopsis thaliana
- Uncharacterized protein / Arabidopsis thaliana
- Uncharacterized protein / Arachis hypogaea
- Uncharacterized protein / Brassica oleracea var. botrytis
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Citrus sinensis
- Uncharacterized protein / Corylus avellana
- Uncharacterized protein / Fragaria x ananassa
- Uncharacterized protein / Glycine max
- Uncharacterized protein / Juglans regia
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Uncharacterized protein / Malus domestica var. golden delicious
- Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris P02873
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Phaseolin, alpha-type / Phaseolus vulgaris P07219
- Phaseolin, beta-type / Phaseolus vulgaris P02853
- Uncharacterized protein / Phaseolus vulgaris
- Uncharacterized protein / Pistacia vera
- Uncharacterized protein / Pisum sativum
- Uncharacterized protein / Prunus dulcis var. sativa
- Uncharacterized protein / Pyrus communis var. williams
- Uncharacterized protein / Ricinus communis
- Uncharacterized protein / Ricinus communis
- Uncharacterized protein / Vigna radiata var. radiata
- Invertase [secreted form] / Saccharomyces cerevisiae
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Hemagglutinin-neuraminidase / Sendai virus (strain hvj) P04853
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Uncharacterized protein / Schistosoma mansoni
- Hemoglobin extracellular / Riftia pachyptila
Protein
- Allantois (UBERON_0004340)
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Cerebrospinal Fluid (UBERON_0001359)
- Coelomic Fluid (UBERON_0036217)
- Colon (UBERON_0001155)
- Colostrum (UBERON_0001914)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Hemolymph (UBERON_0001011)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) NRK (CVCL_3758) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911) C127 (CVCL_6550)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G2 (CVCL_VT69)
- Ovary (UBERON_0000992) IM4/V/IV-G3 (CVCL_VT70)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992) Lec1 (CVCL_3440)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Prefrontal Cortex (UBERON:0000451)
- Retina (UBERON_0000966)
- Royal Jelly
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Thyroid (UBERON_0002046)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BT-474 (CVCL_0179)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- BW5147 (CVCL_3896) Leukocyte (CL_0000738)
- BW5147.PHAR2.7 (CVCL_VT60) Leukocyte (CL_0000738)
- CHO (CVCL_0213)
- CHO-S (CVCL_7183)
- Detroit 551 (CVCL_2434)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293SF-3F6 (CVCL_4V95)
- HEK293T (CVCL_0063)
- HT-1080 (CVCL_0317)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Jurkat (CVCL_0065)
- LS174T (CVCL_1384)
- MCF-7 (CVCL_0031)
- NCI-H929 (CVCL_1600)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- NS0 (CVCL_3940)
- Rat1 (CVCL_0492)
- SK-BR-3 (CVCL_0033)
- SPC-Mb-92-C6 (CVCL_VT62)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Delipidated Cell
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Cotyledon (BTO_0000300)
- Endosperm (BTO_0000390)
- Floret (BTO_0000468)
- Fruit (BTO_0000486)
- Leaf (BTO_0000713)
- Pollen (BTO_0001097)
- Root (BTO_0001188)
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Tuber (BTO_0001400)
- Low-Density Lipoprotein Particle (GO_0034362)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / High-Mannose / Structure 314
- N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Galf(b1-2)[Man(a1-3)][Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(?1-?)[Man(?1-?)]Man(a1-6)[Man(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(?1-?)"
- N-Linked / High-Mannose / Man(?1-?)[Man(?1-?)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)[Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-?)"
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 3542
- N-Linked / High-Mannose / Structure 3572
- N-Linked / High-Mannose / Structure 9623
- N-Linked / High-Mannose / Structure 10291
- N-Linked / High-Mannose / Structure 10418
- N-Linked / High-Mannose / Structure 10542
- N-Linked / High-Mannose / Structure 11130
- N-Linked / High-Mannose / Structure 11425
- N-Linked / High-Mannose / Structure 11601
- N-Linked / High-Mannose / Structure 11911
- N-Linked / High-Mannose / Structure 11946
- N-Linked / Undefined core / Structure 9584
- N-Linked / Undefined core / Structure 9822
- N-Linked / Undefined core / Structure 9886
Reported structure
- Hex:7 HexNAc:2 (avg mass : 1559.4021 )
Composition
- Alzheimer's disease (DOID:10652)
- Atopic dermatitis (DOID:3310)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Erythroleukemia with associated Polycythemia
- Esophageal cancer (DOID:5041)
- Gastritis (DOID:4029)
- Hyper IgE syndrome (DOID:0080545)
- Hypercholesterolemia, Familial (DOID:13810)
- Hyperimmune condition
- Hypersensitivity reaction disease (DOID:0060056)
- IgE myeloma (DOID:9538)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Lymphoma (DOID:0060058)
- Mannosidosis, alpha (DOID:3413)
- Middle East respiratory syndrome (DOID:0080642)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Prostate cancer (DOID:10283)
- Schizophrenia (DOID:5419)
- T-cell childhood acute lymphocytic leukemia (DOID:0080145)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- Malignant tissues produce divergent antibody glycosylation of relevance for cancer gene therapy effectiveness. (2020 - Brücher D, Franc V, Smith SN, Heck AJR, Plückthun A) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Expression and glycoengineering of functionally active heteromultimeric IgM in plants (2014 - Loos A, Gruber C, Altmann F, Mehofer U, Hensel F, Grandits M, Oostenbrink C, Stadlmayr G, Furtmüller PG, Steinkellner H) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention. (2013 - Huang HW, Chen CH, Lin CH, Wong CH, Lin KI) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- Structural characterization of the N-glycan moiety and site of glycosylation in vitellogenin from the decapod crustacean Cherax quadricarinatus. (2004 - Khalaila I, Peter-Katalinic J, Tsang C, Radcliffe CM, Aflalo ED, Harvey DJ, Dwek RA, Rudd PM, Sagi A) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycan structures of mouse interferon-beta produced by Bombyx mori larvae. (2003 - Misaki R, Nagaya H, Fujiyama K, Yanagihara I, Honda T, Seki T) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Tandem mass spectrometry of ribonuclease A and B: N-linked glycosylation site analysis of whole protein ions (2002 - Reid, Stephenson, McLuckey) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
- Glycoproteins secreted from suspension-cultured tobacco BY2 cells have distinct glycan structures from intracellular glycoproteins. (2001 - Misaki R, Kimura Y, Fujiyama K, Seki T) / Status : Reviewed
- N-linked oligosaccharides of cobra venom factor contain novel alpha(1-3)galactosylated Le(x) structures. (2001 - Gowda DC, Glushka J, van-Halbeek H , Thotakura RN, Bredehorst R, Vogel C-W) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- The nematode Caenorhabditis elegans synthesizes unusual O-linked glycans: identification of glucose-substituted mucin-type O-glycans and short chondroitin-like oligosaccharides (2001 - Guerardel, Balanzino, Maes, Leroy, Coddeville, Oriol, Strecker) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Comparative study of the N-glycans of human monoclonal immunoglobulins M produced by hybridoma and parental cells. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Nagatomi Y, Asanagi M, Shimazaki Y, Makino T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- N-Glycan analysis by matrix-assisted laser desorption/ionization mass spectrometry of electrophoretically separated nonmammalian proteins: application to peanut allergen Ara h 1 and olive pollen allergen Ole e 1. (2000 - Kolarich D, Altmann F) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Analysis of carbohydrate heterogeneity in a glycoprotein using liquid chromatography/mass spectrometry and liquid chromatography with tandem mass spectrometry. (1999 - Kawasaki N, Ohta M, Hyuga S, Hashimoto O, Hayakawa T) / Status : Reviewed
- Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
- Characterization and analysis of a novel glycoprotein from snake venom using liquid chromatography-electrospray mass spectrometry and Edman degradation. (1999 - Zeng R, Xu Q, Shao X, Wang K, Xia Q) / Status : Reviewed
- Glycosylation sites and site-specific glycosylation in human Tamm-Horsfall glycoprotein. (1999 - van Rooijen J, Voskamp A, Kamerling J, Vliegenthart J) / Status : Reviewed
- Characterization of N-glycans from Arabidopsis. Application to a fucose-deficient mutant. (1999 - Rayon C, Cabanes-Macheteau M, Loutelier-Bourhis C, Salliot-Maire I, Lemoine J, Reiter W, Lerouge P, Faye L) / Status : Reviewed
- Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
- Structure and distribution of N-glycans on the S7-allele stylar self-incompatibility ribonuclease of Nicotiana alata. (1998 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- A unique, terminally glucosylated oligosaccharide is a common feature on Leishmania cell surfaces (1997 - Funk VA, Thomas-Oates JE, Kielland SL, Bates PA, Olafson RW) / Status : Reviewed
- Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Primary structure of the N-linked carbohydrate chains of Calreticulin from spinach leaves. (1996 - Navazio L, Baldan B, Mariani P, Gerwig G, Vliegenthart J) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
- The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
- Characterization of asparagine-linked oligosaccharides on a mouse submandibular mucin. (1995 - Denny P, Hong-Le N) / Status : Reviewed
- N-linked sugar chains of 350-kDa royal jelly glycoprotein. (1995 - Kimura Y, Washino N, Yonekura M) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
- Glycosylation of glycoprotein 55 encoded by the anaemia-inducing strain of Friend spleen focus-forming virus. (1994 - Volker J, Geyer H, Geyer R) / Status : Reviewed
- A detailed structural characterization of ribonuclease B oligosaccharides by 1H NMR spectroscopy and mass spectrometry. (1994 - Fu D, Chen L, O'Neill R) / Status : Reviewed
- Novel structures of N-linked high-mannose type oligosaccharides containing alpha-D-galactofuranosyl linkages in Aspergillus niger alpha-D-glucosidase. (1994 - Takayanagi T, Kimura A, Chiba S, Ajisaka K) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Glycosylation of recombinant prorenin in insect cells: the insect cell line Sf9 does not express the mannose 6-phosphate recognition signal. (1994 - Aeed P, Elhammer A) / Status : Reviewed
- The carbohydrate structures of Trypanosoma brucei brucei MITat 1.6 variant surface glycoprotein. A re-investigation of the C-terminal glycan. (1993 - Strang A, Allen A, Holder A, van Halbeek H) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Isolation of oligomannose-type glycans from bean glycoproteins. (1993 - Lu Y, Ye J, Wold F) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- The conformational effects of N-glycosylation on the tailpiece from serum IgM. (1991 - Wormald M, Wooten E, Bazzo R, Edge C, Feinstein A, Rademacher T, Dwek R) / Status : Reviewed
- Structural analysis of the glycoprotein allergen Art v II from the pollen of mugwort (Artemisia vulgaris L.). (1991 - Nilsen B, Sletten K, Paulsen B, O'Neill M, van Halbeek H) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structure and biosynthesis of the xylose-containing carbohydrate moiety of rice alpha-amylase. (1990 - Hayashi M, Tsuru A, Mitsui T, Takahashi N, Hanzawa H, Arata Y, Akazawa T) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Structures of sugar chains of water-soluble glycoproteins in developing castor bean cotyledons. (1990 - Kimura Y, Suehisa H, Yamaguchi O, Nakajima S, Takagi S) / Status : Reviewed
- Pregnancy-associated changes in oligomannose oligosaccharides of human and bovine uromodulin (Tamm-Horsfall glycoprotein). (1990 - Smagula R, Van Halbeek H, Decker J, Muchmore A, Moody C, Sherblom A) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Characterisation of the asparagine-linked oligosaccharides from Trypanosoma brucei type-I variant surface glycoproteins. (1990 - Zamze SE, Wooten EW, Ashford DA, Ferguson MA, Dwek RA, Rademacher TW) / Status : Reviewed
- Structures of the N-linked oligosaccharides of Gp63, the major surface glycoprotein, from Leishmania mexicana amazonensis. (1990 - Olafson R, Thomas J, Ferguson M, Dwek R, Chaudhuri M, Chang K, Rademacher T) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
- Carbohydrate structure of recombinant human uterine tissue plasminogen activator expressed in mouse epithelial cells. (1989 - Pfeiffer G, Schmidt M, Strube K, Geyer R) / Status : Reviewed
- Characterization of the high mannose asparagine-linked oligosaccharides synthesized by Schistosoma mansoni adult male worms. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
- Structure, position, and biosynthesis of the high mannose and the complex oligosaccharide side chains of the bean storage protein phaseolin. (1987 - Sturm A, Van Kuik J, Vliegenthart J, Chrispeels M) / Status : Reviewed
- Identification method for twelve oligomannose-type sugar chains thought to be processing intermediates of glycoproteins. (1987 - Hase S, Natsuka S, Oku H, Ikenaka T) / Status : Reviewed
- High-mannose structure of apolipoprotein-B from low-density lipoproteins of human plasma. (1985 - Vauhkonen M, Viitala J, Parkkinen J, Rauvala H) / Status : Reviewed
- The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
- Carbohydrate structures of HVJ (Sendai virus) glycoproteins. (1981 - Yoshima H, Nakanishi M, Okada Y, Kobata A) / Status : Reviewed
Reference
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- Acid ceramidase / Homo sapiens
- Adenosine receptor A1 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-1-antichymotrypsin / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Aminopeptidase n / Homo sapiens
- Amphoterin-induced protein 2 / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
- Asn-185
- Apolipoprotein D / Homo sapiens
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Arylsulfatase B / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- Attractin / Homo sapiens
- Basal cell adhesion molecule / Homo sapiens
- Basigin / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Beta-hexosaminidase subunit alpha / Homo sapiens
- Beta-hexosaminidase subunit beta / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- C-type mannose receptor 2 / Homo sapiens
- Calreticulin / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 1 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 8 / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cartilage-associated protein / Homo sapiens
- Cathepsin D / Homo sapiens
- Cathepsin Z / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Cleft lip and palate transmembrane protein 1 / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Collagen alpha-1(I) chain / Homo sapiens
- Collagen alpha-1(III) chain / Homo sapiens
- Collagen alpha-1(V) chain / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(I) chain / Homo sapiens
- Collagen alpha-2(V) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement C2 / Homo sapiens
-
Complement c3 / Homo sapiens
- Undefined site
- Asn-85
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- CUB domain-containing protein 1 / Homo sapiens
- Cysteine-rich with EGF-like domain protein 2 / Homo sapiens
- Decorin / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Dipeptidyl peptidase 2 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 9 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Dystroglycan / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 1 / Homo sapiens
- Endoplasmic reticulum aminopeptidase 2 / Homo sapiens
- Endoplasmin / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Ephrin type-B receptor 3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- Epithelial cell adhesion molecule / Homo sapiens
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens
- Erlin-1 / Homo sapiens
- Erlin-2 / Homo sapiens
- Extracellular sulfatase Sulf-1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibronectin / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- G-protein coupled receptor 98 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Heat shock 70 kDa protein 13 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
-
High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
- Undefined site
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- HLA class II histocompatibility antigen, DP beta 1 chain / Homo sapiens
- HLA class II histocompatibility antigen, DQ alpha 1 chain / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- Hyaluronidase-4 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin alpha (non secretory) / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
- Asn-275
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-225
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
- Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 / Homo sapiens
- Insulin receptor / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-6 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Integrin beta-3 / Homo sapiens
- Integrin beta-5 / Homo sapiens
- Integrin beta-6 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Keratin, type II cytoskeletal 8 / Homo sapiens
- L-amino-acid oxidase / Homo sapiens
- Lactadherin / Homo sapiens
- Lactoperoxidase / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Legumain / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lipase member J / Homo sapiens
- Lipase member K / Homo sapiens
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
- Asn-180
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens
- Lumican / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal alpha-mannosidase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosomal protective protein / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Mast/stem cell growth factor receptor Kit / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Melanoma inhibitory activity protein 3 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Metal transporter CNNM4 / Homo sapiens
- Microfibril-associated glycoprotein 4 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Mucin-5B / Homo sapiens
- Mucolipin-3 / Homo sapiens
- Myelin protein zero-like protein 2 / Homo sapiens
- Myeloperoxidase / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- N-acylethanolamine-hydrolyzing acid amidase / Homo sapiens
- Neurocan core protein / Homo sapiens
- Neurofascin / Homo sapiens
- Neuronal cell adhesion molecule / Homo sapiens
- Neutrophil gelatinase-associated lipocalin / Homo sapiens
- Nicastrin / Homo sapiens
- Niemann-Pick C1 protein / Homo sapiens
- Nuclear pore membrane glycoprotein 210 / Homo sapiens
- Olfactomedin-4 / Homo sapiens
- P2X purinoceptor 4 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Pancreatic secretory granule membrane major glycoprotein GP2 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
- Periostin / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- Pituitary tumor-transforming gene 1 protein-interacting protein / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Pro-epidermal growth factor / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl 3-hydroxylase 1 / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Prostaglandin G/H synthase 2 / Homo sapiens
- Protein CREG1 / Homo sapiens
- Protein FAM171A2 / Homo sapiens
- Protein O-mannose kinase / Homo sapiens
- Protein OS-9 / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Putative phospholipase B-like 2 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-3 / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Asn-470
- Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
- Secretogranin-3 / Homo sapiens
- Seipin / Homo sapiens
- Semaphorin-4D / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sialate O-acetylesterase / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
- Signal peptide peptidase-like 2A / Homo sapiens
- Signal-regulatory protein beta-1 isoform 3 / Homo sapiens
- Sortilin-related receptor / Homo sapiens
- Sulfatase-modifying factor 1 / Homo sapiens
- SUN domain-containing protein 2 / Homo sapiens
- Suppressor of tumorigenicity 14 protein / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
-
T-cell surface antigen cd2 / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Tenascin / Homo sapiens
- Tetraspanin-1 / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Tetratricopeptide repeat protein 17 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-3 / Homo sapiens
- Thyroglobulin / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- TM2 domain-containing protein 3 / Homo sapiens
- Torsin-1A-interacting protein 1 / Homo sapiens
- Torsin-1B / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Transmembrane protein 245 / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
- Trophoblast glycoprotein / Homo sapiens
- Tumor necrosis factor receptor superfamily member 17 / Homo sapiens
- Tumor necrosis factor receptor superfamily member 5 / Homo sapiens
- Tumor-associated calcium signal transducer 2 / Homo sapiens
- Twisted gastrulation protein homolog 1 / Homo sapiens
- Tyrosine-protein phosphatase non-receptor type substrate 1 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- UPF0577 protein KIAA1324 / Homo sapiens
-
Uromodulin / Homo sapiens
- Undefined site
- Asn-275
- V-set domain-containing T-cell activation inhibitor 1 / Homo sapiens
- V-type proton ATPase subunit S1 / Homo sapiens
- Vasorin / Homo sapiens
- Vitronectin / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc transporter ZIP6 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Lactotransferrin / Bos taurus
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Ribonuclease pancreatic [b] / Bos taurus
- Undefined site
- Asn-60
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor L1 / Mus musculus
- Aggrecan core protein / Mus musculus
- Alpha-L-iduronidase / Mus musculus
- Aminopeptidase N / Mus musculus
- Angiotensin-converting enzyme / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- ATP-binding cassette sub-family A member 2 / Mus musculus
- ATP-binding cassette sub-family A member 7 / Mus musculus
- Attractin / Mus musculus
- Basigin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Brevican core protein / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- C-type lectin domain family 4 member A / Mus musculus
- C-type mannose receptor 2 / Mus musculus
- Cadherin EGF LAG seven-pass G-type receptor 2 / Mus musculus
- Cadherin-10 / Mus musculus
- Cadherin-11 / Mus musculus
- Cadherin-12 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-18 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Carbonic anhydrase 4 / Mus musculus
- Cathepsin D / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Ceramide synthase 6 / Mus musculus
- Cerebellin-2 / Mus musculus
- Choline transporter-like protein 1 / Mus musculus
- Claudin domain-containing protein 1 / Mus musculus
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
- Clusterin / Mus musculus
- Complement C1q subcomponent subunit A / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- CUB and sushi domain-containing protein 1 / Mus musculus
- CUB and sushi domain-containing protein 3 / Mus musculus
- Cystatin-C / Mus musculus
- Delta and Notch-like epidermal growth factor-related receptor / Mus musculus
- Dickkopf-related protein 3 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus
- Dopamine beta-hydroxylase / Mus musculus
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus
- Dyslexia-associated protein KIAA0319-like protein / Mus musculus
- E3 ubiquitin-protein ligase RNF130 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus
- Endothelin-converting enzyme 1 / Mus musculus
- Ephrin-A3 / Mus musculus
- ER membrane protein complex subunit 1 / Mus musculus
- ER membrane protein complex subunit 10 / Mus musculus
- ERO1-like protein alpha / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Fibroblast growth factor receptor / Mus musculus
- G-protein coupled receptor 56 / Mus musculus
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyl hydrolase / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor 1 / Mus musculus
- Glutamate receptor 2 / Mus musculus
- Glutamate receptor 3 / Mus musculus
- Glutamate receptor ionotropic, kainate 2 / Mus musculus
- Glutamate receptor ionotropic, kainate 3 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI inositol-deacylase / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Heat shock 70 kDa protein 13 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
- Hypoxia up-regulated protein 1 / Mus musculus
- Iduronate 2-sulfatase / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Insulin receptor / Mus musculus
- Integrin alpha 7 / Mus musculus
- Integrin alpha-1 / Mus musculus
- Integrin alpha-V / Mus musculus
- Integrin beta-1 / Mus musculus
- Integrin beta-2 / Mus musculus
- Integrin beta-8 / Mus musculus
-
Interferon beta / Mus musculus
- Undefined site
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L2 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2 of Catenin delta-1 / Mus musculus
- Isoform 2 of Integrin alpha-3 / Mus musculus
- Isoform 2 of Leucine-rich repeat and fibronectin type-III domain-containing protein 5 / Mus musculus
- Isoform 2 of Teneurin-3 / Mus musculus
- Isoform 2 of TM2 domain-containing protein 1 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Lactosylceramide alpha-2,3-sialyltransferase / Mus musculus
- Laminin subunit alpha-5 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine zipper protein 2 / Mus musculus
- Leucine-rich repeat-containing protein 55 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukemia inhibitory factor receptor / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal thioesterase PPT2 / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 5 / Mus musculus
- Major prion protein / Mus musculus
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus
- Melanoma inhibitory activity protein 3 / Mus musculus
- Membralin / Mus musculus
- Metal transporter CNNM4 / Mus musculus
-
Mucin / Mus musculus
- Undefined site
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus
- Multiple inositol polyphosphate phosphatase 1 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- N-acetylglucosamine-6-sulfatase / Mus musculus
- Netrin receptor DCC / Mus musculus
- Neural cell adhesion molecule 1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neuroendocrine convertase 2 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Neuronal pentraxin receptor / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Neuroplastin / Mus musculus
- Neutral cholesterol ester hydrolase 1 / Mus musculus
- Nicastrin / Mus musculus
- Nuclear pore membrane glycoprotein 210 / Mus musculus
- Nucleotide exchange factor SIL1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- P2X purinoceptor 7 / Mus musculus
- Palmitoyl-protein thioesterase 1 / Mus musculus
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus
- Phosphatidylcholine-sterol acyltransferase / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A2 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Pre-B-cell leukemia transcription factor-interacting protein 1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Pro-neuregulin-2, membrane-bound isoform / Mus musculus
- Probable C-mannosyltransferase DPY19L4 / Mus musculus
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus
- Proenkephalin-A / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin g/h synthase 2 / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protein EVI2A / Mus musculus
- Protein FAM171A2 / Mus musculus
- Protein FAM234B / Mus musculus
- Protein kinase C-binding protein NELL2 / Mus musculus
- Protein NOV homolog / Mus musculus
- Protein O-glucosyltransferase 1 / Mus musculus
- Protein O-mannosyl-transferase 1 / Mus musculus
- Protein OS-9 / Mus musculus
- Protein sel-1 homolog 1 / Mus musculus
- Protocadherin Fat 1 / Mus musculus
- Protocadherin Fat 2 / Mus musculus
- Protocadherin-16 / Mus musculus
- Protocadherin-9 / Mus musculus
- Receptor tyrosine-protein kinase erbB-3 / Mus musculus
- Receptor-type tyrosine-protein phosphatase delta / Mus musculus
- Receptor-type tyrosine-protein phosphatase kappa / Mus musculus
- Reelin / Mus musculus
- Reticulocalbin-1 / Mus musculus
- Retinal-specific ATP-binding cassette transporter / Mus musculus
- Sacsin / Mus musculus
- Seipin / Mus musculus
- Semaphorin-3E / Mus musculus
- Semaphorin-4A / Mus musculus
- Semaphorin-4D / Mus musculus
- Semaphorin-7A / Mus musculus
- Serpin H1 / Mus musculus
- Serum paraoxonase/arylesterase 2 / Mus musculus
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus
- SID1 transmembrane family member 1 / Mus musculus
- Signal peptide, CUB and EGF-like domain-containing protein 1 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 5 / Mus musculus
- Sortilin / Mus musculus
- Sortilin-related receptor / Mus musculus
- SPARC / Mus musculus
- SPARC-like protein 1 / Mus musculus
- Sterol regulatory element-binding protein cleavage-activating protein / Mus musculus
- Stromal interaction molecule 1 / Mus musculus
- Sulfatase-modifying factor 1 / Mus musculus
- SUN domain-containing ossification factor / Mus musculus
- SUN domain-containing protein 2 / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- Synaptotagmin-1 / Mus musculus
- Teneurin-2 / Mus musculus
- Testican-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thioredoxin domain-containing protein 15 / Mus musculus
- Thrombospondin type-1 domain-containing protein 4 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7B / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Torsin-1A-interacting protein 1 / Mus musculus
- Torsin-1B / Mus musculus
- Transferrin receptor protein 1 / Mus musculus
- Translocon-associated protein subunit alpha / Mus musculus
- Translocon-associated protein subunit beta / Mus musculus
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane prolyl 4-hydroxylase / Mus musculus
- Transmembrane protein 106B / Mus musculus
- Transmembrane protein 106C / Mus musculus
- Transmembrane protein 131 / Mus musculus
- Transmembrane protein 178B / Mus musculus
- Transmembrane protein 62 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Trophoblast glycoprotein / Mus musculus
- Tyrosine-protein kinase Mer / Mus musculus
- Uncharacterized family 31 glucosidase KIAA1161 / Mus musculus
-
Uncharacterized protein / Mus musculus
- Undefined site
- Uncharacterized protein C11orf87 homolog / Mus musculus
- V-type proton ATPase subunit S1 / Mus musculus
- VIP36-like protein / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- Zinc finger protein 521 / Mus musculus
- Zinc transporter ZIP10 / Mus musculus
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Thyroglobulin / Sus scrofa
- Undefined site
-
Ascorbate oxidase / Acremonium sp. HI-25
- Undefined site
-
Uncharacterized protein / Actinidia chinensis
- Undefined site
-
Uncharacterized protein / Apium graveolens var. oulce
- Undefined site
-
Art v II / Artemisia vulgaris
- Undefined site
-
Uncharacterized protein / Daucus carota
- Undefined site
-
Uncharacterized protein / Lycopersicon esculentum
- Undefined site
-
Ribonuclease s-3 / Nicotiana alata
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
- Ribonuclease s-7 / Nicotiana alata
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
- Major protein allergan / Olea europaea
-
Uncharacterized protein / Solanum tuberosum
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Calreticulin / Spinacia oleracea
- Undefined site
-
Uncharacterized protein / Fagopyrum esculentum
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein / Pinus pinea
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Alpha-glucosidase / Aspergillus niger
- Undefined site
-
Endopolygalacturonase II / Aspergillus niger
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Uncharacterized protein / Agaricus bisporus
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Apisin / Apis mellifera
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Leishmanolysin / Leishmania amazonensis
- Undefined site
-
Leishmanolysin / Leishmania donovani
- Undefined site
-
Leishmanolysin / Leishmania major
- Undefined site
-
Leishmanolysin c1 / Leishmania mexicana
- Undefined site
-
Leishmanolysin / Leishmania tropica
- Undefined site
-
Uncharacterized protein / Leptomonas Samueli
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei
-
Variant surface glycoprotein mitat 1.4a / Trypansoma brucei
- Undefined site
-
Uncharacterized protein / Persea americana
- Undefined site
-
Cobra venom factor / Naja kaouthia
- Undefined site
- Galactose-binding lectin / Trimeresurus stejnegeri
-
Uncharacterized protein / Allium cepa
- Undefined site
-
Uncharacterized protein / Asparagus officinalis
- Undefined site
-
Uncharacterized protein / Cocos nucifera
- Undefined site
-
Uncharacterized protein / Musa acuminata
- Undefined site
-
Alpha-amylase / Oryza sativa
- Undefined site
-
Vitellogenin / Cherax quadricarinatus
- Undefined site
-
Hemocyanin / Pontastacus leptodactylus
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
- Undefined site
-
Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Uncharacterized protein / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein / Arachis hypogaea
- Undefined site
-
Uncharacterized protein / Brassica oleracea var. botrytis
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Citrus sinensis
- Undefined site
-
Uncharacterized protein / Corylus avellana
- Undefined site
-
Uncharacterized protein / Fragaria x ananassa
- Undefined site
-
Uncharacterized protein / Glycine max
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Uncharacterized protein / Malus domestica var. golden delicious
- Undefined site
-
Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
- Phaseolin, alpha-type / Phaseolus vulgaris
- Phaseolin, beta-type / Phaseolus vulgaris
-
Uncharacterized protein / Phaseolus vulgaris
- Undefined site
-
Uncharacterized protein / Pistacia vera
- Undefined site
-
Uncharacterized protein / Pisum sativum
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
-
Uncharacterized protein / Pyrus communis var. williams
- Undefined site
-
Uncharacterized protein / Ricinus communis
- Undefined site
-
Uncharacterized protein / Ricinus communis
- Undefined site
-
Uncharacterized protein / Vigna radiata var. radiata
- Undefined site
-
Invertase [secreted form] / Saccharomyces cerevisiae
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
Hemagglutinin-neuraminidase / Sendai virus (strain hvj)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Uncharacterized protein / Schistosoma mansoni
- Undefined site
-
Hemoglobin extracellular / Riftia pachyptila
- Undefined site
Reported glycosite
- QYNSTNMGLWR (11aa)
- QCVNLTTR (8aa)
- FWLPHNVTWADLK (13aa)
- IWIPVNITWADIEDRDGR (18aa)
- VSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSK (40aa)
- TFASHNASGGSSAGLR (16aa)
- DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- FNVSIDSVPEIR (12aa)
- HAVYWNSSNQHLR (13aa)
- LEPTPPIQFTHFQYNVTVHENSAAK (25aa)
- HENNTKDNSIQHEFSLTR (18aa)
- ALPGGTDNASAASAAGGSGPQR (22aa)
- YCNASVTNSVK (11aa)
- AELSNHTRPVILVPGCLGNR (20aa)
- VNFTIEASEGCYR (13aa)
- KIYIPLNK (8aa)
- KNYSVLYFQQK (11aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- VAGTAVSISCNVSDYEGPAQQDFEWFMYRPEAPATSLGIVSTK (43aa)
- QECYAFNGTQR (11aa)
- WQMNFTVR (8aa)
- SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
- WYSAGLASNSSWFR (14aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- NVSCLWCNTNK (11aa)
- TCEECIKNVSCIWCNTNK (18aa)
- NVSCLW (6aa)
- VVTWGINR (8aa)
- HPSDNNTNLVTPAVGHK (17aa)
- QVPGLHNGTK (10aa)
- LKPLFNK (7aa)
- SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
- YETTNK (6aa)
- LRPLFNK (7aa)
- NLTKDR (6aa)
- FSNVTWF (7aa)
- P0DTC2 Asn-61     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- P0DTC2 Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- WKLNK (5aa)
- QGNASDVILR (10aa)
- FSNVTW (6aa)
- SNVTWF (6aa)
- SCNISVTEK (9aa)
- EEEAIQLDGLNASQIR (16aa)
- NTTIFLK (7aa)
- TDDEVVQREEEAIQLDGLNASQIR (24aa)
- EGSRTDDEVVQREEEAIQLDGLNASQIR (28aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)