GlyConnect

taxonomy (6) protein (17) source (13) structure (8) composition (1) disease (5) reference (11) site (27) peptide (19)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:7 HexNAc:5 dHex:1 (avg mass : 2315.1301 )

Disease

Reference

Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Unreviewed
Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
Cell type and maturation stage-dependent polymorphism of N-linked oligosaccharides on murine lymphocytes and lymphoma cells. (1991 - Yoshida T, Takahashi N, Nakashima I) / Status : Reviewed
The structure of the asparagine-linked sugar chains of bovine brain ribonuclease. (1990 - Katoh H, Ohgi K, Irie M, Endo T, Kobata A) / Status : Reviewed
The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed

Reported glycosite

CD59 glycoprotein / Homo sapiens
- Asn-43
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Asn-180
Prostaglandin-h2 d-isomerase / Homo sapiens
- Asn-78
Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens
- Asn-690
Acetylcholinesterase / Bos taurus
- Undefined site
Ribonuclease, brain / Bos taurus
- Asn-88
Uncharacterized protein from Ascites / Mus musculus
- Undefined site
Uncharacterized protein from B-Lymphocyte / Mus musculus
- Undefined site
Uncharacterized protein from B-Lymphocyte (Peripheral) / Mus musculus
- Undefined site
Uncharacterized protein from Plasma Membrane / Mus musculus
- Undefined site
Uncharacterized protein from T-Lymphocyte / Mus musculus
- Undefined site
Uncharacterized protein from T-Lymphocyte (Peripheral) / Mus musculus
- Undefined site
Uncharacterized protein from T-Lymphocyte (Stimulated) / Mus musculus
- Undefined site
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
- Undefined site
Coagulation factor VIII / Sus scrofa
- Undefined site
Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Asn-122
- Asn-149
- Asn-165
- Asn-282
- Asn-343
- Asn-657
- Asn-717
- Asn-1098
- Asn-1159
- Asn-1174
- Asn-1194

Mass spectrometry observed peptide

TAVNCSSDFDACLITK (16aa)
- P13987 Asn-43
SVVAPATDGGLNLTSTFLR (19aa)
- P41222 Asn-78
TQSLLIVNNATNVVIK (16aa)
- P0DTC2 Asn-122
YYHKNNK (7aa)
- P0DTC2 Asn-149
VYSSANN (7aa)
- P0DTC2 Asn-165
VYSSANNCTFE (11aa)
- P0DTC2 Asn-165
EEQYNSTYR (9aa)
- P01857 Asn-180
NGTITDAVDCALDPLSE (17aa)
- P0DTC2 Asn-282
NGTITDAVDCALDPLSEK (18aa)
- P0DTC2 Asn-282
FPNITNLCPFGEVFNA (16aa)
- P0DTC2 Asn-343
FPNITNLCPFGEVFNATR (18aa)
- P0DTC2 Asn-343
AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- P0DTC2 Asn-657
NVS (3aa)
- Q9BYF1 Asn-690
IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFC (69aa)
- P0DTC2 Asn-717
EGVFVSNGTHWFVT (14aa)
- P0DTC2 Asn-1098
AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCD (41aa)
- P0DTC2 Asn-1098
NHTSPDVDLGDISGINASVVNIQK (24aa)
- P0DTC2 Asn-1174
EELDKYFKNHTSPDVDLGDISGIN (24aa)
- P0DTC2 Asn-1159
NLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTS (48aa)
- P0DTC2 Asn-1194

- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)
- N-Linked / Complex (avg mass : 2315.1301)

- Hex:7 HexNAc:5 dHex:1 / N-Linked (avg mass : 2315.1301)