taxonomy (25)
protein (131)
source (104)
structure (29)
composition (1)
disease (43)
reference (159)
site (199)
peptide (15)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Equus caballus (Domestic horse)
- Macaca radiata (Bonnet macaque)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Salvelinus leucomaenis pluvius (Whitespotted char)
- Bufo arenarum
- Bufo bufo (European toad)
- Bufo japonicus (Japanese toad)
- Bufo viridis
- Rana dalmatina
- Xenopus tropicalis (Western clawed frog)
- Gallus gallus (Chicken)
- Human herpes simplex virus 2
- Trypanosoma cruzi
- Murine hepatitis virus (strain a59)
- Friend murine leukemia virus (F-mulv)
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (gm1.2 mutant)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein (a) / Homo sapiens P08519
- Apolipoprotein C-III / Homo sapiens P02656
- Bile-salt-activated lipase / Homo sapiens P19835
- Chondroitin sulfate proteoglycan / Homo sapiens
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Chromogranin a / Homo sapiens P10645
- Coagulation factor IX / Homo sapiens P00740
- Coagulation factor V / Homo sapiens P12259
- Complement c4-a / Homo sapiens P0C0L4
- Erythropoietin / Homo sapiens P01588
- Glycocalicin / Homo sapiens P07359
- Glycophorin a and b / Homo sapiens P06028 P02724
- Glycophorin a, b and c / Homo sapiens P06028 P02724 P04921
- Glycophorin B Miltenberger subtype III / Homo sapiens B8Q179
- Glycophorin-A / Homo sapiens P02724
- Gpl115 / Homo sapiens
- Hemopexin / Homo sapiens P02790
- IgG-IL2 fusion protein / Homo sapiens P60568
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens P01860
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens P01860
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy variable 4-39 / Homo sapiens P01824
- Immunoglobulin lambda-1 light chain / Homo sapiens P0DOX8
- Insulin-like growth factor II / Homo sapiens P01344
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens P19827
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens P19823
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon alpha-2 / Homo sapiens P01563
- Interleukin-2 / Homo sapiens P60568
- Kininogen-1 / Homo sapiens P01042
- Leukosialin (cd43) / Homo sapiens P16150
- Low-density lipoprotein receptor / Homo sapiens P01130
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Muc1 fusion protein / Homo sapiens
- Muc1f (delta tr) / Homo sapiens P15941
- Mucin-1 / Homo sapiens P15941
- Mucin-5B / Homo sapiens Q9HC84
- Mucin-7 / Homo sapiens Q8TAX7
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens Q96PD5
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens Q96FE7
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasminogen / Homo sapiens P00747
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Protein YIPF3 / Homo sapiens Q9GZM5
- Proteoglycan / Homo sapiens
- Proteoglycan 4 (lubricin) / Homo sapiens Q92954
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens P15941
- Recombinant Mucin-1 Muc1f/2tr / Homo sapiens P15941 Q02817
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Recombinant Mucin-1 Muc1f/5actr / Homo sapiens P15941 P98088
- Recombinant Mucin-1 Muc1f/5btr / Homo sapiens P15941 Q9HC84
- Rgm / Homo sapiens
- Semenogelin-2 / Homo sapiens Q02383
- Serotransferrin / Homo sapiens P02787
- Serum albumin / Homo sapiens P02768
- Sex hormone-binding globulin / Homo sapiens P04278
- Spacr / Homo sapiens
- Sparc-like protein 1 / Homo sapiens Q14515
- Thrombopoietin / Homo sapiens P40225
- Transferrin receptor protein 1 / Homo sapiens P02786
- Tumor necrosis factor receptor superfamily member 16 / Homo sapiens P08138
- Tumor necrosis factor receptor superfamily member 1b (etanercept, enbrel) / Homo sapiens P20333
- Tumor-necrosis factor-alpha / Homo sapiens P01375
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein from Transudate / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Uncharacterized protein from Urine / Homo sapiens
- Unspecified mucin / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Vitamin d-binding protein / Homo sapiens P02774
- Alpha-2-hs-glycoprotein / Bos taurus P12763
- Casein / Bos taurus
- Chromogranin a / Bos taurus P05059
- Coagulation factor x / Bos taurus P00743
- Gp-3 / Bos taurus
- Kappa casein / Bos taurus P02668
- Lpg-1 / Bos taurus
- Mucin / Bos taurus
- Plasminogen / Bos taurus P06868
- Seminal plasma protein pdc-109 / Bos taurus P02784
- Uncharacterized protein / Bos taurus
- Glycophorin / Canis lupus familiaris P02727
- Mucin / Canis lupus familiaris
- Choriogonadotropin beta chain / Equus caballus P08751
- Mucin / Macaca radiata
- Epiglycanin / Mus musculus D9N008
- Fetal antigen 1 / Mus musculus Q09163
- Glycophorin / Mus musculus P14220
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Uncharacterized protein / Mus musculus
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 Q62005 P10761
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Immunoglobulin gamma / Oryctolagus cuniculus
- Dystroglycan / Ovis aries W5PVZ9
- Major membrane glycoprotein - MII2 / Rattus norvegicus
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Neuroligin 1 / Rattus norvegicus Q62765
- Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein from Brain / Rattus norvegicus
- Uncharacterized protein from Liver / Rattus norvegicus
- Uncharacterized proteoglycan / Rattus norvegicus
- Mucin / Sus scrofa
- Plasminogen / Sus scrofa P06867
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Polysialoglycoprotein (psgp) / Salvelinus leucomaenis pluvius
- Mucin / Bufo arenarum
- Mucin / Bufo bufo
- Uncharacterized protein / Bufo japonicus
- Mucin / Bufo viridis
- Mucin / Rana dalmatina
- Mucin / Xenopus tropicalis
- Ovomucin / Gallus gallus
- gG-2 / Human herpes simplex virus 2 P13290
- 35/50 kDa surface glycoprotein / Trypanosoma cruzi
- E1 glycoprotein / Murine hepatitis virus (strain a59) P03415
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus P03393
- Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Aorta (UBERON_0000947)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cervical Mucosa (UBERON_0012248)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Colon (UBERON_0001155)
- Colonic Mucosa (UBERON_0000317) HT29-16E (CVCL_C763)
- Colostrum (UBERON_0001914)
- Connective Tissue (UBERON_0002384) LTK (CVCL_R978)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Large Intestine (UBERON_0000059)
- Liver (UBERON_0002107) AH66-TC (CVCL_4368) Plasma Membrane (GO_0005886)
- Liver (UBERON_0002107) Zajdela-Hepatoma (CVCL_1D00) Cell Surface (GO_0009986)
- Lymph Node (UBERON_0000029) CCRF-HSB-2 (CVCL_1859)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) TA3/Ha (CVCL_4321)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DXB11 (CVCL_1977)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Pulmonary Mucosa
- Retina (UBERON_0000966)
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) A-431 (CVCL_0037) Fibroblast (CL_0000057)
- Small Intestine (UBERON_0002108)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Tracheal Mucosa (UBERON_0000379)
- Transudate (UBERON_0007779)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Zona Pellucida (UBERON_0000086)
- 17cl1 (CVCL_VT75) Fibroblast (CL_0000057)
- BALL-1 (CVCL_1075) Lymphocyte (CL_0000542)
- C10 (CVCL_5245)
- C6 (CVCL_0194) Glial Cell (CL_0000125)
- CCRF-CEM (CVCL_0207) Lymphocyte (CL_0000542)
- CCRF-CEM (CVCL_0207) T-Lymphocyte (CL_0000084)
- CHO (CVCL_0213)
- COLO 205 (CVCL_0218)
- COLO 320 (CVCL_1989)
- Caco-2 (CVCL_0025)
- Co115 (CVCL_D102)
- DLD-1 (CVCL_0248)
- Eveline (CVCL_A1LI)
- HCT 116 (CVCL_0291)
- HCT 15 (CVCL_0292)
- HCT 8 (CVCL_2478)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- HL-60 (CVCL_0002) Leukocyte (CL_0000738)
- HT29 (CVCL_A8EZ)
- KM12 (CVCL_1331)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- RKO (CVCL_0504)
- Rat1 (CVCL_0492)
- SW1116 (CVCL_0544)
- SW1398 (CVCL_3885)
- SW1463 (CVCL_1718)
- SW48 (CVCL_1724)
- SW620 (CVCL_0547)
- SW837 (CVCL_1729)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- WiDr (CVCL_2760)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Jelly Coat
- Erythrocyte (CL_0000232)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Granulocyte (CL_0000094)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Neutrophil (CL_0000775)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
- T-Lymphocyte (CL_0000084)
- Cell Surface (GO_0009986)
- Chromaffin Granules (GO_0042583)
- Plasma Membrane (GO_0005886)
- Very-Low-Density Lipoprotein Particle (GO_0034361)
Source
- Free / Lactosamine / Structure 9029
- Free / Lactosamine / Structure 9030
- Free / No-core / NeuAc(a2-6)Man(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-3)Gal(b1-4)GlcNAc
- N-Linked / No-core / NeuAc(a2-6)Gal(b1-4)GlcNAc
- O-Linked / Core 1 / Gal(?1-?)GalNAc + "Neu5Ac"
- O-Linked / Core 1 / Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a + "Neu5Ac(a"
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a +"NeuAc"
- O-Linked / Core 1 / Gal(b1-3)GalNAc+"+ NeuAc"
- O-Linked / Core 1 / Gal(b1-3)GalNAc+"+ NeuAc(a2-?)"
- O-Linked / Core 1 / NeuAc(?2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-6)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-?)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 9259
- O-Linked / Core 1 / Structure 11170
- O-Linked / Core 8 / Gal(a1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ NeuAc"
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ NeuAc(?2-?)"
- O-Linked / Undefined core / Gal(?1-?)GalNAc+"+ NeuAc"
- O-Linked / Undefined core / Gal(b1-?)GalNAc+"+ NeuAc"
- O-Linked / Undefined core / Hex(?1-?)HexNAc+"+ NeuAc"
- O-Linked / Undefined core / NeuAc(?2-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / NeuAc(?2-?)Gal(?1-?)GalNAc
- O-Linked / Undefined core / NeuAc(a2-3)Gal(?1-3)GalNAc
Reported structure
- Hex:1 HexNAc:1 NeuAc:1 (avg mass : 674.6106 )
Composition
- Adenocarcinoma (DOID:299)
- Arthritis, Rheumatoid (DOID:7148)
- Aspartylglycosaminuria (DOID:0050461)
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, breast (DOID:1612)
- Carcinoid Tumor, with multiple liver metastasis
- Carcinoma, Hepatocellular (DOID:684)
- Carcinoma, Squamous cell (DOID:1749)
- Cecum adenocarcinoma (DOID:3039)
- Chondrosarcoma (DOID:3371)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Dyscrasia, Plasma Cell (DOID:6536)
- Erythroleukemia with associated Polycythemia
- Glioma
- Hybridoma
- Hyperlipoproteinemia, Familial Type V (DOID:1171)
- Kidney Failure, Chronic (DOID:784)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Acute lymphoblastic and HIV-1
- Leukemia, Acute myelogenous (DOID:9119)
- Leukemia, Myloid, Chronic (DOID:8552)
- Leukemia, Promyelocytic (DOID:0060318)
- Lymphoma (DOID:0060058)
- Mannosidosis, beta (DOID:3633)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Osteoarthritis (DOID:8398)
- Pancreatitis, Chronic (DOID:4989)
- Parasite Nippostrongylus brasiliensis nfection
- Parkinson's disease (DOID:14330)
- Prostate cancer (DOID:10283)
- Rectal adenocarcinoma (DOID:1996)
- Sialidosis (Mucolipidosis I) (DOID:3343)
- Tn Polyagglutinability Syndrome (DOID:0080520)
- Wiskott-Aldrich Syndrome (DOID:9169)
Disease
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Identification of protein O-glycosylation site and corresponding glycans using liquid chromatography-tandem mass spectrometry via mapping accurate mass and retention time shift (2014 - Huang LJ, Lin JH, Tsai JH, Chu YY, Chen YW, Chen SL, Chen SH) / Status : Reviewed
- Site-specific analysis of the O-glycosylation of bovine fetuin by electron-transfer dissociation mass spectrometry (2014 - Windwarder M, Altmann F) / Status : Reviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Naturally Occurring Structural Isomers in Serum IgA1 O-Glycosylation (2012 - Kazuo Takahashi, Archer D. Smith, IV, Knud Poulsen, Mogens Kilian, Bruce A. Julian, Jiri Mestecky, Jan Novak, Matthew B. Renfrow) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Species-specificity of amphibia carbohydrate chains: the Bufo viridis case study (2002 - Coppin, Maes, Strecker) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- A nucleotide insertion frameshift cause albumin Kenitra, an extended and O-glycosylated mutant of human serum albumin with two additional disulfide bridges (2001 - Minchiotti, Campagnoli, Rossi, Cosulich, Monti, Pucci, Kragh-Hansen, Granel, Disdier, Weiller, Galliano) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
- Structural elucidation of the N- and O-glycans of human apolipoprotein(a): role of O-glycans in conferring protease resistance. (2001 - Garner B, Merry A, Royle L, Harvey D, Rudd P, Thillet J) / Status : Reviewed
- Structure of O-glycosidically linked oligosaccharides from glycoproteins of Trypanosoma cruzi CL-Brener strain: evidence for the presence of O-linked sialyl-oligosaccharides. (2001 - Todeschini A, da Silveira E, Jones C, Wait R, Previato J, Mendona-Previato L) / Status : Reviewed
- Identification of transient glycosylation alterations of sialylated mucin oligosaccharides during infection by the rat intestinal parasite Nippostrongylus brasiliensis. (2000 - Karlsson N, Olson F, Jovall P, Andersch Y, Enerbck L, Hansson G) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Impaired galactosylation of core 2 O-glycans in erythrocytes of beta1,4-galactosyltransferase knockout mice. (1999 - Kotani N, Asano M, Iwakura Y, Takasaki S) / Status : Reviewed
- Chromogranin A from bovine adrenal medulla: molecular characterization of glycosylations, phosphorylations, and sequence heterogeneities by mass spectrometry. (1999 - Bauer S, Zhang X, Van Dongen W, Claeys M, Przybylski M) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Characterization of SPACR, a sialoprotein associated with cones and rods present in the interphotoreceptor matrix of the human retina: immunological and lectin binding analysis. (1998 - Acharya S, Rayborn M, Hollyfield J) / Status : Reviewed
- Structural characterisation of N-linked and O-linked oligosaccharides derived from interferon-alpha2b and interferon-alpha14c produced by Sendai-virus-induced human peripheral blood leukocytes (1998 - Nyman, Kalkkinen, Tolo, Helin) / Status : Reviewed
- Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. (1998 - Olsen E, Rahbek-Nielsen H, Thogersen I, Roepstorff P, Enghild J) / Status : Reviewed
- Human low-molecular-weight salivary mucin expresses the sialyl lewisx determinant and has L-selectin ligand activity. (1998 - Prakobphol A, Thomsson K, Hansson G, Rosen S, Singer M, Phillips N, Medzihradszky K, Burlingame A, Leffler H, Fisher S) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana dalmatina. (1998 - Morelle W, Guytant R, Strecker G) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural analysis of sequences O-linked to mannose reveals a novel Lewis X structure in cranin (dystroglycan) purified from sheep brain. (1998 - Smalheiser N, Haslam S, Sutton-Smith M, Morris H, Dell A) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of bovine chromogranin A from adrenal medullary chromaffin granules and their relationship with biological activities. (1997 - Strub J, Sorokine O, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Evidence for a novel O-linked sialylated trisaccharide on Ser-248 of human plasminogen 2. (1997 - Pirie-Shepherd S, Stevens R, Andon N, Enghild J, Pizzo S) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- The structural analysis of the O-glycans of the jacalin-bound rabbit immunoglobulin G. (1997 - Kabir S, Gerwig G) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Structural determination of the O-linked sialyl oligosaccharides liberated from fetuin with endo-alpha-N-acetylgalactosaminidase-S by HPLC analysis and 600-MHz 1H-NMR spectroscopy. (1997 - Ishii-Karakasa I, Iwase H, Hotta K) / Status : Reviewed
- O-glycosylated species of natural human tumor-necrosis factor-alpha. (1996 - Takakura-Yamamoto R, Yamamoto S, Fukuda S, Kurimoto M) / Status : Reviewed
- O-linked olgiosaccharide on the 75-kDa neurotrophin receptor (1996 - Chapman, Eckart, Kaufman, Lapointe) / Status : Reviewed
- Study of O-sialylation of glycoproteins in C6 glioma cells treated with retinoic acid. (1996 - Reboul P, George P, Miquel D, Louisot P, Broquet P) / Status : Reviewed
- The structure of the O-linked carbohydrate chain of bovine seminal plasma protein PDC-109 revised by H-NMR spectroscopy A correction. (1996 - Gerwig G, Calvete J, Tpfer-Petersen E, Vliegenthart J) / Status : Reviewed
- Antibacterial activity of glycosylated and phosphorylated chromogranin A-derived peptide 173-194 from bovine adrenal medullary chromaffin granules. (1996 - Strub J, Goumon Y, Lugardon K, Capon C, Lopez M, Moniatte M, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
- Characterization of four monosialo and a novel disialo Asn N-glycosides from the urine of a patient with aspartylglycosaminuria. (1995 - Irie F, Murakoshi H, Suzuki T, Suzuki Y, Kon K, Ando S, Yoshida K, Hirabayashi Y) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
- Localization and structural characterization of an oligosaccharide O-linked to bovine PDC-109. Quantitation of the glycoprotein in seminal plasma and on the surface of ejaculated and capacitated spermatozoa. (1994 - Calvete J, Raida M, Sanz L, Wempe F, Scheit K, Romero A, Tpfer-Petersen E) / Status : Reviewed
- Altered sialylation of CD45 in HIV-1-infected T lymphocytes. (1994 - Lefebvre J, Giordanengo V, Doglio A, Cagnon L, Breittmayer J, Peyron J, Lesimple J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- Structural features of carbohydrate chains in human salivary mucins. (1993 - Slomiany B, Murty V, Slomiany A) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A. (1993 - Krotkiewski H, Lisowska E, Nilsson G, Grnberg G, Nilsson B) / Status : Reviewed
- Variation of the glycosylation of human pancreatic bile-salt-dependent lipase. (1993 - Mas E, Abouakil N, Roudani S, Franc J, Montreuil J, Lombardo D) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- Oligosaccharide structures of mucins secreted by the human colonic cancer cell line CL.16E. (1992 - Capon C, Laboisse C, Wieruszeski J, Maoret J, Augeron C, Fournet B) / Status : Reviewed
- Analysis of glycoform of O-glycan from human myeloma immunoglobulin A1 by gas-phase hydrazinolysis following pyridylamination of oligosaccharides. (1992 - Iwase H, Ishii-Karakasa I, Fujii E, Hotta K, Hiki Y, Kobayashi Y) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Identification of the O-linked glycosylation site of the human transferrin receptor. (1992 - Hayes G, Enns C, Lucas J) / Status : Reviewed
- Structure of the N- and O-glycans of the A-chain of human plasma alpha 2HS-glycoprotein as deduced from the chemical compositions of the derivatives prepared by stepwise degradation with exoglycosidases. (1992 - Watzlawick H, Walsh M, Yoshioka Y, Schmid K, Brossmer R) / Status : Reviewed
- 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
- O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
- Altered O-glycan synthesis in lymphocytes from patients with Wiskott-Aldrich syndrome. (1991 - Piller F, Le Deist F, Weinberg K, Parkman R, Fukuda M) / Status : Reviewed
- Natural human interferon-alpha 2 is O-glycosylated. (1991 - Adolf G, Kalsner I, Ahorn H, Maurer-Fogy I, Cantell K) / Status : Reviewed
- Structure determination of the major N- and O-linked carbohydrate chains of the beta subunit from equine chorionic gonadotropin. (1990 - Damm J, Hard K, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- Structure determination of five sialylated trisaccharides with core types 1, 3 or 5 isolated from bovine submaxillary mucin. (1990 - Savage A, Donoghue C, D'Arcy S, Koeleman C, van den Eijnden D) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
- Sialyl-alpha 2-6-mannosyl-beta 1-4-N-acetylglucosamine, a novel compound occurring in urine of patients with beta-mannosidosis. (1990 - van Pelt J, Dorland L, Duran M, Hokke C, Kamerling J, Vliegenthart J) / Status : Reviewed
- Expression of human interleukin-2 in recombinant baby hamster kidney, Ltk-, and Chinese hamster ovary cells. Structure of O-linked carbohydrate chains and their location within the polypeptide. (1989 - Conradt H, Nimtz M, Dittmar K, Lindenmaier W, Hoppe J, Hauser H) / Status : Reviewed
- Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns. (1988 - Marti T, Schaller J, Rickli E, Schmid K, Kamerling J, Gerwig G, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structural analysis by fast-atom-bombardment mass spectrometry of the mixture of alditols derived from the O-linked oligosaccharides of murine glycophorins. (1988 - Krotkiewski H, Lisowska E, Angel A, Nilsson B) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Structural analysis of O-glycosidic type of sialyloligosaccharide-alditols derived from urinary glycopeptides of a sialidosis patient. (1988 - van Pelt J, Van Bilsen D, Kamerling J, Vliegenthart J) / Status : Reviewed
- Isolation of sialylcompounds from hemofiltrate of chronic uremic patients and identification by nuclear magnetic resonance. (1987 - Weisshaar G, Brunner H, Friebolin H, Baumann W, Mann H, Opferkuch H, Sieberth H) / Status : Reviewed
- [Sialic acid containing compounds in the hemofiltrate of patients with chronic renal insufficiency. II. Isolation and structure determination of sialoglycopeptides] (1987 - Weisshaar G, Baumann W, Friebolin H, Brunner H, Mann H, Sieberth H, Opferkuch H) / Status : Reviewed
- The structures of N- and O-glycosidic carbohydrate chains of a chondroitin sulfate proteoglycan isolated from the media of the human aorta. (1987 - Akiyama F, Stevens R, Hayashi S, Swann D, Binette J, Caterson B, Schmid K, Van Halbeek H, Mutsaers J, Gerwig G) / Status : Reviewed
- Structure of acidic oligosaccharides isolated from pronase-treated glycoprotein of bonnet-monkey (Macaca radiata) cervical mucus. (1987 - Nasir-ud-Din ) / Status : Reviewed
- Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins. (1987 - Fukuda M, Lauffenburger M, Sasaki H, Rogers ME, Dell A) / Status : Reviewed
- Membrane glycophorins of Dantu blood group erythrocytes. (1987 - Blumenfeld O, Smith A, Moulds J) / Status : Reviewed
- The structure of the O-glycosidic oligosaccharide chains of the major Zajdela hepatoma ascites-cell-membrane glycoprotein. (1986 - Nato F, Goulut C, Bourrillon R, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Porcine submaxillary mucin contains alpha 2----3- and alpha 2----6-linked N-acetyl- and N-glycolylneuraminic acid. (1986 - Savage A, Koppen P, Schiphorst W, Trippelvitz L, Van Halbeek H, Vliegenthart J, Van den Eijnden D) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Membrane glycophorins in Sta blood group erythrocytes. (1986 - Blumenfeld O, Adamany A, Kikuchi M, Sabo B, McCreary J) / Status : Reviewed
- Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
- Characterization of O-glycosidically linked oligosaccharides of rat erythrocyte membrane sialoglycoproteins. (1986 - Edge A, Van Langenhove A, Reinhold V, Weber P) / Status : Reviewed
- Structure determination of oligosaccharides isolated from Cad erythrocyte membranes by permethylation analysis and 500-MHz 1H-NMR spectroscopy. (1985 - Herkt F, Parente J, Leroy Y, Fournet B, Blanchard D, Cartron J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structures of the carbohydrate units of polysialoglycoproteins isolated from the eggs of four species of salmonid fishes. (1985 - Iwasaki M, Inoue S) / Status : Reviewed
- Structural studies of O-glycosidic oligosaccharide units of dog erythrocyte glycophorin. (1985 - Yamashita T, Murayama J, Utsumi H, Hamada A) / Status : Reviewed
- Oligosaccharide chains of herpes simplex virus type 2 glycoprotein gG.2. (1985 - Serafini-Cessi F, Malagolini N, Dall'Olio F, Pereira L, Campadelli-Fiume G) / Status : Reviewed
- Oligosaccharide structures of the low-molecular-weight salivary mucin from a normal individual and one with cystic fibrosis. (1985 - Reddy M, Levine M, Prakobphol A) / Status : Reviewed
- Structures of the major carbohydrates of natural human interleukin-2. (1985 - Conradt H, Geyer R, Hoppe J, Grotjahn L, Plessing A, Mohr H) / Status : Reviewed
- Structural studies on the O-linked carbohydrate chains of human platelet glycocalicin. (1984 - Korrel S, Clemetson K, Van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- The carbohydrates of mouse hepatitis virus (MHV) A59: structures of the O-glycosidically linked oligosaccharides of glycoprotein E1. (1984 - Niemann H, Geyer R, Klenk H, Linder D, Stirm S, Wirth M) / Status : Reviewed
- Glycoprotein E1 of MHV-A59: structure of the O-linked carbohydrates and construction of full length recombinant cDNA clones. (1984 - Niemann H, Heisterberg-Moutsis G, Geyer R, Klenk H, Wirth M) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Characterization of a human lymphocyte surface sialoglycoprotein that is defective in Wiskott-Aldrich syndrome. (1984 - Remold-O'Donnell E, Kenney D, Parkman R, Cairns L, Savage B, Rosen F) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Isolation and characterization of the O-glycan chain of the human vitamin-D binding protein. (1983 - Viau M, Constans J, Debray H, Montreuil J) / Status : Reviewed
- Structures of the major oligosaccharides from a human rectal adenocarcinoma glycoprotein. (1983 - Kurosaka A, Nakajima H, Funakoshi I, Matsuyama M, Nagayo T, Yamashina I) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - Mellis S, Baenziger J) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- Characterization of the B-chain of human plasma alpha 2HS-glycoprotein. The complete amino acid sequence and primary structure of its heteroglycan. (1983 - Gejyo F, Chang J, Brgi W, Schmid K, Offner G, Troxler R, Van Halbeek H, Dorland L, Gerwig G, Vliegenthart J) / Status : Reviewed
- Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
- Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
- Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
- Glycoproteins and proteoglycans of the chromaffin granule matrix. (1982 - Kiang W-L, Krusius T, Finne J, Margolis RU, Margolis RK) / Status : Reviewed
- Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus. (1981 - Blumenfeld O, Adamany A, Puglia K) / Status : Reviewed
- The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- A 360-MHz 1H-NMR study of three oligosaccharides isolated from cow kappa-casein. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolles P) / Status : Reviewed
- The structure of the O-glycosylically-linked oligosaccharide chains of LPG-I, a glycoprotein present in articular lubricating fraction of bovine synovial fluid. (1980 - Garg H, Swann D, Glasgow L) / Status : Reviewed
- The chemical structure of the main sugar moiety isolated from bovine whole casein. (1980 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- The structures of the carbohydrate moieties of bovine blood coagulation factor X. (1980 - Mizuochi T, Yamashita K, Fujikawa K, Titani K, Kobata A) / Status : Reviewed
- Oligosaccharides on proteoglycans from the swarm rat chondrosarcoma. (1980 - Lohmander L, De Luca S, Nilsson B, Hascall V, Caputo C, Kimura J, Heinegard D) / Status : Reviewed
- Cow kappa-casein: structure of the carbohydrate portion. (1979 - Fournet B, Fiat A, Alais C, Jolls P) / Status : Reviewed
- Chemical structure of epiglycanin, the major glycoprotein of the TA3-Ha ascites cell. The carbohydrate chains. (1979 - van den Eijnden D, Evans N, Codington J, Reinhold V, Silber C, Jeanloz R) / Status : Reviewed
- Carbohydrate of the human plasminogen variants. III. Structure of the O-glycosidically linked oligosaccharide unit. (1979 - Hayes M, Castellino F) / Status : Reviewed
- Characterization of the oligosaccharide side chain of apolipoprotein C-III from human plasma very low density lipoproteins. (1978 - Vaith P, Assmann G, Uhlenbruck G) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of rat brain glycoproteins. (1975 - Finne J) / Status : Reviewed
- Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of fetuin. (1974 - Spiro R, Bhoyroo V) / Status : Reviewed
- Isolation and characterization of oligosaccharides from canine submaxillary mucin. (1974 - Lombart C, Winzler R) / Status : Reviewed
- Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
Reference
- Alpha-2-HS-glycoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Apolipoprotein (a) / Homo sapiens
- Undefined site
- Apolipoprotein C-III / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
-
Chondroitin sulfate proteoglycan / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Chromogranin a / Homo sapiens
- Coagulation factor IX / Homo sapiens
- Coagulation factor V / Homo sapiens
- Complement c4-a / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
- Ser-153
-
Glycocalicin / Homo sapiens
- Undefined site
-
Glycophorin a and b / Homo sapiens
- Undefined site
-
Glycophorin a, b and c / Homo sapiens
- Undefined site
-
Glycophorin B Miltenberger subtype III / Homo sapiens
- Undefined site
-
Glycophorin-A / Homo sapiens
- Undefined site
-
Gpl115 / Homo sapiens
- Undefined site
- Hemopexin / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Ser-113
- Immunoglobulin heavy constant delta / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy variable 4-39 / Homo sapiens
- Undefined site
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Insulin-like growth factor II / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Interferon alpha-2 / Homo sapiens
- Interleukin-2 / Homo sapiens
- Kininogen-1 / Homo sapiens
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
-
Mucin-5B / Homo sapiens
- Undefined site
-
Mucin-7 / Homo sapiens
- Undefined site
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Plasminogen / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Protein YIPF3 / Homo sapiens
-
Proteoglycan / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/2tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
- Undefined site
-
Rgm / Homo sapiens
- Undefined site
- Semenogelin-2 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
-
Serum albumin / Homo sapiens
- Undefined site
- Sex hormone-binding globulin / Homo sapiens
-
Spacr / Homo sapiens
- Undefined site
- Sparc-like protein 1 / Homo sapiens
-
Thrombopoietin / Homo sapiens
- Undefined site
- Transferrin receptor protein 1 / Homo sapiens
-
Tumor necrosis factor receptor superfamily member 16 / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 1b (etanercept, enbrel) / Homo sapiens
- Tumor-necrosis factor-alpha / Homo sapiens
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Transudate / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Vitamin d-binding protein / Homo sapiens
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
-
Casein / Bos taurus
- Undefined site
- Chromogranin a / Bos taurus
-
Coagulation factor x / Bos taurus
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
- Kappa casein / Bos taurus
-
Lpg-1 / Bos taurus
- Undefined site
-
Mucin / Bos taurus
- Undefined site
- Plasminogen / Bos taurus
- Seminal plasma protein pdc-109 / Bos taurus
-
Uncharacterized protein / Bos taurus
- Undefined site
-
Glycophorin / Canis lupus familiaris
- Undefined site
-
Mucin / Canis lupus familiaris
- Undefined site
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Mucin / Macaca radiata
- Undefined site
-
Epiglycanin / Mus musculus
- Undefined site
-
Fetal antigen 1 / Mus musculus
- Undefined site
-
Glycophorin / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Dystroglycan / Ovis aries
- Undefined site
-
Major membrane glycoprotein - MII2 / Rattus norvegicus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Uncharacterized proteoglycan / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
- Plasminogen / Sus scrofa
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Polysialoglycoprotein (psgp) / Salvelinus leucomaenis pluvius
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Uncharacterized protein / Bufo japonicus
- Undefined site
-
Mucin / Bufo viridis
- Undefined site
-
Mucin / Rana dalmatina
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
-
Ovomucin / Gallus gallus
- Undefined site
-
gG-2 / Human herpes simplex virus 2
- Undefined site
-
35/50 kDa surface glycoprotein / Trypanosoma cruzi
- Undefined site
-
E1 glycoprotein / Murine hepatitis virus (strain a59)
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- EDQTSPAPGLR (11aa)
- TPLPPTSAHGNVAEGETKPDPDVTER (26aa)
- VATTVISK (8aa)
- DVSTPPTVLPDNFPR (15aa)
- HYTNPSQDVTVPCPVPSTPPTPSP (24aa)
- SCDTPPPCPR (10aa)
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-122     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- EAISPPDAASAAPLR (15aa)
- MAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSR (33aa)
- AVAVTLQSH (9aa)
- NHGVDDDGDDDGDDGGTDGPR (21aa)
- SQIQTPNPNQDQWSGQNAK (19aa)
- EPPPRTLPATDLQ (13aa)
- DQADGSRASVDSGSSEEQGGSSR (23aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (44aa)
Mass spectrometry observed peptide
-
- Free / Lactosamine
(avg mass : 674.6106)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
-
- Free / Lactosamine
(avg mass : 674.6106)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Reviewed
- Annotation and Structural Analysis of Sialylated Human Milk Oligosaccharides (2011 - Shuai Wu, Rudolf Grimm, J Bruce German, Carlito B Lebrilla) / Status : Reviewed
-
- Free / No-core
(avg mass : 674.6106)
- Urine (UBERON_0001088)
- Mannosidosis, beta (DOID:3633)
-
- N-Linked / No-core
(avg mass : 674.6106)
- Structure of O-glycosidically linked oligosaccharides from glycoproteins of Trypanosoma cruzi CL-Brener strain: evidence for the presence of O-linked sialyl-oligosaccharides. (2001 - Todeschini A, da Silveira E, Jones C, Wait R, Previato J, Mendona-Previato L) / Status : Reviewed
- Characterization of four monosialo and a novel disialo Asn N-glycosides from the urine of a patient with aspartylglycosaminuria. (1995 - Irie F, Murakoshi H, Suzuki T, Suzuki Y, Kon K, Ando S, Yoshida K, Hirabayashi Y) / Status : Reviewed
- Isolation of sialylcompounds from hemofiltrate of chronic uremic patients and identification by nuclear magnetic resonance. (1987 - Weisshaar G, Brunner H, Friebolin H, Baumann W, Mann H, Opferkuch H, Sieberth H) / Status : Reviewed
- Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
35/50 kDa surface glycoprotein / Trypanosoma cruzi
- Undefined site
-
- N-Linked / No-core
(avg mass : 674.6106)
- Characterization of four monosialo and a novel disialo Asn N-glycosides from the urine of a patient with aspartylglycosaminuria. (1995 - Irie F, Murakoshi H, Suzuki T, Suzuki Y, Kon K, Ando S, Yoshida K, Hirabayashi Y) / Status : Reviewed
- Isolation of sialylcompounds from hemofiltrate of chronic uremic patients and identification by nuclear magnetic resonance. (1987 - Weisshaar G, Brunner H, Friebolin H, Baumann W, Mann H, Opferkuch H, Sieberth H) / Status : Reviewed
- Isolation and structural characterization of five major sialyloligosaccharides and a sialylglycopeptide from normal human urine. (1983 - Parkkinen J, Finne J) / Status : Reviewed
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Coagulation factor IX / Homo sapiens
- Tumor necrosis factor receptor superfamily member 1b (etanercept, enbrel) / Homo sapiens
- Alpha-2-hs-glycoprotein / Bos taurus
- Kappa casein / Bos taurus
-
- O-Linked / Core 1
(avg mass : 674.6106)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Alpha-2-HS-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cervical Mucosa (UBERON_0012248)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Thyroid (UBERON_0002046)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- BALL-1 (CVCL_1075) Lymphocyte (CL_0000542)
- C10 (CVCL_5245)
- SW1398 (CVCL_3885)
- T84 (CVCL_0555)
- Adipocytes (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Jelly Coat
- Erythrocyte (CL_0000232)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Granulocyte (CL_0000094)
- Leukocyte (CL_0000738)
- Neutrophil (CL_0000775)
- Adenocarcinoma (DOID:299)
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, breast (DOID:1612)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Acute myelogenous (DOID:9119)
- Leukemia, Myloid, Chronic (DOID:8552)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Parkinson's disease (DOID:14330)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Identification of the blood group Lewis(a) determinant in the oviducal mucins of Xenopus tropicalis. (2003 - Guérardel Y, Petit D, Madigou T, Guillet B, Maes E, Maftah A, Boujard D, Strecker G, Kol O) / Status : Reviewed
- Species-specificity of amphibia carbohydrate chains: the Bufo viridis case study (2002 - Coppin, Maes, Strecker) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Rana dalmatina. (1998 - Morelle W, Guytant R, Strecker G) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Structural characterisation of N-linked and O-linked oligosaccharides derived from interferon-alpha2b and interferon-alpha14c produced by Sendai-virus-induced human peripheral blood leukocytes (1998 - Nyman, Kalkkinen, Tolo, Helin) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from the jelly coats of the anuran Bufo arenarum. (1998 - Morelle W, Cabada M, Strecker G) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- O-glycosylated species of natural human tumor-necrosis factor-alpha. (1996 - Takakura-Yamamoto R, Yamamoto S, Fukuda S, Kurimoto M) / Status : Reviewed
- Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
- Isolation, structural determination, and calcium-binding properties of the major glycoprotein present in Bufo japonicus japonicus egg jelly. (1994 - Shimoda Y, Kitajima K, Inoue S, Inoue Y) / Status : Reviewed
- An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A. (1993 - Krotkiewski H, Lisowska E, Nilsson G, Grnberg G, Nilsson B) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
- Structure determination of five sialylated trisaccharides with core types 1, 3 or 5 isolated from bovine submaxillary mucin. (1990 - Savage A, Donoghue C, D'Arcy S, Koeleman C, van den Eijnden D) / Status : Reviewed
- Analysis of N- and O-glycosidically bound sialooligosaccharides in glycoproteins by high-performance liquid chromatography with pulsed amperometric detection. (1990 - Honda S, Suzuki S, Zaiki S, Kakehi K) / Status : Reviewed
- Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
- Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Structure of sialyloligosaccharides isolated from bonnet monkey (Macaca radiata) cervical mucus glycoproteins exhibiting multiple blood group activities. (1986 - Nasir-Ud-Din , Jeanloz R, Lamblin G, Roussel P, van Halbeek H, Mutsaers J, Vliegenthart J) / Status : Reviewed
- Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
- Characterization of O-glycosidically linked oligosaccharides of rat erythrocyte membrane sialoglycoproteins. (1986 - Edge A, Van Langenhove A, Reinhold V, Weber P) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Porcine submaxillary mucin contains alpha 2----3- and alpha 2----6-linked N-acetyl- and N-glycolylneuraminic acid. (1986 - Savage A, Koppen P, Schiphorst W, Trippelvitz L, Van Halbeek H, Vliegenthart J, Van den Eijnden D) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Structures of the carbohydrate units of polysialoglycoproteins isolated from the eggs of four species of salmonid fishes. (1985 - Iwasaki M, Inoue S) / Status : Reviewed
- Structural studies of O-glycosidic oligosaccharide units of dog erythrocyte glycophorin. (1985 - Yamashita T, Murayama J, Utsumi H, Hamada A) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- Structures of the major oligosaccharides from a human rectal adenocarcinoma glycoprotein. (1983 - Kurosaka A, Nakajima H, Funakoshi I, Matsuyama M, Nagayo T, Yamashina I) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - Mellis S, Baenziger J) / Status : Reviewed
- The structures of the carbohydrate moieties of bovine blood coagulation factor X. (1980 - Mizuochi T, Yamashita K, Fujikawa K, Titani K, Kobata A) / Status : Reviewed
- A 360-MHz 1H-NMR study of three oligosaccharides isolated from cow kappa-casein. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolles P) / Status : Reviewed
- Isolation and characterization of oligosaccharides from canine submaxillary mucin. (1974 - Lombart C, Winzler R) / Status : Reviewed
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Erythropoietin / Homo sapiens
- Undefined site
-
Glycophorin-A / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin heavy variable 4-39 / Homo sapiens
- Undefined site
- Interferon alpha-2 / Homo sapiens
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
-
Proteoglycan / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Rgm / Homo sapiens
- Undefined site
- Sex hormone-binding globulin / Homo sapiens
- Tumor-necrosis factor-alpha / Homo sapiens
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Coagulation factor x / Bos taurus
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Glycophorin / Canis lupus familiaris
- Undefined site
-
Mucin / Canis lupus familiaris
- Undefined site
-
Mucin / Macaca radiata
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Polysialoglycoprotein (psgp) / Salvelinus leucomaenis pluvius
- Undefined site
-
Mucin / Bufo arenarum
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Uncharacterized protein / Bufo japonicus
- Undefined site
-
Mucin / Bufo viridis
- Undefined site
-
Mucin / Rana dalmatina
- Undefined site
-
Mucin / Xenopus tropicalis
- Undefined site
-
Ovomucin / Gallus gallus
- Undefined site
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Synovial Fluid (UBERON_0001090)
- HEK293-F (CVCL_6642)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Proteoglycan 4 (lubricin) / Homo sapiens
- SCDTPPPCPR (10aa)
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-122     Immunoglobulin heavy constant gamma 3 / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-137     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-122     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(g) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin gamma-3 (anti-GDob1 allotype G3m(s) / monoclonal) / Homo sapiens
- P01860 Thr-152     Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Erythropoietin / Homo sapiens
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Brain (UBERON_0000955)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Pancreas (UBERON_0001264)
- CCRF-CEM (CVCL_0207) Lymphocyte (CL_0000542)
- Rat1 (CVCL_0492)
- Lymphocyte (CL_0000542)
- T-Lymphocyte (CL_0000084)
- Erythroleukemia with associated Polycythemia
- Leukemia, Acute lymphoblastic (DOID:9952)
- Pancreatitis, Chronic (DOID:4989)
- Wiskott-Aldrich Syndrome (DOID:9169)
- O-linked olgiosaccharide on the 75-kDa neurotrophin receptor (1996 - Chapman, Eckart, Kaufman, Lapointe) / Status : Reviewed
- Variation of the glycosylation of human pancreatic bile-salt-dependent lipase. (1993 - Mas E, Abouakil N, Roudani S, Franc J, Montreuil J, Lombardo D) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Altered O-glycan synthesis in lymphocytes from patients with Wiskott-Aldrich syndrome. (1991 - Piller F, Le Deist F, Weinberg K, Parkman R, Fukuda M) / Status : Reviewed
- Characterization of a human lymphocyte surface sialoglycoprotein that is defective in Wiskott-Aldrich syndrome. (1984 - Remold-O'Donnell E, Kenney D, Parkman R, Cairns L, Savage B, Rosen F) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of rat brain glycoproteins. (1975 - Finne J) / Status : Reviewed
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
-
Gpl115 / Homo sapiens
- Undefined site
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Tumor necrosis factor receptor superfamily member 16 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus
- Undefined site
-
Env polyprotein (secondary product, gp65) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Adenocarcinoma (DOID:299)
-
Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/2tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Structure of the O-glycosidically linked carbohydrate units of rat brain glycoproteins. (1975 - Finne J) / Status : Reviewed
- Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides. (1969 - Thomas D, Winzler R) / Status : Reviewed
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Brain / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 1
(avg mass : 674.6106)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Glycosylation pattern of human inter-alpha-inhibitor heavy chains. (1998 - Flahaut C, Capon C, Balduyck M, Ricart G, Sautiere P, Mizon J) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Amniotic Fluid (UBERON_0000173)
- Aorta (UBERON_0000947)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colonic Mucosa (UBERON_0000317) HT29-16E (CVCL_C763)
- Colostrum (UBERON_0001914)
- Connective Tissue (UBERON_0002384) LTK (CVCL_R978)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914)
- Kidney (UBERON_0002113) BHK570 (CVCL_6370) Fibroblast (CL_0000057)
- Liver (UBERON_0002107) AH66-TC (CVCL_4368) Plasma Membrane (GO_0005886)
- Liver (UBERON_0002107) Zajdela-Hepatoma (CVCL_1D00) Cell Surface (GO_0009986)
- Lymph Node (UBERON_0000029) CCRF-HSB-2 (CVCL_1859)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) T-47D (CVCL_0553)
- Mammary Gland (UBERON_0001911) TA3/Ha (CVCL_4321)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Milk (UBERON_0001913)
- Mucosa of Small Intestine (UBERON_0001204)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DXB11 (CVCL_1977)
- Pleura (UBERON_0000977) K-562 (CVCL_0004)
- Pulmonary Mucosa
- Retina (UBERON_0000966)
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Tracheal Mucosa (UBERON_0000379)
- Transudate (UBERON_0007779)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Zona Pellucida (UBERON_0000086)
- 17cl1 (CVCL_VT75) Fibroblast (CL_0000057)
- C6 (CVCL_0194) Glial Cell (CL_0000125)
- CCRF-CEM (CVCL_0207) T-Lymphocyte (CL_0000084)
- COLO 205 (CVCL_0218)
- COLO 320 (CVCL_1989)
- Caco-2 (CVCL_0025)
- Co115 (CVCL_D102)
- DLD-1 (CVCL_0248)
- Eveline (CVCL_A1LI)
- HCT 116 (CVCL_0291)
- HCT 15 (CVCL_0292)
- HCT 8 (CVCL_2478)
- HL-60 (CVCL_0002) Leukocyte (CL_0000738)
- HT29 (CVCL_A8EZ)
- KM12 (CVCL_1331)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- RKO (CVCL_0504)
- SW1116 (CVCL_0544)
- SW1398 (CVCL_3885)
- SW1463 (CVCL_1718)
- SW48 (CVCL_1724)
- SW620 (CVCL_0547)
- SW837 (CVCL_1729)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- WiDr (CVCL_2760)
- Egg Cell
- Erythrocyte (CL_0000232)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Granulocyte (CL_0000094)
- Lymphocyte (CL_0000542)
- Neutrophil (CL_0000775)
- Platelet (CL_0000233) Plasma Membrane (GO_0005886)
- Chromaffin Granules (GO_0042583)
- Plasma Membrane (GO_0005886)
- Very-Low-Density Lipoprotein Particle (GO_0034361)
- Adenocarcinoma (DOID:299)
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, breast (DOID:1612)
- Carcinoid Tumor, with multiple liver metastasis
- Carcinoma, Hepatocellular (DOID:684)
- Cecum adenocarcinoma (DOID:3039)
- Chondrosarcoma (DOID:3371)
- Choriocarcinoma (DOID:3594)
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- Cystic Fibrosis (DOID:1485)
- Dyscrasia, Plasma Cell (DOID:6536)
- Glioma
- Hybridoma
- Hyperlipoproteinemia, Familial Type V (DOID:1171)
- Kidney Failure, Chronic (DOID:784)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Leukemia, Acute lymphoblastic and HIV-1
- Leukemia, Acute myelogenous (DOID:9119)
- Leukemia, Myloid, Chronic (DOID:8552)
- Leukemia, Promyelocytic (DOID:0060318)
- Lymphoma (DOID:0060058)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Parasite Nippostrongylus brasiliensis nfection
- Parkinson's disease (DOID:14330)
- Rectal adenocarcinoma (DOID:1996)
- Sialidosis (Mucolipidosis I) (DOID:3343)
- Tn Polyagglutinability Syndrome (DOID:0080520)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Site-specific analysis of the O-glycosylation of bovine fetuin by electron-transfer dissociation mass spectrometry (2014 - Windwarder M, Altmann F) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Structural elucidation of the N- and O-glycans of human apolipoprotein(a): role of O-glycans in conferring protease resistance. (2001 - Garner B, Merry A, Royle L, Harvey D, Rudd P, Thillet J) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Identification of transient glycosylation alterations of sialylated mucin oligosaccharides during infection by the rat intestinal parasite Nippostrongylus brasiliensis. (2000 - Karlsson N, Olson F, Jovall P, Andersch Y, Enerbck L, Hansson G) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Impaired galactosylation of core 2 O-glycans in erythrocytes of beta1,4-galactosyltransferase knockout mice. (1999 - Kotani N, Asano M, Iwakura Y, Takasaki S) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Characterization of SPACR, a sialoprotein associated with cones and rods present in the interphotoreceptor matrix of the human retina: immunological and lectin binding analysis. (1998 - Acharya S, Rayborn M, Hollyfield J) / Status : Reviewed
- Human low-molecular-weight salivary mucin expresses the sialyl lewisx determinant and has L-selectin ligand activity. (1998 - Prakobphol A, Thomsson K, Hansson G, Rosen S, Singer M, Phillips N, Medzihradszky K, Burlingame A, Leffler H, Fisher S) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Expression of N-linked sialyl Le(x) determinants and O-glycans in the carbohydrate moiety of human amniotic fluid transferrin during pregnancy. (1998 - van Rooijen J, Jeschke U, Kamerling J, Vliegenthart J) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of human chromogranin A (CGA79-439) from urine of patients with carcinoid tumors. (1998 - Gadroy P, Stridsberg M, Capon C, Michalski J, Strub J, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- The structural analysis of the O-glycans of the jacalin-bound rabbit immunoglobulin G. (1997 - Kabir S, Gerwig G) / Status : Reviewed
- Glycosylation analysis and protein structure determination of murine fetal antigen 1 (mFA1)--the circulating gene product of the delta-like protein (dlk), preadipocyte factor 1 (Pref-1) and stromal-cell-derived protein 1 (SCP-1) cDNAs. (1997 - Krogh T, Bachmann E, Teisner B, Skjdt K, Hjrup P) / Status : Reviewed
- Structural determination of the O-linked sialyl oligosaccharides liberated from fetuin with endo-alpha-N-acetylgalactosaminidase-S by HPLC analysis and 600-MHz 1H-NMR spectroscopy. (1997 - Ishii-Karakasa I, Iwase H, Hotta K) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Phosphorylation and O-glycosylation sites of bovine chromogranin A from adrenal medullary chromaffin granules and their relationship with biological activities. (1997 - Strub J, Sorokine O, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Evidence for a novel O-linked sialylated trisaccharide on Ser-248 of human plasminogen 2. (1997 - Pirie-Shepherd S, Stevens R, Andon N, Enghild J, Pizzo S) / Status : Reviewed
- Study of O-sialylation of glycoproteins in C6 glioma cells treated with retinoic acid. (1996 - Reboul P, George P, Miquel D, Louisot P, Broquet P) / Status : Reviewed
- Peptide, disulfide, and glycosylation mapping of recombinant human thrombopoietin from ser1 to Arg246. (1996 - Hoffman RC, Andersen H, Walker K, Krakover JD, Patel S, Stamm MR, Osborn SG) / Status : Reviewed
- The structure of the O-linked carbohydrate chain of bovine seminal plasma protein PDC-109 revised by H-NMR spectroscopy A correction. (1996 - Gerwig G, Calvete J, Tpfer-Petersen E, Vliegenthart J) / Status : Reviewed
- Comparison of O-linked carbohydrate chains in MUC-1 mucin from normal breast epithelial cell lines and breast carcinoma cell lines. Demonstration of simpler and fewer glycan chains in tumor cells. (1996 - Lloyd KO, Burchell J, Kudryashov V, Yin BW, Taylor-Papadimitriou J) / Status : Reviewed
- Antibacterial activity of glycosylated and phosphorylated chromogranin A-derived peptide 173-194 from bovine adrenal medullary chromaffin granules. (1996 - Strub J, Goumon Y, Lugardon K, Capon C, Lopez M, Moniatte M, Van Dorsselaer A, Aunis D, Metz-Boutigue M) / Status : Reviewed
- Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units. (1995 - Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Altered sialylation of CD45 in HIV-1-infected T lymphocytes. (1994 - Lefebvre J, Giordanengo V, Doglio A, Cagnon L, Breittmayer J, Peyron J, Lesimple J) / Status : Reviewed
- Structure determination of the intact major sialylated oligosaccharide chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. (1994 - Watson E, Bhide A, van Halbeek H) / Status : Reviewed
- An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A. (1993 - Krotkiewski H, Lisowska E, Nilsson G, Grnberg G, Nilsson B) / Status : Reviewed
- Structural features of carbohydrate chains in human salivary mucins. (1993 - Slomiany B, Murty V, Slomiany A) / Status : Reviewed
- Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells. (1993 - Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H) / Status : Reviewed
- Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells. (1993 - Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A) / Status : Reviewed
- Oligosaccharide structures of mucins secreted by the human colonic cancer cell line CL.16E. (1992 - Capon C, Laboisse C, Wieruszeski J, Maoret J, Augeron C, Fournet B) / Status : Reviewed
- Structure of the N- and O-glycans of the A-chain of human plasma alpha 2HS-glycoprotein as deduced from the chemical compositions of the derivatives prepared by stepwise degradation with exoglycosidases. (1992 - Watzlawick H, Walsh M, Yoshioka Y, Schmid K, Brossmer R) / Status : Reviewed
- Analysis of glycoform of O-glycan from human myeloma immunoglobulin A1 by gas-phase hydrazinolysis following pyridylamination of oligosaccharides. (1992 - Iwase H, Ishii-Karakasa I, Fujii E, Hotta K, Hiki Y, Kobayashi Y) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- 1H and 13C-NMR assignments for sialylated oligosaccharide-alditols related to mucins. Study of thirteen components from hen ovomucin and swallow nest mucin. (1992 - Strecker G, Wieruszeski J, Cuvillier O, Michalski J, Montreuil J) / Status : Reviewed
- O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome. (1992 - Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Structure determination of the major N- and O-linked carbohydrate chains of the beta subunit from equine chorionic gonadotropin. (1990 - Damm J, Hard K, Kamerling J, van Dedem G, Vliegenthart J) / Status : Reviewed
- O-linked oligosaccharides from human serum immunoglobulin A1. (1989 - Field M, Dwek R, Edge C, Rademacher T) / Status : Reviewed
- Expression of human interleukin-2 in recombinant baby hamster kidney, Ltk-, and Chinese hamster ovary cells. Structure of O-linked carbohydrate chains and their location within the polypeptide. (1989 - Conradt H, Nimtz M, Dittmar K, Lindenmaier W, Hoppe J, Hauser H) / Status : Reviewed
- Structural analysis by fast-atom-bombardment mass spectrometry of the mixture of alditols derived from the O-linked oligosaccharides of murine glycophorins. (1988 - Krotkiewski H, Lisowska E, Angel A, Nilsson B) / Status : Reviewed
- Isolation and structural characterization of low-molecular-mass monosialyl oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis. (1988 - van Halbeek H, Breg J, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- The N- and O-linked carbohydrate chains of human, bovine and porcine plasminogen. Species specificity in relation to sialylation and fucosylation patterns. (1988 - Marti T, Schaller J, Rickli E, Schmid K, Kamerling J, Gerwig G, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structural analysis of O-glycosidic type of sialyloligosaccharide-alditols derived from urinary glycopeptides of a sialidosis patient. (1988 - van Pelt J, Van Bilsen D, Kamerling J, Vliegenthart J) / Status : Reviewed
- [Sialic acid containing compounds in the hemofiltrate of patients with chronic renal insufficiency. II. Isolation and structure determination of sialoglycopeptides] (1987 - Weisshaar G, Baumann W, Friebolin H, Brunner H, Mann H, Sieberth H, Opferkuch H) / Status : Reviewed
- The structures of N- and O-glycosidic carbohydrate chains of a chondroitin sulfate proteoglycan isolated from the media of the human aorta. (1987 - Akiyama F, Stevens R, Hayashi S, Swann D, Binette J, Caterson B, Schmid K, Van Halbeek H, Mutsaers J, Gerwig G) / Status : Reviewed
- Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins. (1987 - Fukuda M, Lauffenburger M, Sasaki H, Rogers ME, Dell A) / Status : Reviewed
- Membrane glycophorins of Dantu blood group erythrocytes. (1987 - Blumenfeld O, Smith A, Moulds J) / Status : Reviewed
- Membrane glycophorins in Sta blood group erythrocytes. (1986 - Blumenfeld O, Adamany A, Kikuchi M, Sabo B, McCreary J) / Status : Reviewed
- Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
- The structure of the O-glycosidic oligosaccharide chains of the major Zajdela hepatoma ascites-cell-membrane glycoprotein. (1986 - Nato F, Goulut C, Bourrillon R, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Characterization of O-glycosidically linked oligosaccharides of rat erythrocyte membrane sialoglycoproteins. (1986 - Edge A, Van Langenhove A, Reinhold V, Weber P) / Status : Reviewed
- Porcine submaxillary mucin contains alpha 2----3- and alpha 2----6-linked N-acetyl- and N-glycolylneuraminic acid. (1986 - Savage A, Koppen P, Schiphorst W, Trippelvitz L, Van Halbeek H, Vliegenthart J, Van den Eijnden D) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structural variations of O-linked oligosaccharides present in leukosialin isolated from erythroid, myeloid, and T-lymphoid cell lines. (1986 - Carlsson S, Sasaki H, Fukuda M) / Status : Reviewed
- Structure determination of oligosaccharides isolated from Cad erythrocyte membranes by permethylation analysis and 500-MHz 1H-NMR spectroscopy. (1985 - Herkt F, Parente J, Leroy Y, Fournet B, Blanchard D, Cartron J, van Halbeek H, Vliegenthart J) / Status : Reviewed
- Oligosaccharide structures of the low-molecular-weight salivary mucin from a normal individual and one with cystic fibrosis. (1985 - Reddy M, Levine M, Prakobphol A) / Status : Reviewed
- Structures of the major carbohydrates of natural human interleukin-2. (1985 - Conradt H, Geyer R, Hoppe J, Grotjahn L, Plessing A, Mohr H) / Status : Reviewed
- Structural studies of O-glycosidic oligosaccharide units of dog erythrocyte glycophorin. (1985 - Yamashita T, Murayama J, Utsumi H, Hamada A) / Status : Reviewed
- Glycoprotein E1 of MHV-A59: structure of the O-linked carbohydrates and construction of full length recombinant cDNA clones. (1984 - Niemann H, Heisterberg-Moutsis G, Geyer R, Klenk H, Wirth M) / Status : Reviewed
- Structural studies on the O-linked carbohydrate chains of human platelet glycocalicin. (1984 - Korrel S, Clemetson K, Van Halbeek H, Kamerling J, Sixma J, Vliegenthart J) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- The carbohydrates of mouse hepatitis virus (MHV) A59: structures of the O-glycosidically linked oligosaccharides of glycoprotein E1. (1984 - Niemann H, Geyer R, Klenk H, Linder D, Stirm S, Wirth M) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Study of the carbohydrate moiety of human serum sex hormone-binding globulin. (1983 - Avvakumov G, Matveentseva I, Akhrem L, Strel'chyonok O, Akhrem A) / Status : Reviewed
- Isolation and characterization of the O-glycan chain of the human vitamin-D binding protein. (1983 - Viau M, Constans J, Debray H, Montreuil J) / Status : Reviewed
- Characterization of the B-chain of human plasma alpha 2HS-glycoprotein. The complete amino acid sequence and primary structure of its heteroglycan. (1983 - Gejyo F, Chang J, Brgi W, Schmid K, Offner G, Troxler R, Van Halbeek H, Dorland L, Gerwig G, Vliegenthart J) / Status : Reviewed
- Structures of the O-glycosidically linked oligosaccharides of human IgD. (1983 - Mellis S, Baenziger J) / Status : Reviewed
- Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
- Glycoproteins and proteoglycans of the chromaffin granule matrix. (1982 - Kiang W-L, Krusius T, Finne J, Margolis RU, Margolis RK) / Status : Reviewed
- Structures of N-linked and O-linked oligosaccharides on proteoglycan monomer isolated from the Swarm rat chondrosarcoma. (1982 - Nilsson B, De Luca S, Lohmander S, Hascall V) / Status : Reviewed
- Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
- Structures of sialylated O-glycosidically and N-glycosidically linked oligosaccharides in a monoclonal immunoglobulin light chain. (1981 - Chandrasekaran EV, Mendicino A, Garver FA, Mendicino J) / Status : Reviewed
- Localization of the carbohydrate units in a human immunoglobulin light chain, protein Sm lambda. (1981 - Garver F, Chang L, Kiefer C, Mendicino J, Chandrasekaran E, Isobe T, Osserman E) / Status : Reviewed
- The chemical structure of the main sugar moiety isolated from bovine whole casein. (1980 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- The structures of the carbohydrate moieties of bovine blood coagulation factor X. (1980 - Mizuochi T, Yamashita K, Fujikawa K, Titani K, Kobata A) / Status : Reviewed
- A 360-MHz 1H-NMR study of three oligosaccharides isolated from cow kappa-casein. (1980 - van Halbeek H, Dorland L, Vliegenthart J, Fiat A, Jolles P) / Status : Reviewed
- Oligosaccharides on proteoglycans from the swarm rat chondrosarcoma. (1980 - Lohmander L, De Luca S, Nilsson B, Hascall V, Caputo C, Kimura J, Heinegard D) / Status : Reviewed
- The structure of the O-glycosylically-linked oligosaccharide chains of LPG-I, a glycoprotein present in articular lubricating fraction of bovine synovial fluid. (1980 - Garg H, Swann D, Glasgow L) / Status : Reviewed
- Cow kappa-casein: structure of the carbohydrate portion. (1979 - Fournet B, Fiat A, Alais C, Jolls P) / Status : Reviewed
- Chemical structure of epiglycanin, the major glycoprotein of the TA3-Ha ascites cell. The carbohydrate chains. (1979 - van den Eijnden D, Evans N, Codington J, Reinhold V, Silber C, Jeanloz R) / Status : Reviewed
- Carbohydrate of the human plasminogen variants. III. Structure of the O-glycosidically linked oligosaccharide unit. (1979 - Hayes M, Castellino F) / Status : Reviewed
- Characterization of the oligosaccharide side chain of apolipoprotein C-III from human plasma very low density lipoproteins. (1978 - Vaith P, Assmann G, Uhlenbruck G) / Status : Reviewed
- Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
- Structure of the O-glycosidically linked carbohydrate units of fetuin. (1974 - Spiro R, Bhoyroo V) / Status : Reviewed
- Alpha-2-HS-glycoprotein / Homo sapiens
-
Apolipoprotein (a) / Homo sapiens
- Undefined site
- Apolipoprotein C-III / Homo sapiens
-
Chondroitin sulfate proteoglycan / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
- Chromogranin a / Homo sapiens
-
Erythropoietin / Homo sapiens
- Undefined site
-
Glycocalicin / Homo sapiens
- Undefined site
-
Glycophorin a and b / Homo sapiens
- Undefined site
-
Glycophorin a, b and c / Homo sapiens
- Undefined site
-
Glycophorin-A / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin heavy variable 4-39 / Homo sapiens
- Undefined site
- Immunoglobulin lambda-1 light chain / Homo sapiens
- Interleukin-2 / Homo sapiens
-
Leukosialin (cd43) / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
-
Mucin-5B / Homo sapiens
- Undefined site
-
Mucin-7 / Homo sapiens
- Undefined site
- Plasminogen / Homo sapiens
-
Proteoglycan / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Sex hormone-binding globulin / Homo sapiens
-
Spacr / Homo sapiens
- Undefined site
-
Thrombopoietin / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Transudate / Homo sapiens
- Undefined site
-
Uncharacterized protein from Urine / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Vitamin d-binding protein / Homo sapiens
- Undefined site
- Alpha-2-hs-glycoprotein / Bos taurus
-
Casein / Bos taurus
- Undefined site
- Chromogranin a / Bos taurus
-
Coagulation factor x / Bos taurus
- Undefined site
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
-
Lpg-1 / Bos taurus
- Undefined site
- Plasminogen / Bos taurus
- Seminal plasma protein pdc-109 / Bos taurus
-
Uncharacterized protein / Bos taurus
- Undefined site
-
Glycophorin / Canis lupus familiaris
- Undefined site
-
Choriogonadotropin beta chain / Equus caballus
- Undefined site
-
Epiglycanin / Mus musculus
- Undefined site
-
Fetal antigen 1 / Mus musculus
- Undefined site
-
Glycophorin / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Uncharacterized protein / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Major membrane glycoprotein - MII2 / Rattus norvegicus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Sialoglycoprotein (rspg-4) / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Uncharacterized proteoglycan / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
- Plasminogen / Sus scrofa
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Ovomucin / Gallus gallus
- Undefined site
-
E1 glycoprotein / Murine hepatitis virus (strain a59)
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Seminal Fluid (UBERON_0006530)
- Striatum (UBERON_0002345)
- Substantia Nigra (UBERON_0002038)
- HEK293 (CVCL_0045)
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Localization and structural characterization of an oligosaccharide O-linked to bovine PDC-109. Quantitation of the glycoprotein in seminal plasma and on the surface of ejaculated and capacitated spermatozoa. (1994 - Calvete J, Raida M, Sanz L, Wempe F, Scheit K, Romero A, Tpfer-Petersen E) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Seminal plasma protein pdc-109 / Bos taurus
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Blood Plasma (UBERON_0001969)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Posttranslational modifications of human inter-alpha-inhibitor: identification of glycans and disulfide bridges in heavy chains 1 and 2. (1998 - Olsen E, Rahbek-Nielsen H, Thogersen I, Roepstorff P, Enghild J) / Status : Reviewed
- Coagulation factor V / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h1 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h2 / Homo sapiens
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- EAISPPDAASAAPLR (15aa)
-
- O-Linked / Core 1
(avg mass : 674.6106)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- O-Linked / Core 8
(avg mass : 674.6106)
- Bronchitis, Chronic (DOID:6132)
- Structures of monosialyl oligosaccharides isolated from the respiratory mucins of a non-secretor (O, Lea+b-) patient suffering from chronic bronchitis. Characterization of a novel type of mucin carbohydrate core structure. (1994 - van Halbeek H, Strang A, Lhermitte M, Rahmoune H, Lamblin G, Roussel P) / Status : Reviewed
- Structure of acidic oligosaccharides isolated from pronase-treated glycoprotein of bonnet-monkey (Macaca radiata) cervical mucus. (1987 - Nasir-ud-Din ) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Macaca radiata
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Adenocarcinoma (DOID:299)
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- Structural analysis by fast-atom-bombardment mass spectrometry of the mixture of alditols derived from the O-linked oligosaccharides of murine glycophorins. (1988 - Krotkiewski H, Lisowska E, Angel A, Nilsson B) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Glycophorin / Mus musculus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Brain (UBERON_0000955)
-
Dystroglycan / Ovis aries
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Control/Healthy
- Naturally Occurring Structural Isomers in Serum IgA1 O-Glycosylation (2012 - Kazuo Takahashi, Archer D. Smith, IV, Knud Poulsen, Mogens Kilian, Bruce A. Julian, Jiri Mestecky, Jan Novak, Matthew B. Renfrow) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
- HYTNPSQDVTVPCPVPSTPPTPSP (24aa)
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Placenta (UBERON_0001987)
- Skin of Body (UBERON_0002097) A-431 (CVCL_0037) Fibroblast (CL_0000057)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Chromaffin Granules (GO_0042583)
- Carcinoma, Squamous cell (DOID:1749)
- Chromogranin A from bovine adrenal medulla: molecular characterization of glycosylations, phosphorylations, and sequence heterogeneities by mass spectrometry. (1999 - Bauer S, Zhang X, Van Dongen W, Claeys M, Przybylski M) / Status : Reviewed
- Identification of the O-linked glycosylation site of the human transferrin receptor. (1992 - Hayes G, Enns C, Lucas J) / Status : Reviewed
- Natural human interferon-alpha 2 is O-glycosylated. (1991 - Adolf G, Kalsner I, Ahorn H, Maurer-Fogy I, Cantell K) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus. (1981 - Blumenfeld O, Adamany A, Puglia K) / Status : Reviewed
-
Glycophorin B Miltenberger subtype III / Homo sapiens
- Undefined site
- Interferon alpha-2 / Homo sapiens
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
- Transferrin receptor protein 1 / Homo sapiens
- Chromogranin a / Bos taurus
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Adenocarcinoma (DOID:299)
-
gG-2 / Human herpes simplex virus 2
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
- A nucleotide insertion frameshift cause albumin Kenitra, an extended and O-glycosylated mutant of human serum albumin with two additional disulfide bridges (2001 - Minchiotti, Campagnoli, Rossi, Cosulich, Monti, Pucci, Kragh-Hansen, Granel, Disdier, Weiller, Galliano) / Status : Reviewed
-
Serum albumin / Homo sapiens
- Undefined site
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Large Intestine (UBERON_0000059)
- Small Intestine (UBERON_0002108)
- Adenocarcinoma (DOID:299)
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 674.6106)
- BALL-1 (CVCL_1075) Lymphocyte (CL_0000542)
- Tumor-necrosis factor-alpha / Homo sapiens
-
- Hex:1 HexNAc:1 NeuAc:1 / O-Linked
(avg mass : 674.6106)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- O-Linked / Core 1 / Gal(?1-?)GalNAc + "Neu5Ac"
- O-Linked / Core 1 / Gal(b1-3)[Neu5Ac(?2-?)]GalNAc(a1-
- O-Linked / Core 1 / Gal(b1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a + "Neu5Ac(a"
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a +"NeuAc"
- O-Linked / Core 1 / Gal(b1-3)GalNAc+"+ NeuAc"
- O-Linked / Core 1 / Gal(b1-3)GalNAc+"+ NeuAc(a2-?)"
- O-Linked / Core 1 / NeuAc(?2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(?2-?)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-6)Gal(b1-3)GalNAc
- O-Linked / Core 1 / NeuAc(a2-?)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 9259
- O-Linked / Core 1 / Structure 11170
- O-Linked / Core 8 / Gal(a1-3)[NeuAc(a2-6)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)[NeuAc(?2-6)]GalNAc
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ NeuAc"
- O-Linked / Undefined core / Gal(?1-3)GalNAc+"+ NeuAc(?2-?)"
- O-Linked / Undefined core / Gal(?1-?)GalNAc+"+ NeuAc"
- O-Linked / Undefined core / Gal(b1-?)GalNAc+"+ NeuAc"
- O-Linked / Undefined core / Hex(?1-?)HexNAc+"+ NeuAc"
- O-Linked / Undefined core / NeuAc(?2-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / NeuAc(?2-?)Gal(?1-?)GalNAc
- O-Linked / Undefined core / NeuAc(a2-3)Gal(?1-3)GalNAc
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycomic analysis of high density lipoprotein shows a highly sialylated particle (2014 - Huang J1, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Complement c4-a / Homo sapiens
- Hemopexin / Homo sapiens
- Insulin-like growth factor II / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Kininogen-1 / Homo sapiens
- N-acetylmuramoyl-l-alanine amidase / Homo sapiens
- Phosphoinositide-3-kinase-interacting protein 1 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Protein YIPF3 / Homo sapiens
- Semenogelin-2 / Homo sapiens
- Sparc-like protein 1 / Homo sapiens
- Uromodulin / Homo sapiens
- Alpha-2-hs-glycoprotein / Bos taurus
- Kappa casein / Bos taurus
- EDQTSPAPGLR (11aa)
- TPLPPTSAHGNVAEGETKPDPDVTER (26aa)
- VATTVISK (8aa)
- DVSTPPTVLPDNFPR (15aa)
- MAETCVPVLRCNTAAPMWLNGTHPSSDEGIVSR (33aa)
- AVAVTLQSH (9aa)
- NHGVDDDGDDDGDDGGTDGPR (21aa)
- SQIQTPNPNQDQWSGQNAK (19aa)
- EPPPRTLPATDLQ (13aa)
- DQADGSRASVDSGSSEEQGGSSR (23aa)
- IEETTMTTQTPAPIQAPSAILPLPGQSVER (30aa)
- APVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR (44aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:1 HexNAc:1 NeuAc:1 / O-Linked
(avg mass : 674.6106)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Source
Disease
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Disease
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Source
Disease
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Undefined core
(avg mass : 674.6106)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Source
Disease
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 674.6106)
Disease
Reference
Reported glycosite
- O-Linked / Core 8
(avg mass : 674.6106)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 1
(avg mass : 674.6106)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Reported glycosite
- O-Linked / Core 1
(avg mass : 674.6106)
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 674.6106)
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 674.6106)
Source
Disease
Reported glycosite
- Free / No-core
(avg mass : 674.6106)
Source
Reference
Reported glycosite
- Free / Lactosamine
(avg mass : 674.6106)
Source
Reference
Reported glycosite
- Free / Lactosamine
(avg mass : 674.6106)