Hex:6 HexNAc:6 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Rattus norvegicus (Norway rat)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Biglycan / Homo sapiens    P21810
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Catenin delta-1 / Homo sapiens    O60716
• CD59 glycoprotein / Homo sapiens    P13987
• Ceruloplasmin / Homo sapiens    P00450
• Clusterin / Homo sapiens    P10909
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Ectopic P granules protein 5 homolog / Homo sapiens    Q9HCE0
• Erythropoietin / Homo sapiens    P01588
• Fibromodulin / Homo sapiens    Q06828
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Sialomucin core protein 24 / Homo sapiens    Q04900
• Neuroligin 1 / Rattus norvegicus    Q62765
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Colon (UBERON_0001155)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• EBV-transformed B-cell (CL_0000236)  
• Neutrophil (CL_0000775)  

Reported structure

• N-Linked / Complex / Structure 9352
• N-Linked / Complex / Structure 9532
• N-Linked / Complex / Structure 9732
• N-Linked / Complex / Structure 9826
• N-Linked / Complex / Structure 10057
• N-Linked / Complex / Structure 10170
• N-Linked / Complex / Structure 10173
• N-Linked / Complex / Structure 10249
• N-Linked / Complex / Structure 10278
• N-Linked / Complex / Structure 10286
• N-Linked / Complex / Structure 10448
• N-Linked / Complex / Structure 10543
• N-Linked / Complex / Structure 10566
• N-Linked / Complex / Structure 10568
• N-Linked / Complex / Structure 10687
• N-Linked / Undefined core / Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[Hex(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ HexNAc + NeuAc"

Composition

• Hex:6 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2647.4406 )

Disease

• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• Prostate cancer (DOID:10283)

Reference

• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed

Reported glycosite

• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-65
• Biglycan / Homo sapiens
  •        Asn-270
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
  •        Asn-104
  •        Asn-246
• Catenin delta-1 / Homo sapiens
  •        Asn-641
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Ceruloplasmin / Homo sapiens
  •        Asn-762
• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-374
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Ectopic P granules protein 5 homolog / Homo sapiens
  •        Asn-137
• Erythropoietin / Homo sapiens
  •        Asn-110
• Fibromodulin / Homo sapiens
  •        Asn-166
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-146
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-58
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Sialomucin core protein 24 / Homo sapiens
  •        Asn-72
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-1098
  •        Asn-1134
  •        Asn-1174
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-1074

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• NSCVSCFNVSVVNTTCFWIECK (22aa)
  •    Q04900    Asn-72     Sialomucin core protein 24 / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103     Clusterin / Homo sapiens
• YPNAS (5aa)
  •    P06731    Asn-104     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
  •    Q9HCE0    Asn-137     Ectopic P granules protein 5 homolog / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• SPLNTS (6aa)
  •    P06731    Asn-246     Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• NDTVDFPK (8aa)
  •    O60716    Asn-641     Catenin delta-1 / Homo sapiens
• EIHHIQEQNVSNAFIDKGEFYIGSK (25aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IGIVNNT (7aa)
  •    P0DTC2    Asn-1134     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GINASVV (7aa)
  •    P0DTC2    Asn-1174     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)