taxonomy (4)
protein (25)
source (17)
structure (19)
composition (1)
disease (8)
reference (17)
site (38)
peptide (35)
- Homo sapiens (Human)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein D / Homo sapiens P05090
- Biglycan / Homo sapiens P21810
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Catenin delta-1 / Homo sapiens O60716
- CD59 glycoprotein / Homo sapiens P13987
- Ceruloplasmin / Homo sapiens P00450
- Clusterin / Homo sapiens P10909
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Ectopic P granules protein 5 homolog / Homo sapiens Q9HCE0
- Erythropoietin / Homo sapiens P01588
- Fibromodulin / Homo sapiens Q06828
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Sialomucin core protein 24 / Homo sapiens Q04900
- Neuroligin 1 / Rattus norvegicus Q62765
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- EBV-transformed B-cell (CL_0000236)
- Neutrophil (CL_0000775)
Source
- N-Linked / Complex / Structure 9352
- N-Linked / Complex / Structure 9532
- N-Linked / Complex / Structure 9732
- N-Linked / Complex / Structure 9826
- N-Linked / Complex / Structure 10057
- N-Linked / Complex / Structure 10170
- N-Linked / Complex / Structure 10173
- N-Linked / Complex / Structure 10249
- N-Linked / Complex / Structure 10278
- N-Linked / Complex / Structure 10286
- N-Linked / Complex / Structure 10448
- N-Linked / Complex / Structure 10543
- N-Linked / Complex / Structure 10566
- N-Linked / Complex / Structure 10568
- N-Linked / Complex / Structure 10687
- N-Linked / Complex / Structure 11141
- N-Linked / Complex / Structure 11211
- N-Linked / Complex / Structure 11257
- N-Linked / Undefined core / Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[Hex(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ HexNAc + NeuAc"
Reported structure
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
- Prostate cancer (DOID:10283)
Disease
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein D / Homo sapiens
- Biglycan / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Catenin delta-1 / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibromodulin / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Sialomucin core protein 24 / Homo sapiens
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- LELNLTDSENATCLYAK (17aa)
- TAVNCSSDFDACLITK (16aa)
- YETTNK (6aa)
- CIQANYSIMENGK (13aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- NSCVSCFNVSVVNTTCFWIECK (22aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- YPNAS (5aa)
- TFYWDFYTNR (10aa)
- GQALLVNSSQPWEPLQLHVDK (21aa)
- TQSLLIVNNATNVVIK (16aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- VYSSANNCTFE (11aa)
- IYIDHNNITR (10aa)
- SPLNTS (6aa)
- MIENGSISFIPTIR (14aa)
- FPNITNLCPFGE (12aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- VFNATR (6aa)
- IANITQGEDQYYIR (14aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- NDTVDFPK (8aa)
- EIHHIQEQNVSNAFIDKGEFYIGSK (25aa)
- NMTLFSDLVAEK (12aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Erythropoietin / Homo sapiens
- GQALLVNSSQPWEPLQLHVDK (21aa)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Adipocytes (CL_0000136)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Control/Healthy
- Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
- Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
- Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Ascitic fluid (UBERON_0007795)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2647.4406)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2647.4406)
- Colon (UBERON_0001155)
-
- N-Linked / Undefined core
(avg mass : 2647.4406)
-
Neuroligin 1 / Rattus norvegicus
- Undefined site
-
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2647.4406)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- N-Linked / Complex / Structure 9352
- N-Linked / Complex / Structure 9532
- N-Linked / Complex / Structure 9732
- N-Linked / Complex / Structure 9826
- N-Linked / Complex / Structure 10057
- N-Linked / Complex / Structure 10170
- N-Linked / Complex / Structure 10173
- N-Linked / Complex / Structure 10249
- N-Linked / Complex / Structure 10278
- N-Linked / Complex / Structure 10286
- N-Linked / Complex / Structure 10448
- N-Linked / Complex / Structure 10543
- N-Linked / Complex / Structure 10566
- N-Linked / Complex / Structure 10568
- N-Linked / Complex / Structure 10687
- N-Linked / Complex / Structure 11141
- N-Linked / Complex / Structure 11211
- N-Linked / Complex / Structure 11257
- N-Linked / Undefined core / Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[Hex(?1-?)HexNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ HexNAc + NeuAc"
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Apolipoprotein D / Homo sapiens
- Biglycan / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Catenin delta-1 / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Fibromodulin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Sialomucin core protein 24 / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- LELNLTDSENATCLYAK (17aa)
- TAVNCSSDFDACLITK (16aa)
- YETTNK (6aa)
- CIQANYSIMENGK (13aa)
- NSCVSCFNVSVVNTTCFWIECK (22aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- SSCGKENTSDPSIVIAFGR (19aa)
- AFENVTDLQWLILDHNLLENSK (22aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- YPNAS (5aa)
- TFYWDFYTNR (10aa)
- KLHINHNNLTESVGPLPK (18aa)
- LHINHNNLTESVGPLPK (17aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- IYIDHNNITR (10aa)
- SPLNTS (6aa)
- MIENGSISFIPTIR (14aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- IANITQGEDQYYIR (14aa)
- NDTVDFPK (8aa)
- EIHHIQEQNVSNAFIDKGEFYIGSK (25aa)
- NMTLFSDLVAEK (12aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:6 dHex:1 NeuAc:1 / N-Linked
(avg mass : 2647.4406)
Reported glycosite
- N-Linked / Undefined core
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2647.4406)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2647.4406)
