Hex:3 HexNAc:6 NeuAc:1

Taxonomy

• Homo sapiens (Human)

Protein

• Glycodelin-a / Homo sapiens    P09466
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288

Source

• Amniotic Fluid (UBERON_0000173)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  

Reported structure

• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9762
• N-Linked / Complex / Structure 10726
• N-Linked / Complex / Structure 10986

Composition

• Hex:3 HexNAc:6 NeuAc:1 (avg mass : 2014.8704 )

Disease

• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)

Reference

• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed

Reported glycosite

• Glycodelin-a / Homo sapiens
  •        Asn-46
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69

Mass spectrometry observed peptide

• AVCGGVLVHPQWVLTAAHCIRNK (23aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens