taxonomy (1)
protein (3)
source (3)
structure (4)
composition (1)
disease (2)
reference (4)
site (3)
peptide (4)
- Homo sapiens (Human)
Taxonomy
- Glycodelin-a / Homo sapiens P09466
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
Protein
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9762
- N-Linked / Complex / Structure 10726
- N-Linked / Complex / Structure 10986
Reported structure
- Hex:3 HexNAc:6 NeuAc:1 (avg mass : 2014.8704 )
Composition
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
Reference
- Glycodelin-a / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
Reported glycosite
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NK (2aa)
- NKSVLLGR (8aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2014.8704)
- Amniotic Fluid (UBERON_0000173)
- Glycodelin-a / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2014.8704)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2014.8704)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 2014.8704)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2014.8704)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2014.8704)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2014.8704)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2014.8704)