Hex:2 HexNAc:2

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Capra hircus (Goat)
• Felis catus (Cat)
• Macaca radiata (Bonnet macaque)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Oncorhynchus masou ishikawai (Ishikawa's cherry salmon)
• Oncorhynchus mykiss (Rainbow trout)
• Oncorhynchus nerka adonis
• Bufo bufo (European toad)
• Rana catesbeiana (Bullfrog)
• Rana palustris
• Rana utricularia
• Gallus gallus (Chicken)
• Aspergillus awamori
• Megathura crenulata (Californian giant keyhole limpet)
• Antheraea pernyi (Chinese oak silkmoth)
• Apis mellifera (Honeybee)
• Bombyx mori (Domestic silkworm)
• Drosophila melanogaster (Fruit fly)
• Mamestra brassicae
• Spodoptera frugiperda (Fall armyworm)
• Trypanosoma cruzi
• Armoracia rusticana (Horseradish)
• Marburg virus (strain musoke)
• Schistosoma mansoni

Protein

• Apolipoprotein e / Homo sapiens    P02649
• CD59 glycoprotein / Homo sapiens    P13987
• Choriogonadotropin - alpha and beta chains / Homo sapiens    P01215    P0DN86
• Choriogonadotropin beta chain / Homo sapiens    P0DN86
• Glycoprotein ln / Homo sapiens
• Glycoprotein rg / Homo sapiens
• Immunoglobulin alpha (secretory) / Homo sapiens    P01876    P01877
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Interferon alpha-2 / Homo sapiens    P01563
• Interleukin-18-binding protein / Homo sapiens    O95998
• Kappa casein / Homo sapiens    P07498
• Lactotransferrin / Homo sapiens    P02788
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix metalloproteinase-9 / Homo sapiens    P14780
• Membrane component, chromosome 17, surface marker 2 / Homo sapiens    Q14596
• Muc1 fusion protein / Homo sapiens
• Muc1f (delta tr) / Homo sapiens    P15941
• Mucin / Homo sapiens
• Mucin-1 / Homo sapiens    P15941
• P-selectin glycoprotein ligand (psgl-1) / Homo sapiens    Q14242
• Progranulin / Homo sapiens    P28799
• Prosaposin / Homo sapiens    P07602
• Protein yipf3 / Homo sapiens    Q9GZM5
• Proteoglycan / Homo sapiens
• Proteoglycan 4 (lubricin) / Homo sapiens    Q92954
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens    P15941
• Recombinant Mucin-1 Muc1f/2tr / Homo sapiens    P15941    Q02817
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens    P15941    Q99102
• Recombinant Mucin-1 Muc1f/5actr / Homo sapiens    P15941    P98088
• Recombinant Mucin-1 Muc1f/5btr / Homo sapiens    P15941    Q9HC84
• Uncharacterized protein from Fluid / Homo sapiens
• Uncharacterized protein from Granulocyte / Homo sapiens
• Uncharacterized protein from Mammary Gland / Homo sapiens
• Uncharacterized protein from Meconium / Homo sapiens
• Uncharacterized protein from Seminal Fluid / Homo sapiens
• Zona pellucida sperm-binding protein 3 / Homo sapiens    P21754
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Gp-3 / Bos taurus
• Kappa casein / Bos taurus    P02668
• Lactophorin / Bos taurus    P80195
• Lactotransferrin / Bos taurus    P24627
• Mucin / Bos taurus
• Mucin / Capra hircus
• Mucin / Macaca radiata
• Acid ceramidase / Mus musculus    Q9WV54
• Adhesion G protein-coupled receptor B2 / Mus musculus    Q8CGM1
• Adipocyte plasma membrane-associated protein / Mus musculus    Q9D7N9
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus    P56528
• Apoptosis inhibitor 5 / Mus musculus    O35841
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• C-Jun-amino-terminal kinase-interacting protein 3 / Mus musculus    Q9ESN9
• Cadherin-13 / Mus musculus    Q9WTR5
• Carboxypeptidase E / Mus musculus    Q00493
• Contactin-1 / Mus musculus    P12960
• Contactin-associated protein-like 4 / Mus musculus    Q99P47
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Epiglycanin / Mus musculus    D9N008
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus    P63137
• Gamma-glutamyltransferase 7 / Mus musculus    Q99JP7
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus    P35438
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus    Q01097
• Immunoglobulin superfamily member 21 / Mus musculus    Q7TNR6
• Inactive dipeptidyl peptidase 10 / Mus musculus    Q6NXK7
• Integrin alpha-6 / Mus musculus    Q61739
• Integrin alpha-V / Mus musculus    P43406
• Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus    Q80TS3-2
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus    P11881-3
• Isoform 6 of Receptor-type tyrosine-protein phosphatase S / Mus musculus    B0V2N1-6
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Lysosomal alpha-glucosidase / Mus musculus    P70699
• Muc2 / Mus musculus
• Myelin-associated glycoprotein / Mus musculus    P20917
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neural cell adhesion molecule L1-like protein / Mus musculus    P70232
• Neurocan core protein / Mus musculus    P55066
• Neuroendocrine convertase 2 / Mus musculus    P21661
• Neurofascin / Mus musculus    Q810U3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Opioid-binding protein/cell adhesion molecule / Mus musculus    G5E8G3
• Phospholipase D3 / Mus musculus    O35405
• Plexin-A4 / Mus musculus    Q80UG2
• Prenylcysteine oxidase / Mus musculus    Q9CQF9
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Protein FAM171A2 / Mus musculus    A2A699
• Protein phosphatase 1 regulatory subunit 29 / Mus musculus    Q68FM6
• Receptor-type tyrosine-protein phosphatase eta / Mus musculus    Q64455
• Rho-associated protein kinase 2 / Mus musculus    P70336
• Roundabout homolog 2 / Mus musculus    Q7TPD3
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium channel subunit beta-4 / Mus musculus    Q7M729
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Tetraspanin-3 / Mus musculus    Q9QY33
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• TM2 domain-containing protein 3 / Mus musculus    Q8BJ83
• Zona pellucida sperm-binding protein 2 / Mus musculus    P20239
• Zona pellucida sperm-binding protein 3 / Mus musculus    P10761
• Brain non dialyzable glycopeptide / Oryctolagus cuniculus
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Asgp-1 / Rattus norvegicus
• Uncharacterized protein from Cell Membranes / Rattus norvegicus
• Mucin / Sus scrofa
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Polysialoglycoprotein (psgp) / Oncorhynchus masou ishikawai
• Polysialoglycoprotein (psgp) / Oncorhynchus mykiss
• Polysialoglycoprotein (psgp) / Oncorhynchus nerka adonis
• Mucin / Bufo bufo
• Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana    P80051
• Mucin / Rana palustris
• Mucin / Rana utricularia
• Ovalbumin / Gallus gallus    P01012
• Ovomucin / Gallus gallus
• Glucoamylase g1 / Aspergillus awamori    P69328
• Hemocyanin / Megathura crenulata    Q10583    Q10584
• Arylphorin / Antheraea pernyi    Q7Z1F8
• Uncharacterized protein from Hemolymph / Antheraea pernyi
• Hyaluronoglucosaminidase / Apis mellifera    Q08169
• Phospholipase a2 / Apis mellifera    P00630
• Membrane glycoproteins / Bombyx mori
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
• Membrane glycoproteins / Mamestra brassicae
• Membrane glycoproteins / Spodoptera frugiperda
• Uncharacterized protein from Undefined tissue / Trypanosoma cruzi
• Peroxidase c1a / Armoracia rusticana    P00433
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Circulating cathodic antigen / Schistosoma mansoni    O02197

Source

• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Cervical Mucosa (UBERON_0012248)  
• Colon (UBERON_0001155)   Caco-2 (CVCL_0025)  
• Colon (UBERON_0001155)   LS174T (CVCL_1384)  
• Colostrum (UBERON_0001914)  
• Hemolymph (UBERON_0001011)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)   AH66-TC (CVCL_4368)   Plasma Membrane (GO_0005886)  
• Liver (UBERON_0002107)  
• Liver (UBERON_0002107)   Cytoplasm (GO_0005737)  
• Mammary Gland (UBERON_0001911)   HBL-100 (CVCL_4362)  
• Mammary Gland (UBERON_0001911)   MCF-7 (CVCL_0031)  
• Mammary Gland (UBERON_0001911)   MDA-MB-231 (CVCL_0062)  
• Mammary Gland (UBERON_0001911)   TA3/Ha (CVCL_4321)  
• Mammary Gland (UBERON_0001911)   ZR-75-1 (CVCL_0588)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Mucosa of Large Intestine (UBERON_0001207)  
• Mucosa of Small Intestine (UBERON_0001204)  
• Neurohypophysis (UBERON_0002198)  
• Ovary (UBERON_0000992)   OVCAR-3 (CVCL_0465)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Ovary (UBERON_0000992)  
• Pituitary Gland (UBERON_0000007)  
• Pulmonary Mucosa  
• Saliva (UBERON_0001836)  
• Seminal Fluid (UBERON_0006530)  
• Submandibular Gland (UBERON_0001736)  
• Synovial Fluid (UBERON_0001090)  
• Thyroid (UBERON_0002046)  
• Tracheal Mucosa (UBERON_0000379)  
• Urine (UBERON_0001088)  
• Uterine Cervix (UBERON_0000002)   HEp-2 (CVCL_1906)  
• Venom (UBERON_0007113)  
• Zona Pellucida (UBERON_0000086)  
• BM-N (CVCL_Z633)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• HL-60 (CVCL_0002)   Leukocyte (CL_0000738)  
• IZD-MB-0503 (CVCL_C411)   Hemocyte (CL_0000387)  
• SPC-Mb-92-C6 (CVCL_VT62)  
• Egg Cell  
• Egg Cell   Egg White  
• Egg Cell   Jelly Coat  
• Granulocyte (CL_0000094)  
• Leukocyte (CL_0000738)  
• Neutrophil (CL_0000775)  
• Cerebrospinal Fluid Secretion (GO_0033326)  
• Plasma Membrane (GO_0005886)  

Reported structure

• O-Linked / Undefined core / Gal(?1-4)GlcNAc(?1-6)[Gal(?1-3)]GalNAc
• O-Linked / No-core / Gal(?1-?)GlcNAc(?1-6)[Gal(?1-3)]GalNAc
• O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)]GalNAc
• O-Linked / No-core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-3)GalNAc
• O-Linked / Core 2 / Gal(b1-3)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
• O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-?)]GalNAc
• O-Linked / Undefined core / Gal(b1-?)GlcNAc(?1-?)Gal(?1-?)GalNAc
• O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 1 / GalNAc(b1-3)Gal(b1-4)Gal(b1-3)GalNAc
• O-Linked / Undefined core / Glc(?1-4)GlcNAc(?1-4)Gal(?1-3)GalNAc
• N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:2 HexNAc:2 (avg mass : 748.6901 )

Disease

• Adenocarcinoma (DOID:299)
• Arthritis, Rheumatoid (DOID:7148)
• Bronchiectasis, due to Kartagener's Syndrome
• Cancer, breast (DOID:1612)
• Cancer, Ovarian (DOID:2394)
• Cancer, Ovarian (Cystic) (DOID:2394)
• Carcinoma, Hepatocellular (DOID:684)
• Choriocarcinoma (DOID:3594)
• Choriocarcinoma, with Hyperthyroidism
• Cystic Fibrosis (DOID:1485)
• Diabetes Mellitus (DOID:9351)
• Hydatidiform Mole (DOID:3590)
• Hydatidiform Mole, Invasive (DOID:3590)
• Hyperimmune condition
• Leukemia, Myloid, Chronic (DOID:8552)
• Leukemia, Promyelocytic (DOID:0060318)
• Mannosidosis, alpha (DOID:3413)
• Osteoarthritis (DOID:8398)
• Ovarian cyst (DOID:5119)
• Prostate cancer (DOID:10283)

Reference

• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins (2013 - Halim A, Rüetschi U, Larson G, Nilsson J) / Status : Reviewed
• Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
• Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
• Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
• Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
• Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
• Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
• In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
• Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
• High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
• Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
• The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
• Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
• Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
• Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
• New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
• Biosynthesis of O-N-acetylglucosamine-linked glycans in Trypanosoma cruzi. Characterization of the novel uridine diphospho-N-acetylglucosamine:polypeptide N-acetylglucosaminyltransferase-catalyzing formation of N-acetylglucosamine alpha1-->O-threonine. (1998 - Previato J, Sola-Penna M, Agrellos O, Jones C, Oeltmann T, Travassos L, Mendona-Previato L) / Status : Reviewed
• Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
• Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
• Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
• Isolation and characterization of ovarian cancer antigen CA 125 using a new monoclonal antibody (VK-8): identification as a mucin-type molecule. (1997 - Lloyd K, Yin B, Kudryashov V) / Status : Reviewed
• Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
• Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Structures of the O-glycans on P-selectin glycoprotein ligand-1 from HL-60 cells. (1996 - Wilkins P, McEver R, Cummings R) / Status : Reviewed
• The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
• The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
• O-glycosylation mimics N-glycosylation in the 16-KDa fragment of bovine pro-opiomelanocortin. The major O-glycan attached to Thr-45 carries SO4-4GalNAc beta 1-4GlcNAc beta 1-, which is the archetypal non-reducing epitope in the N-glycans of pituitary glycohormones. (1994 - Siciliano R, Morris H, Bennett H, Dell A) / Status : Reviewed
• Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
• Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
• Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2. (1993 - Carlsson S, Lycksell P, Fukuda M) / Status : Reviewed
• Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
• O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
• Crystal structure of glucoamylase from Aspergillus awamori var. X100 to 2.2-A resolution. (1992 - Aleshin A, Golubev A, Firsov L, Honzatko R) / Status : Reviewed
• Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
• The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
• Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
• Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
• Natural human interferon-alpha 2 is O-glycosylated. (1991 - Adolf G, Kalsner I, Ahorn H, Maurer-Fogy I, Cantell K) / Status : Reviewed
• Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
• Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
• Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
• Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
• Studies on cervical glycoproteins. Isolation and characterization of neutral oligosaccharides from pronase-treated glycoproteins of bonnet monkey (Macaca radiata). (1990 - Nasir-ud-Din , Hussain SA, Jeanloz RW, Walker-Nasir E) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
• Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
• Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
• Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
• Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
• Determination of the structure of sulfated tetra- and pentasaccharides obtained by alkaline borohydride degradation of hen ovomucin. A fast atom bombardment-mass spectrometric and 1H-NMR spectroscopic study. (1987 - Strecker G, Wieruszeski J, Martel C, Montreuil J) / Status : Reviewed
• Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
• Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
• Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
• Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
• Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
• Structures of the carbohydrate units of polysialoglycoproteins isolated from the eggs of four species of salmonid fishes. (1985 - Iwasaki M, Inoue S) / Status : Reviewed
• Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
• Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
• The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
• Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
• Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
• Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
• Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
• Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
• Structural characterization of neutral oligosaccharides of human midcycle cervical mucin. (1982 - Yurewicz E, Matsuura F, Moghissi K) / Status : Reviewed
• Structures of carbohydrate chains of glycoprotein isolated from goat submaxillary mucin. (1982 - Dutta B, Rao C) / Status : Reviewed
• Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
• Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
• Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
• Structure of the asialyl oligosaccharide chains of kappa-casein isolated from ovine colostrum. (1980 - Soulier S, Sarfati R, Szab L) / Status : Reviewed
• Sialoglycoproteins of human mammary cells: partial characterization of sialoglycopeptides. (1979 - Chandrasekaran E, Davidson E) / Status : Reviewed
• Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
• Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
• Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

• Apolipoprotein e / Homo sapiens
  •        Thr-212
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Choriogonadotropin - alpha and beta chains / Homo sapiens
  •        Undefined site
• Choriogonadotropin beta chain / Homo sapiens
  •        Undefined site
• Glycoprotein ln / Homo sapiens
  •        Undefined site
• Glycoprotein rg / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha (secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-275
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
• Interferon alpha-2 / Homo sapiens
  •        Thr-129
• Interleukin-18-binding protein / Homo sapiens
  •        Ser-53
• Kappa casein / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Ser-436
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Undefined site
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Undefined site
• Matrix metalloproteinase-9 / Homo sapiens
  •        Undefined site
• Membrane component, chromosome 17, surface marker 2 / Homo sapiens
  •        Undefined site
• Muc1 fusion protein / Homo sapiens
  •        Undefined site
• Muc1f (delta tr) / Homo sapiens
  •        Undefined site
• Mucin / Homo sapiens
  •        Undefined site
• Mucin-1 / Homo sapiens
  •        Undefined site
• P-selectin glycoprotein ligand (psgl-1) / Homo sapiens
  •        Undefined site
• Progranulin / Homo sapiens
  •        Asn-530
  •        Thr-532
• Prosaposin / Homo sapiens
  •        Undefined site
• Protein yipf3 / Homo sapiens
  •        Thr-346
• Proteoglycan / Homo sapiens
  •        Undefined site
• Proteoglycan 4 (lubricin) / Homo sapiens
  •        Thr-324
  •        Thr-485
  •        Thr-676
  •        Thr-900
  •        Thr-1161
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens
  •        Undefined site
• Recombinant Mucin-1 Muc1f/2tr / Homo sapiens
  •        Undefined site
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
  •        Undefined site
• Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
  •        Undefined site
• Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Granulocyte / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Mammary Gland / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Seminal Fluid / Homo sapiens
  •        Undefined site
• Zona pellucida sperm-binding protein 3 / Homo sapiens
  •        Undefined site
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Thr-71
• Gp-3 / Bos taurus
  •        Undefined site
• Kappa casein / Bos taurus
  •        Undefined site
• Lactophorin / Bos taurus
  •        Thr-104
• Lactotransferrin / Bos taurus
  •        Asn-495
• Mucin / Bos taurus
  •        Undefined site
• Mucin / Capra hircus
  •        Undefined site
• Mucin / Macaca radiata
  •        Undefined site
• Acid ceramidase / Mus musculus
  •        Asn-258
• Adhesion G protein-coupled receptor B2 / Mus musculus
  •        Asn-636
• Adipocyte plasma membrane-associated protein / Mus musculus
  •        Asn-159
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
  •        Asn-124
• Apoptosis inhibitor 5 / Mus musculus
  •        Asn-491
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-95
  •        Asn-121
  •        Asn-241
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-61
• C-Jun-amino-terminal kinase-interacting protein 3 / Mus musculus
  •        Asn-715
• Cadherin-13 / Mus musculus
  •        Asn-598
• Carboxypeptidase E / Mus musculus
  •        Asn-139
• Contactin-1 / Mus musculus
  •        Asn-208
  •        Asn-457
  •        Asn-593
• Contactin-associated protein-like 4 / Mus musculus
  •        Asn-287
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-343
  •        Asn-505
• Epiglycanin / Mus musculus
  •        Undefined site
• Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
  •        Asn-104
• Gamma-glutamyltransferase 7 / Mus musculus
  •        Asn-198
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus
  •        Asn-368
  •        Asn-440
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus
  •        Asn-688
• Immunoglobulin superfamily member 21 / Mus musculus
  •        Asn-407
• Inactive dipeptidyl peptidase 10 / Mus musculus
  •        Asn-258
• Integrin alpha-6 / Mus musculus
  •        Asn-284
• Integrin alpha-V / Mus musculus
  •        Asn-74
• Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
  •        Asn-911
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-968
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
  •        Asn-2502
• Isoform 6 of Receptor-type tyrosine-protein phosphatase S / Mus musculus
  •        Asn-674
• Leucyl-cystinyl aminopeptidase / Mus musculus
  •        Asn-215
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-61
  •        Asn-109
• Low-density lipoprotein receptor-related protein 1B / Mus musculus
  •        Asn-1549
• Lysosomal alpha-glucosidase / Mus musculus
  •        Asn-390
• Muc2 / Mus musculus
  •        Undefined site
• Myelin-associated glycoprotein / Mus musculus
  •        Asn-99
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
  •        Asn-478
  •        Asn-670
• Neural cell adhesion molecule L1-like protein / Mus musculus
  •        Asn-822
• Neurocan core protein / Mus musculus
  •        Asn-121
• Neuroendocrine convertase 2 / Mus musculus
  •        Asn-523
• Neurofascin / Mus musculus
  •        Asn-866
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
  •        Asn-501
• Opioid-binding protein/cell adhesion molecule / Mus musculus
  •        Asn-70
• Phospholipase D3 / Mus musculus
  •        Asn-234
• Plexin-A4 / Mus musculus
  •        Asn-441
• Prenylcysteine oxidase / Mus musculus
  •        Asn-196
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-447
  •        Asn-3840
• Prosaposin / Mus musculus
  •        Asn-459
• Protein FAM171A2 / Mus musculus
  •        Asn-66
• Protein phosphatase 1 regulatory subunit 29 / Mus musculus
  •        Asn-371
• Receptor-type tyrosine-protein phosphatase eta / Mus musculus
  •        Asn-267
• Rho-associated protein kinase 2 / Mus musculus
  •        Asn-791
• Roundabout homolog 2 / Mus musculus
  •        Asn-793
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
  •        Asn-110
  •        Asn-168
  •        Asn-246
  •        Asn-271
• Sodium channel subunit beta-4 / Mus musculus
  •        Asn-71
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-118
  •        Asn-153
  •        Asn-238
• Tetraspanin-3 / Mus musculus
  •        Asn-167
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
  •        Asn-118
• TM2 domain-containing protein 3 / Mus musculus
  •        Asn-183
• Zona pellucida sperm-binding protein 2 / Mus musculus
  •        Undefined site
• Zona pellucida sperm-binding protein 3 / Mus musculus
  •        Undefined site
• Brain non dialyzable glycopeptide / Oryctolagus cuniculus
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Asgp-1 / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Cell Membranes / Rattus norvegicus
  •        Undefined site
• Mucin / Sus scrofa
  •        Undefined site
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Polysialoglycoprotein (psgp) / Oncorhynchus masou ishikawai
  •        Undefined site
• Polysialoglycoprotein (psgp) / Oncorhynchus mykiss
  •        Undefined site
• Polysialoglycoprotein (psgp) / Oncorhynchus nerka adonis
  •        Undefined site
• Mucin / Bufo bufo
  •        Undefined site
• Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana
  •        Asn-57
  •        Asn-83
• Mucin / Rana palustris
  •        Undefined site
• Mucin / Rana utricularia
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucin / Gallus gallus
  •        Undefined site
• Glucoamylase g1 / Aspergillus awamori
  •        Asn-195
• Hemocyanin / Megathura crenulata
  •        Undefined site
• Arylphorin / Antheraea pernyi
  •        Undefined site
• Uncharacterized protein from Hemolymph / Antheraea pernyi
  •        Undefined site
• Hyaluronoglucosaminidase / Apis mellifera
  •        Undefined site
• Phospholipase a2 / Apis mellifera
  •        Asn-46
• Membrane glycoproteins / Bombyx mori
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
  •        Undefined site
• Membrane glycoproteins / Mamestra brassicae
  •        Undefined site
• Membrane glycoproteins / Spodoptera frugiperda
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Trypanosoma cruzi
  •        Undefined site
• Peroxidase c1a / Armoracia rusticana
  •        Undefined site
• Structural glycoprotein / Marburg virus (strain musoke)
  •        Undefined site
• Circulating cathodic antigen / Schistosoma mansoni
  •        Undefined site

Mass spectrometry observed peptide

• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• QGNASDVILR (10aa)
  •    Q9DB72    Asn-61
• WKLNK (5aa)
  •    Q61735    Asn-61
• ASVDVFGNR (9aa)
  •    A2A699    Asn-66
• VAWLNR (6aa)
  •    G5E8G3    Asn-70
• WSYNNSETSR (10aa)
  •    Q7M729    Asn-71
• ANTTQPGIVEGGQVLK (16aa)
  •    P43406    Asn-74
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92
• NLTIVDSGLK (10aa)
  •    P15209    Asn-95
• NCTLLLSTLSPELGGK (16aa)
  •    P20917    Asn-99
• LSYNVIPLNLTLDNR (15aa)
  •    P63137    Asn-104
• DAMVGNYTCEVTELSR (16aa)
  •    Q61735    Asn-109
• ISNVTPADAGIYYCVK (16aa)
  •    P97797    Asn-110
• FLEPYNDSIQAQK (13aa)
  •    P14231    Asn-118
• DEGDYFCELQVSGANPMSSNK (21aa)
  •    P01831    Asn-118
• ANATLLLGPLR (11aa)
  •    P55066    Asn-121
• HINFTR (6aa)
  •    P15209    Asn-121
• HRANATLLLGPLR (13aa)
  •    P55066    Asn-121
• LVTQTIPCNK (10aa)
  •    P56528    Asn-124
• GNETIVNLIHSTR (13aa)
  •    Q00493    Asn-139
• RACQFNR (7aa)
  •    P14231    Asn-153
• ACQFNR (6aa)
  •    P14231    Asn-153
• AGPNGTLFVVDAYK (14aa)
  •    Q9D7N9    Asn-159
• NQSVPLSCCR (10aa)
  •    Q9QY33    Asn-167
• VNFTCK (6aa)
  •    P97797    Asn-168
• DHIHCLGNR (9aa)
  •    Q8BJ83    Asn-183
• LLNQTLRENLKK (12aa)
  •    Q9CQF9    Asn-196
• RNESHLIDFR (10aa)
  •    Q99JP7    Asn-198
• GNYSCFVSSPSITK (14aa)
  •    P12960    Asn-208
• DIILHSTGHNISR (13aa)
  •    Q8C129    Asn-215
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217
• ELGVVMYNCSCLAR (14aa)
  •    O35405    Asn-234
• KFHVNYTQPLVAVK (14aa)
  •    P14231    Asn-238
• HMNETSHTQGSLR (13aa)
  •    P15209    Asn-241
• GIANLSNFIR (10aa)
  •    P97797    Asn-246
• LAFLMINDSLVPNMIIPR (18aa)
  •    Q6NXK7    Asn-258
• SVLENTTSYEEAK (13aa)
  •    Q9WV54    Asn-258
• TNSTQVSDVR (10aa)
  •    Q64455    Asn-267
• VTQQSPTSMNQVNLTCR (17aa)
  •    P97797    Asn-271
• ANHSGAVVLLKR (12aa)
  •    Q61739    Asn-284
• QVNFTVDEHRR (11aa)
  •    Q99P47    Asn-287
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• AQNVSILTLCDATTGVCTK (19aa)
  •    Q9Z218    Asn-343
• KLVQVGIYNGTHVIPNDRK (19aa)
  •    P35438    Asn-368
• RFNHTCLTFTTR (12aa)
  •    Q68FM6    Asn-371
• QVVENMTR (8aa)
  •    P70699    Asn-390
• VPAELNGSMYR (11aa)
  •    Q7TNR6    Asn-407
• CGLVPVLAENYKSQQSSDPDPNCVDR (26aa)
  •    P02788    Ser-436
• VICTGPNDTSPGSPR (15aa)
  •    P35438    Asn-440
• NHSLAFVGTK (10aa)
  •    Q80UG2    Asn-441
• FNSTEYQVVTR (11aa)
  •    Q91ZX7    Asn-447
• GTEWLVNSSR (10aa)
  •    P12960    Asn-457
• LVLYLEHNLEKNSTKEEILAALEK (24aa)
  •    Q61207    Asn-459
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478
• YSSNLSNFNYER (12aa)
  •    O35841    Asn-491
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505
• RGDLNINMTSPMGTK (15aa)
  •    P21661    Asn-523
• DVECGEGHFCHDNQTCCR (18aa)
  •    P28799    Thr-532
• DVECGEGHFCHDNQTCCR (18aa)
  •    P28799    Asn-530
• YTCTAQTIVDNSSASADLVVR (21aa)
  •    P12960    Asn-593
• NLSVVILGASDKDLHPNTDPFK (22aa)
  •    Q9WTR5    Asn-598
• NVTDTFKR (8aa)
  •    Q8CGM1    Asn-636
• VPGNQTSTTLK (11aa)
  •    P11627    Asn-670
• KVEAEALNATAIR (13aa)
  •    B0V2N1-6    Asn-674
• FGTVPNGSTER (11aa)
  •    Q01097    Asn-688
• LWCAAGVNLSGWK (13aa)
  •    Q9ESN9    Asn-715
• NLTLK (5aa)
  •    P70336    Asn-791
• FHINK (5aa)
  •    Q7TPD3    Asn-793
• VDVMNSTLVK (10aa)
  •    P70232    Asn-822
• YVPFNGTK (8aa)
  •    Q810U3    Asn-866
• LLTTNK (6aa)
  •    Q80TS3-2    Asn-911
• QSCITEQTQYFFKNDTK (17aa)
  •    O08532-4    Asn-968
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366
• GPCSHLCLINHNR (13aa)
  •    Q9JI18    Asn-1549
• VETGENCTSPAPK (13aa)
  •    P11881-3    Asn-2502
• FGTCSQLCNNTK (12aa)
  •    Q91ZX7    Asn-3840