taxonomy (31)
protein (140)
source (78)
structure (26)
composition (1)
disease (28)
reference (102)
site (171)
peptide (95)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Capra hircus (Goat)
- Felis catus (Cat)
- Macaca radiata (Bonnet macaque)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Oncorhynchus masou ishikawai (Ishikawa's cherry salmon)
- Oncorhynchus mykiss (Rainbow trout)
- Oncorhynchus nerka adonis
- Bufo bufo (European toad)
- Rana catesbeiana (Bullfrog)
- Rana palustris
- Rana utricularia
- Gallus gallus (Chicken)
- Aspergillus awamori
- Megathura crenulata (Californian giant keyhole limpet)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Trypanosoma cruzi
- Armoracia rusticana (Horseradish)
- Marburg virus (strain musoke)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
Taxonomy
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein E / Homo sapiens P02649
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD59 glycoprotein / Homo sapiens P13987
- Choriogonadotropin - alpha and beta chains / Homo sapiens P0DN86 P01215
- Choriogonadotropin beta chain / Homo sapiens P0DN86
- Coagulation factor V / Homo sapiens P12259
- Glycoprotein ln / Homo sapiens
- Glycoprotein rg / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Interferon alpha-2 / Homo sapiens P01563
- Interleukin-18-binding protein / Homo sapiens O95998
- Kappa casein / Homo sapiens P07498
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Membrane component, chromosome 17, surface marker 2 / Homo sapiens Q14596
- Muc1 fusion protein / Homo sapiens
- Muc1f (delta tr) / Homo sapiens P15941
- Mucin-1 / Homo sapiens P15941
- P-selectin glycoprotein ligand (psgl-1) / Homo sapiens Q14242
- Progranulin / Homo sapiens P28799
- Prosaposin / Homo sapiens P07602
- Protein YIPF3 / Homo sapiens Q9GZM5
- Proteoglycan / Homo sapiens
- Proteoglycan 4 (lubricin) / Homo sapiens Q92954
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens P15941
- Recombinant Mucin-1 Muc1f/2tr / Homo sapiens P15941 Q02817
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Recombinant Mucin-1 Muc1f/5actr / Homo sapiens P15941 P98088
- Recombinant Mucin-1 Muc1f/5btr / Homo sapiens P15941 Q9HC84
- Uncharacterized protein / Homo sapiens
- Uncharacterized protein from Mammary Gland / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Uncharacterized protein from Ovary / Homo sapiens
- Uncharacterized protein from Seminal Fluid / Homo sapiens
- Unspecified mucin / Homo sapiens
- Zona pellucida sperm-binding protein 3 / Homo sapiens P21754
- Corticotropin - lipotropin, npp peptide / Bos taurus P01190
- Gp-3 / Bos taurus
- Kappa casein / Bos taurus P02668
- Lactophorin / Bos taurus P80195
- Lactotransferrin / Bos taurus P24627
- Mucin / Bos taurus
- Mucin / Capra hircus
- Mucin / Macaca radiata
- Acid ceramidase / Mus musculus Q9WV54
- Adhesion G protein-coupled receptor B2 / Mus musculus Q8CGM1
- Adipocyte plasma membrane-associated protein / Mus musculus Q9D7N9
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus P56528
- Apoptosis inhibitor 5 / Mus musculus O35841
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- C-Jun-amino-terminal kinase-interacting protein 3 / Mus musculus Q9ESN9
- Cadherin-13 / Mus musculus Q9WTR5
- Carboxypeptidase E / Mus musculus Q00493
- Contactin-1 / Mus musculus P12960
- Contactin-associated protein-like 4 / Mus musculus Q99P47
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Epiglycanin / Mus musculus D9N008
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus P63137
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Immunoglobulin superfamily member 21 / Mus musculus Q7TNR6
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Integrin alpha-6 / Mus musculus Q61739
- Integrin alpha-V / Mus musculus P43406
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 6 of Receptor-type tyrosine-protein phosphatase S / Mus musculus B0V2N1-6
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Muc2 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus P20917
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurocan core protein / Mus musculus P55066
- Neuroendocrine convertase 2 / Mus musculus P21661
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- Phospholipase D3 / Mus musculus O35405
- Plexin-A4 / Mus musculus Q80UG2
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Protein FAM171A2 / Mus musculus A2A699
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus Q68FM6
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus Q64455
- Rho-associated protein kinase 2 / Mus musculus P70336
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-4 / Mus musculus Q7M729
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Tetraspanin-3 / Mus musculus Q9QY33
- Thy-1 membrane glycoprotein / Mus musculus P01831
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Zona pellucida sperm-binding protein 2 / Mus musculus P20239
- Zona pellucida sperm-binding protein 3 / Mus musculus P10761
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Asgp-1 / Rattus norvegicus
- Uncharacterized protein from Liver / Rattus norvegicus
- Mucin / Sus scrofa
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Polysialoglycoprotein (psgp) / Oncorhynchus masou ishikawai
- Polysialoglycoprotein (psgp) / Oncorhynchus mykiss
- Polysialoglycoprotein (psgp) / Oncorhynchus nerka adonis
- Mucin / Bufo bufo
- Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana P80051
- Mucin / Rana palustris
- Mucin / Rana utricularia
- Ovalbumin / Gallus gallus P01012
- Ovomucin / Gallus gallus
- Glucoamylase / Aspergillus awamori P69327
- Hemocyanin / Megathura crenulata Q10583 Q10584
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Uncharacterized protein / Trypanosoma cruzi
- Peroxidase c1a / Armoracia rusticana P00433
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Circulating cathodic antigen / Schistosoma mansoni O02197
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebrospinal Fluid (UBERON_0001359)
- Cervical Mucosa (UBERON_0012248)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Colostrum (UBERON_0001914)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107) AH66-TC (CVCL_4368) Plasma Membrane (GO_0005886)
- Liver (UBERON_0002107)
- Liver (UBERON_0002107) Cytoplasm (GO_0005737)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) TA3/Ha (CVCL_4321)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Mucosa of Large Intestine (UBERON_0001207)
- Mucosa of Small Intestine (UBERON_0001204)
- Neurohypophysis (UBERON_0002198)
- Ovary (UBERON_0000992) OVCAR-3 (CVCL_0465)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992)
- Pituitary Gland (UBERON_0000007)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C10 (CVCL_5245)
- CHO (CVCL_0213)
- Caco-2 (CVCL_0025)
- DLD-1 (CVCL_0248)
- HCT 116 (CVCL_0291)
- HCT 15 (CVCL_0292)
- HEK293 (CVCL_0045)
- HL-60 (CVCL_0002) Leukocyte (CL_0000738)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- KM12 (CVCL_1331)
- LOVO (CVCL_0399)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- SPC-Mb-92-C6 (CVCL_VT62)
- SW1398 (CVCL_3885)
- SW48 (CVCL_1724)
- SW480 (CVCL_0546)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Egg Cell Jelly Coat
- Granulocyte (CL_0000094)
- Leukocyte (CL_0000738)
- Neutrophil (CL_0000775)
- Plasma Membrane (GO_0005886)
Source
- N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9748
- N-Linked / Pauci-Mannose / Structure 10598
- N-Linked / Undefined core / Structure 9611
- N-Linked / Undefined core / Structure 9657
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / GalNAc(b1-3)Gal(b1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11400
- O-Linked / Core 1 / Structure 11414
- O-Linked / Core 2 / Gal(b1-3)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9913
- O-Linked / Core 2 / Structure 10074
- O-Linked / No-core / Gal(?1-?)GlcNAc(?1-6)[Gal(?1-3)]GalNAc
- O-Linked / No-core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Gal(?1-4)GlcNAc(?1-6)[Gal(?1-3)]GalNAc
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)]GalNAc
- O-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-?)]GalNAc
- O-Linked / Undefined core / Gal(b1-?)GlcNAc(?1-?)Gal(?1-?)GalNAc
- O-Linked / Undefined core / Glc(?1-4)GlcNAc(?1-4)Gal(?1-3)GalNAc
Reported structure
- Hex:2 HexNAc:2 (avg mass : 748.6901 )
Composition
- Adenocarcinoma (DOID:299)
- Arthritis, Rheumatoid (DOID:7148)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (DOID:2394)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Carcinoma, Hepatocellular (DOID:684)
- Cecum adenocarcinoma (DOID:3039)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Diabetes Mellitus (DOID:9351)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Hyperimmune condition
- Leukemia, Myloid, Chronic (DOID:8552)
- Leukemia, Promyelocytic (DOID:0060318)
- Mannosidosis, alpha (DOID:3413)
- Mixed phenotype acute leukemia (DOID:9953)
- Osteoarthritis (DOID:8398)
- Ovarian cyst (DOID:5119)
- Parkinson's disease (DOID:14330)
- Prostate cancer (DOID:10283)
Disease
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins (2013 - Halim A, Rüetschi U, Larson G, Nilsson J) / Status : Reviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- The diversity of O-linked glycans expressed during Drosophila melanogaster development reflects stage- and tissue-specific requirements for cell signaling. (2008 - Kazuhiro Aoki, Mindy Porterfield, Samuel S Lee, Brian Dong, Khoi Nguyen, Katherine H McGlamry, Michael Tiemeyer) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Intestinal mucins from cystic fibrosis mice show increased fucosylation due to an induced Fucalpha1-2 glycosyltransferase. (2002 - Thomsson KA, Hinojosa-Kurtzberg M, Axelsson KA, Domino SE, Lowe JB, Gendler SJ, Hansson GC) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Biosynthesis of O-N-acetylglucosamine-linked glycans in Trypanosoma cruzi. Characterization of the novel uridine diphospho-N-acetylglucosamine:polypeptide N-acetylglucosaminyltransferase-catalyzing formation of N-acetylglucosamine alpha1-->O-threonine. (1998 - Previato J, Sola-Penna M, Agrellos O, Jones C, Oeltmann T, Travassos L, Mendona-Previato L) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structural analysis of the oligosaccharide-alditols released by reductive beta-elimination from the jelly coat of Rana utricularia eggs. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Isolation and characterization of ovarian cancer antigen CA 125 using a new monoclonal antibody (VK-8): identification as a mucin-type molecule. (1997 - Lloyd K, Yin B, Kudryashov V) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Structures of the O-glycans on P-selectin glycoprotein ligand-1 from HL-60 cells. (1996 - Wilkins P, McEver R, Cummings R) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- O-glycosylation mimics N-glycosylation in the 16-KDa fragment of bovine pro-opiomelanocortin. The major O-glycan attached to Thr-45 carries SO4-4GalNAc beta 1-4GlcNAc beta 1-, which is the archetypal non-reducing epitope in the N-glycans of pituitary glycohormones. (1994 - Siciliano R, Morris H, Bennett H, Dell A) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2. (1993 - Carlsson S, Lycksell P, Fukuda M) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Crystal structure of glucoamylase from Aspergillus awamori var. X100 to 2.2-A resolution. (1992 - Aleshin A, Golubev A, Firsov L, Honzatko R) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Natural human interferon-alpha 2 is O-glycosylated. (1991 - Adolf G, Kalsner I, Ahorn H, Maurer-Fogy I, Cantell K) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Studies on cervical glycoproteins. Isolation and characterization of neutral oligosaccharides from pronase-treated glycoproteins of bonnet monkey (Macaca radiata). (1990 - Nasir-ud-Din , Hussain SA, Jeanloz RW, Walker-Nasir E) / Status : Reviewed
- Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
- Determination of the structure of sulfated tetra- and pentasaccharides obtained by alkaline borohydride degradation of hen ovomucin. A fast atom bombardment-mass spectrometric and 1H-NMR spectroscopic study. (1987 - Strecker G, Wieruszeski J, Martel C, Montreuil J) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structures of O-linked oligosaccharides present in the proteoglycans secreted by human mammary epithelial cells. (1986 - Gowda D, Bhavanandan V, Davidson E) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Structures of the carbohydrate units of polysialoglycoproteins isolated from the eggs of four species of salmonid fishes. (1985 - Iwasaki M, Inoue S) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Structure of O-glycosidically linked sugar units from plasma membranes of an ascites hepatoma, AH 66. (1982 - Funakoshi I, Yamashina I) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human midcycle cervical mucin. (1982 - Yurewicz E, Matsuura F, Moghissi K) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Structures of carbohydrate chains of glycoprotein isolated from goat submaxillary mucin. (1982 - Dutta B, Rao C) / Status : Reviewed
- Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
- Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Structure of the asialyl oligosaccharide chains of kappa-casein isolated from ovine colostrum. (1980 - Soulier S, Sarfati R, Szab L) / Status : Reviewed
- Sialoglycoproteins of human mammary cells: partial characterization of sialoglycopeptides. (1979 - Chandrasekaran E, Davidson E) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein E / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- CD59 glycoprotein / Homo sapiens
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
- Coagulation factor V / Homo sapiens
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Interferon alpha-2 / Homo sapiens
- Interleukin-18-binding protein / Homo sapiens
-
Kappa casein / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Membrane component, chromosome 17, surface marker 2 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
-
P-selectin glycoprotein ligand (psgl-1) / Homo sapiens
- Undefined site
- Progranulin / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Protein YIPF3 / Homo sapiens
-
Proteoglycan / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/2tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Mammary Gland / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
- Lactophorin / Bos taurus
- Lactotransferrin / Bos taurus
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Capra hircus
- Undefined site
-
Mucin / Macaca radiata
- Undefined site
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Apoptosis inhibitor 5 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- C-Jun-amino-terminal kinase-interacting protein 3 / Mus musculus
- Cadherin-13 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
-
Epiglycanin / Mus musculus
- Undefined site
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 6 of Receptor-type tyrosine-protein phosphatase S / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
-
Muc2 / Mus musculus
- Undefined site
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neuroendocrine convertase 2 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A4 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein FAM171A2 / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
-
Zona pellucida sperm-binding protein 2 / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Polysialoglycoprotein (psgp) / Oncorhynchus masou ishikawai
- Undefined site
-
Polysialoglycoprotein (psgp) / Oncorhynchus mykiss
- Undefined site
-
Polysialoglycoprotein (psgp) / Oncorhynchus nerka adonis
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
- Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana
-
Mucin / Rana palustris
- Undefined site
-
Mucin / Rana utricularia
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucin / Gallus gallus
- Undefined site
- Glucoamylase / Aspergillus awamori
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Uncharacterized protein / Trypanosoma cruzi
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
Reported glycosite
- HENNTKDNSIQHEFSLTR (18aa)
- TAVNCSSDFDACLITK (16aa)
- QGNASDVILR (10aa)
- WKLNK (5aa)
- ASVDVFGNR (9aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RNESTQNCVVAEPEKM (16aa)
- VAWLNR (6aa)
- WSYNNSETSR (10aa)
- ANTTQPGIVEGGQVLK (16aa)
- HAIHVSGTNGTK (12aa)
- IRNVSDTTKR (10aa)
- NLTIVDSGLK (10aa)
- NCTLLLSTLSPELGGK (16aa)
- LSYNVIPLNLTLDNR (15aa)
- DAMVGNYTCEVTELSR (16aa)
- ISNVTPADAGIYYCVK (16aa)
- FLEPYNDSIQAQK (13aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- ANATLLLGPLR (11aa)
- HINFTR (6aa)
- HRANATLLLGPLR (13aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- LVTQTIPCNK (10aa)
- GNETIVNLIHSTR (13aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- AGPNGTLFVVDAYK (14aa)
- NQSVPLSCCR (10aa)
- VNFTCK (6aa)
- DHIHCLGNR (9aa)
- LLNQTLRENLKK (12aa)
- RNESHLIDFR (10aa)
- GNYSCFVSSPSITK (14aa)
- DIILHSTGHNISR (13aa)
- FNHTQTIQQK (10aa)
- ELGVVMYNCSCLAR (14aa)
- KFHVNYTQPLVAVK (14aa)
- HMNETSHTQGSLR (13aa)
- GIANLSNFIR (10aa)
- LAFLMINDSLVPNMIIPR (18aa)
- SVLENTTSYEEAK (13aa)
- TNSTQVSDVR (10aa)
- VTQQSPTSMNQVNLTCR (17aa)
- ANHSGAVVLLKR (12aa)
- QVNFTVDEHRR (11aa)
- VIYQNHNK (8aa)
- GEVFNATR (8aa)
- AQNVSILTLCDATTGVCTK (19aa)
- CPFGEVFNATR (11aa)
- KLVQVGIYNGTHVIPNDRK (19aa)
- RFNHTCLTFTTR (12aa)
- QVVENMTR (8aa)
- VPAELNGSMYR (11aa)
- CGLVPVLAENYKSQQSSDPDPNCVDR (26aa)
- VICTGPNDTSPGSPR (15aa)
- NHSLAFVGTK (10aa)
- FNSTEYQVVTR (11aa)
- GTEWLVNSSR (10aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- FFPYANGTLSIR (12aa)
- YSSNLSNFNYER (12aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- CEGPGVPTVTVHNTTDK (17aa)
- RGDLNINMTSPMGTK (15aa)
- DVECGEGHFCHDNQTCCR (18aa)
- YTCTAQTIVDNSSASADLVVR (21aa)
- NLSVVILGASDKDLHPNTDPFK (22aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- NVTDTFKR (8aa)
- VPGNQTSTTLK (11aa)
- KVEAEALNATAIR (13aa)
- FGTVPNGSTER (11aa)
- LWCAAGVNLSGWK (13aa)
- NLTLK (5aa)
- FHINK (5aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- NFSQILPDPSK (11aa)
- VDVMNSTLVK (10aa)
- YVPFNGTK (8aa)
- LLTTNK (6aa)
- QSCITEQTQYFFKNDTK (17aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- VSNGTHWF (8aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
- GPCSHLCLINHNR (13aa)
- VETGENCTSPAPK (13aa)
- FGTCSQLCNNTK (12aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core
(avg mass : 748.6901)
- Mannosidosis, alpha (DOID:3413)
- Crystal structure of glucoamylase from Aspergillus awamori var. X100 to 2.2-A resolution. (1992 - Aleshin A, Golubev A, Firsov L, Honzatko R) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Glucoamylase / Aspergillus awamori
-
- N-Linked / No-core
(avg mass : 748.6901)
- Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Liver (UBERON_0002107) Cytoplasm (GO_0005737)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- SPC-Mb-92-C6 (CVCL_VT62)
- Egg Cell Egg White
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- Biosynthesis of O-N-acetylglucosamine-linked glycans in Trypanosoma cruzi. Characterization of the novel uridine diphospho-N-acetylglucosamine:polypeptide N-acetylglucosaminyltransferase-catalyzing formation of N-acetylglucosamine alpha1-->O-threonine. (1998 - Previato J, Sola-Penna M, Agrellos O, Jones C, Oeltmann T, Travassos L, Mendona-Previato L) / Status : Reviewed
- New N-glycans in horseradish peroxidase. (1998 - Takahashi N, Lee K, Nakagawa H, Tsukamoto Y, Masuda K, Lee Y) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Alpha-S1-casein / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Lactotransferrin / Bos taurus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Uncharacterized protein / Trypanosoma cruzi
- Undefined site
-
Peroxidase c1a / Armoracia rusticana
- Undefined site
- RNESTQNCVVAEPEKM (16aa)
- KDTRNESTQNCVVAEPEKM (19aa)
-
- N-Linked / No-core
(avg mass : 748.6901)
- Blood Serum (UBERON_0001977)
- Pituitary Gland (UBERON_0000007)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Hyperimmune condition
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Simple N-linked sugar chains are bound to the lutropin of the bullfrog rana catesbeiana. (1993 - Hayashi T, Hanakoka Y, Hayashi H) / Status : Reviewed
- Immunoglobulin epsilon chain c region / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Glycoprotein hormones alpha chain - lutropin / Rana catesbeiana
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 748.6901)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- DFGGFNFSQILPDPSKPSK (19aa)
- GVFVSNGTHWFVTQR (15aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 748.6901)
- Bone Marrow (UBERON_0002371)
-
- N-Linked / Undefined core
(avg mass : 748.6901)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
-
- N-Linked / Undefined core
(avg mass : 748.6901)
- Embryo (UBERON_0000922)
-
- O-Linked / Core 1
(avg mass : 748.6901)
- Egg Cell Jelly Coat
-
Mucin / Rana palustris
- Undefined site
-
- O-Linked / Core 1
(avg mass : 748.6901)
- Cancer, Ovarian (Cystic) (DOID:2394)
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 748.6901)
- Blood Serum (UBERON_0001977)
- Meconium (UBERON_0007109)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Zona Pellucida (UBERON_0000086)
- LS174T (CVCL_1384)
- Granulocyte (CL_0000094)
- Leukocyte (CL_0000738)
- Bronchiectasis, due to Kartagener's Syndrome
- Colon adenocarcinoma (DOID:234)
- Cystic Fibrosis (DOID:1485)
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- The glycosylation and structure of human serum IgA1, Fab, and Fc regions and the role of N-glycosylation on Fc alpha receptor interactions. (1998 - Mattu T, Pleass R, Willis A, Kilian M, Wormald M, Lellouch A, Rudd P, Woof J, Dwek R) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Quantitation and structures of oligosaccharide chains in human trachea mucin glycoproteins. (1992 - Sangadala S, Bhat U, Mendicino J) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Structures of O-linked oligosaccharides isolated from normal granulocytes, chronic myelogenous leukemia cells, and acute myelogenous leukemia cells. (1986 - Fukuda M, Carlsson S, Klock J, Dell A) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Uncharacterized protein / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
-
- O-Linked / Core 1
(avg mass : 748.6901)
- Egg Cell
-
Polysialoglycoprotein (psgp) / Oncorhynchus masou ishikawai
- Undefined site
-
Polysialoglycoprotein (psgp) / Oncorhynchus mykiss
- Undefined site
-
Polysialoglycoprotein (psgp) / Oncorhynchus nerka adonis
- Undefined site
-
- O-Linked / Core 1
(avg mass : 748.6901)
- Striatum (UBERON_0002345)
- Control/Healthy
-
- O-Linked / Core 1
(avg mass : 748.6901)
- Striatum (UBERON_0002345)
- Control/Healthy
-
- O-Linked / Core 2
(avg mass : 748.6901)
- Egg Cell Jelly Coat
-
Mucin / Rana utricularia
- Undefined site
-
- O-Linked / Core 2
(avg mass : 748.6901)
- Carcinoma, Hepatocellular (DOID:684)
-
Uncharacterized protein from Liver / Rattus norvegicus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 748.6901)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cervical Mucosa (UBERON_0012248)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Neurohypophysis (UBERON_0002198)
- Ovary (UBERON_0000992) OVCAR-3 (CVCL_0465)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Seminal Fluid (UBERON_0006530)
- Striatum (UBERON_0002345)
- Submandibular Gland (UBERON_0001736)
- Substantia Nigra (UBERON_0002038)
- Synovial Fluid (UBERON_0001090)
- Thyroid (UBERON_0002046)
- Tracheal Mucosa (UBERON_0000379)
- Urine (UBERON_0001088)
- Uterine Cervix (UBERON_0000002) HEp-2 (CVCL_1906)
- Zona Pellucida (UBERON_0000086)
- C10 (CVCL_5245)
- Caco-2 (CVCL_0025)
- DLD-1 (CVCL_0248)
- HCT 116 (CVCL_0291)
- HCT 15 (CVCL_0292)
- HEK293 (CVCL_0045)
- HL-60 (CVCL_0002) Leukocyte (CL_0000738)
- KM12 (CVCL_1331)
- LOVO (CVCL_0399)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- SW1398 (CVCL_3885)
- SW48 (CVCL_1724)
- SW480 (CVCL_0546)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Jelly Coat
- Leukocyte (CL_0000738)
- Neutrophil (CL_0000775)
- Plasma Membrane (GO_0005886)
- Adenocarcinoma (DOID:299)
- Arthritis, Rheumatoid (DOID:7148)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (DOID:2394)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cecum adenocarcinoma (DOID:3039)
- Choriocarcinoma (DOID:3594)
- Choriocarcinoma, with Hyperthyroidism
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Diabetes Mellitus (DOID:9351)
- Hydatidiform Mole (DOID:3590)
- Hydatidiform Mole, Invasive (DOID:3590)
- Leukemia, Myloid, Chronic (DOID:8552)
- Leukemia, Promyelocytic (DOID:0060318)
- Mixed phenotype acute leukemia (DOID:9953)
- Osteoarthritis (DOID:8398)
- Ovarian cyst (DOID:5119)
- Parkinson's disease (DOID:14330)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- The O-Glycome of Human Nigrostriatal Tissue and Its Alteration in Parkinson's Disease. (2021 - Wilkinson H, Thomsson KA, Rebelo AL, Hilliard M, Pandit A, Rudd PM, Karlsson NG, Saldova R.) / Status : Unreviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Purification and characterization of the MUC1 mucin-type glycoprotein, epitectin, from human urine: structures of the major oligosaccharide alditols. (1998 - Bhavanandan V, Zhu Q, Yamakami K, Dilulio N, Nair S, Capon C, Lemoine J, Fournet B) / Status : Reviewed
- Structure of the O-glycopeptides isolated from bovine milk component PP3. (1998 - Coddeville B, Girardet J, Plancke Y, Campagna S, Linden G, Spik G) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Structural analysis of oligosaccharide-alditols released by reductive beta-elimination from oviducal mucins of Bufo bufo: characterization of the carbohydrate sequence Gal(alpha1-3)GalNAc(alpha1-3)[Fuc(alpha1-2)]Gal. (1997 - Morelle W, Strecker G) / Status : Reviewed
- Carbohydrate and peptide structure of the alpha- and beta-subunits of human chorionic gonadotropin from normal and aberrant pregnancy and choriocarcinoma. (1997 - Elliott M, Kardana A, Lustbader J, Cole L) / Status : Reviewed
- Isolation and characterization of ovarian cancer antigen CA 125 using a new monoclonal antibody (VK-8): identification as a mucin-type molecule. (1997 - Lloyd K, Yin B, Kudryashov V) / Status : Reviewed
- Structure of the O-linked oligosaccharides from a major thyroid cell surface glycoprotein. (1997 - Edge A, Spiro R) / Status : Reviewed
- Structures of the O-glycans on P-selectin glycoprotein ligand-1 from HL-60 cells. (1996 - Wilkins P, McEver R, Cummings R) / Status : Reviewed
- O-glycosylation mimics N-glycosylation in the 16-KDa fragment of bovine pro-opiomelanocortin. The major O-glycan attached to Thr-45 carries SO4-4GalNAc beta 1-4GlcNAc beta 1-, which is the archetypal non-reducing epitope in the N-glycans of pituitary glycohormones. (1994 - Siciliano R, Morris H, Bennett H, Dell A) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- Assignment of O-glycan attachment sites to the hinge-like regions of human lysosomal membrane glycoproteins lamp-1 and lamp-2. (1993 - Carlsson S, Lycksell P, Fukuda M) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Altered glycosylation of human chorionic gonadotropin decreases its hormonal activity as determined by cyclic-adenosine 3',5'-monophosphate production in MA-10 cells. (1990 - Amano J, Nishimura R, Sato S, Kobata A) / Status : Reviewed
- Structures of O-glycosidically linked oligosaccharides isolated from human meconium glycoproteins. (1989 - Capon C, Leroy Y, Wieruszeski J, Ricart G, Strecker G, Montreuil J, Fournet B) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Chemical structure of neutral sugar chains isolated from human mature milk kappa-casein. (1988 - Saito T, Itoh T, Adachi S) / Status : Reviewed
- Comparative study of the mucin-type sugar chains of human chorionic gonadotropin present in the urine of patients with trophoblastic diseases and healthy pregnant women. (1988 - Amano J, Nishimura R, Mochizuki M, Kobata A) / Status : Reviewed
- Structure of sialyl-oligosaccharides isolated from bronchial mucus glycoproteins of patients (blood group O) suffering from cystic fibrosis. (1987 - Breg J, Van Halbeek H, Vliegenthart J, Lamblin G, Houvenaghel M, Roussel P) / Status : Reviewed
- Determination of the structure of sulfated tetra- and pentasaccharides obtained by alkaline borohydride degradation of hen ovomucin. A fast atom bombardment-mass spectrometric and 1H-NMR spectroscopic study. (1987 - Strecker G, Wieruszeski J, Martel C, Montreuil J) / Status : Reviewed
- Structure of neutral oligosaccharides derived from mucus glycoproteins of human seminal plasma. (1986 - Hanisch F-G, Egge H, Peter-Katalinic J, Uhlenbruck G) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- Primary structures and Lewis blood-group-dependent expression of major sialylated saccharides from mucus glycoproteins of human seminal plasma. (1985 - Hanisch F, Egge H, Peter-Katalini J, Uhlenbruck G, Dienst C, Fangmann R) / Status : Reviewed
- Structures of the O-linked oligosaccharides of the major cell surface sialoglycoprotein of MAT-B1 and MAT-C1 ascites sublines of the 13762 rat mammary adenocarcinoma. (1984 - Hull S, Laine R, Kaizu T, Rodriguez I, Carraway K) / Status : Reviewed
- Purification and structures of oligosaccharide chains in swine trachea and Cowper's gland mucin glycoproteins. (1984 - Rana SS, Chandrasekaran EV, Kennedy J, Mendicino J) / Status : Reviewed
- Structures of oligosaccharides cleaved by base-borohydride from an I, H and Lea active ovarian cyst glycoprotein. (1984 - Tanaka M, Dube V, Anderson B) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
- Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides of human midcycle cervical mucin. (1982 - Yurewicz E, Matsuura F, Moghissi K) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Heterogeneity of the glycans O-glycosidically linked to the hinge region of secretory immunoglobulins from human milk. (1981 - Pierce-Cretel A, Pamblanco M, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- The chemical structure of neutral and acidic sugar chains obtained from bovine colostrum kappa-casein. (1981 - Saito T, Itoh T, Adachi S, Suzuki T, Usui T) / Status : Reviewed
- Structure of the asialyl oligosaccharide chains of kappa-casein isolated from ovine colostrum. (1980 - Soulier S, Sarfati R, Szab L) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Choriogonadotropin - alpha and beta chains / Homo sapiens
- Undefined site
-
Choriogonadotropin beta chain / Homo sapiens
- Undefined site
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Kappa casein / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Undefined site
-
Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Undefined site
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Membrane component, chromosome 17, surface marker 2 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Mucin-1 / Homo sapiens
- Undefined site
-
P-selectin glycoprotein ligand (psgl-1) / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f (delta tr) / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/2tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5actr / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/5btr / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Uncharacterized protein from Seminal Fluid / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Gp-3 / Bos taurus
- Undefined site
-
Kappa casein / Bos taurus
- Undefined site
- Lactophorin / Bos taurus
-
Mucin / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Asgp-1 / Rattus norvegicus
- Undefined site
-
Mucin / Sus scrofa
- Undefined site
-
Mucin / Bufo bufo
- Undefined site
-
Ovomucin / Gallus gallus
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
-
- O-Linked / Core 2
(avg mass : 748.6901)
- Mammary Gland (UBERON_0001911) HBL-100 (CVCL_4362)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
-
Proteoglycan / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 748.6901)
- Embryo (UBERON_0000922)
-
- O-Linked / Core 2
(avg mass : 748.6901)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Coagulation factor V / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
- O-Linked / No-core
(avg mass : 748.6901)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / No-core
(avg mass : 748.6901)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 748.6901)
- Cystic Fibrosis (DOID:1485)
-
Muc2 / Mus musculus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 748.6901)
- Leukocyte (CL_0000738)
- Interferon alpha-2 / Homo sapiens
-
- O-Linked / Undefined core
(avg mass : 748.6901)
- Cervical Mucosa (UBERON_0012248)
-
Mucin / Macaca radiata
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 748.6901)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) MDA-MB-231 (CVCL_0062)
- Mammary Gland (UBERON_0001911) TA3/Ha (CVCL_4321)
- Adenocarcinoma (DOID:299)
- Sialoglycoproteins of human mammary cells: partial characterization of sialoglycopeptides. (1979 - Chandrasekaran E, Davidson E) / Status : Reviewed
- Immunochemical and chemical investigations of the structure of glycoprotein fragments obtained from epiglycanin, a glycoprotein at the surface of the TA3-Ha cancer cell. (1975 - Codington J, Linsley K, Jeanlot R) / Status : Reviewed
-
Uncharacterized protein from Mammary Gland / Homo sapiens
- Undefined site
-
Epiglycanin / Mus musculus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 748.6901)
-
Mucin / Capra hircus
- Undefined site
-
- Hex:2 HexNAc:2 / N-Linked
(avg mass : 748.6901)
- N-Linked / No-core / Man(a1-3)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9748
- N-Linked / Pauci-Mannose / Structure 10598
- N-Linked / Undefined core / Structure 9611
- N-Linked / Undefined core / Structure 9657
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- CD59 glycoprotein / Homo sapiens
- Progranulin / Homo sapiens
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Apoptosis inhibitor 5 / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- C-Jun-amino-terminal kinase-interacting protein 3 / Mus musculus
- Cadherin-13 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-2 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 6 of Receptor-type tyrosine-protein phosphatase S / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurocan core protein / Mus musculus
- Neuroendocrine convertase 2 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-A4 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Protein FAM171A2 / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Rho-associated protein kinase 2 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- HENNTKDNSIQHEFSLTR (18aa)
- TAVNCSSDFDACLITK (16aa)
- QGNASDVILR (10aa)
- WKLNK (5aa)
- ASVDVFGNR (9aa)
- VAWLNR (6aa)
- WSYNNSETSR (10aa)
- ANTTQPGIVEGGQVLK (16aa)
- HAIHVSGTNGTK (12aa)
- IRNVSDTTKR (10aa)
- NLTIVDSGLK (10aa)
- NCTLLLSTLSPELGGK (16aa)
- LSYNVIPLNLTLDNR (15aa)
- DAMVGNYTCEVTELSR (16aa)
- ISNVTPADAGIYYCVK (16aa)
- FLEPYNDSIQAQK (13aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- ANATLLLGPLR (11aa)
- HINFTR (6aa)
- HRANATLLLGPLR (13aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- LVTQTIPCNK (10aa)
- GNETIVNLIHSTR (13aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- AGPNGTLFVVDAYK (14aa)
- NQSVPLSCCR (10aa)
- VNFTCK (6aa)
- DHIHCLGNR (9aa)
- LLNQTLRENLKK (12aa)
- RNESHLIDFR (10aa)
- GNYSCFVSSPSITK (14aa)
- DIILHSTGHNISR (13aa)
- FNHTQTIQQK (10aa)
- ELGVVMYNCSCLAR (14aa)
- KFHVNYTQPLVAVK (14aa)
- HMNETSHTQGSLR (13aa)
- GIANLSNFIR (10aa)
- LAFLMINDSLVPNMIIPR (18aa)
- SVLENTTSYEEAK (13aa)
- TNSTQVSDVR (10aa)
- VTQQSPTSMNQVNLTCR (17aa)
- ANHSGAVVLLKR (12aa)
- QVNFTVDEHRR (11aa)
- VIYQNHNK (8aa)
- GEVFNATR (8aa)
- AQNVSILTLCDATTGVCTK (19aa)
- CPFGEVFNATR (11aa)
- KLVQVGIYNGTHVIPNDRK (19aa)
- RFNHTCLTFTTR (12aa)
- QVVENMTR (8aa)
- VPAELNGSMYR (11aa)
- VICTGPNDTSPGSPR (15aa)
- NHSLAFVGTK (10aa)
- FNSTEYQVVTR (11aa)
- GTEWLVNSSR (10aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- FFPYANGTLSIR (12aa)
- YSSNLSNFNYER (12aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- CEGPGVPTVTVHNTTDK (17aa)
- RGDLNINMTSPMGTK (15aa)
- DVECGEGHFCHDNQTCCR (18aa)
- YTCTAQTIVDNSSASADLVVR (21aa)
- NLSVVILGASDKDLHPNTDPFK (22aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- NVTDTFKR (8aa)
- VPGNQTSTTLK (11aa)
- KVEAEALNATAIR (13aa)
- FGTVPNGSTER (11aa)
- LWCAAGVNLSGWK (13aa)
- NLTLK (5aa)
- FHINK (5aa)
- NFSQILPDPSK (11aa)
- VDVMNSTLVK (10aa)
- YVPFNGTK (8aa)
- LLTTNK (6aa)
- QSCITEQTQYFFKNDTK (17aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- EGVFVSNGTHWF (12aa)
- VSNGTHWF (8aa)
- GPCSHLCLINHNR (13aa)
- VETGENCTSPAPK (13aa)
- FGTCSQLCNNTK (12aa)
-
- Hex:2 HexNAc:2 / O-Linked
(avg mass : 748.6901)
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / GalNAc(b1-3)Gal(b1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11400
- O-Linked / Core 1 / Structure 11414
- O-Linked / Core 2 / Gal(b1-3)Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9913
- O-Linked / Core 2 / Structure 10074
- O-Linked / No-core / Gal(?1-?)GlcNAc(?1-6)[Gal(?1-3)]GalNAc
- O-Linked / No-core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-3)GalNAc
- O-Linked / Undefined core / Gal(?1-4)GlcNAc(?1-6)[Gal(?1-3)]GalNAc
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)]GalNAc
- O-Linked / Undefined core / Gal(b1-4)GlcNAc(b1-?)[Gal(b1-?)]GalNAc
- O-Linked / Undefined core / Gal(b1-?)GlcNAc(?1-?)Gal(?1-?)GalNAc
- O-Linked / Undefined core / Glc(?1-4)GlcNAc(?1-4)Gal(?1-3)GalNAc
- Prostate cancer (DOID:10283)
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins (2013 - Halim A, Rüetschi U, Larson G, Nilsson J) / Status : Reviewed
- Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD (2012 - Halim A, Nilsson J, Rüetschi U, Hesse C, Larson G) / Status : Reviewed
Suggested structure
Disease
Reference
- Hex:2 HexNAc:2 / O-Linked
(avg mass : 748.6901)
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:2 HexNAc:2 / N-Linked
(avg mass : 748.6901)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 748.6901)
Source
Disease
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 748.6901)
Disease
Reported glycosite
- O-Linked / Undefined core
(avg mass : 748.6901)
Source
Disease
Reported glycosite
- O-Linked / No-core
(avg mass : 748.6901)
Source
Disease
Reported glycosite
- O-Linked / No-core
(avg mass : 748.6901)
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 748.6901)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 748.6901)
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 748.6901)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 748.6901)
Source
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 748.6901)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 748.6901)
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 748.6901)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 748.6901)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 748.6901)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 748.6901)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 748.6901)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 748.6901)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 748.6901)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 748.6901)
Disease
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 748.6901)