Hex:10 HexNAc:2

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Cricetulus griseus (Chinese hamster)
• Mus musculus (House mouse)
• Daucus carota (Carrot)
• Lycopersicon esculentum (Tomato)
• Asterias rubens (European starfish)
• Columba livia (Domestic pigeon)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Unio elongatulus
• Fagopyrum esculentum (Common buckwheat)
• Caenorhabditis elegans
• Aspergillus niger
• Agaricus bisporus (Common mushroom)
• Antheraea pernyi (Chinese oak silkmoth)
• Bombyx mori (Domestic silkworm)
• Drosophila melanogaster (Fruit fly)
• Leptomonas Samueli
• Persea americana (Avocado)
• Allium cepa (Onion)
• Asparagus officinalis (Garden asparagus)
• Musa acuminata (Banana)
• Oryza sativa (Rice)
• Cherax quadricarinatus (Australian red claw crayfish)
• Friend spleen focus-forming virus
• Friend spleen focus-forming virus (anemia inducing strain)
• Brassica oleracea var. botrytis (Cauliflower)
• Canavalia ensiformis (Jack bean)
• Citrus sinensis (Orange)
• Fragaria x ananassa (Strawberry)
• Malus domestica var. golden delicious (Cultivated apple - golden delicious)
• Pisum sativum (Pea)
• Pyrus communis var. williams (Pear)
• Vigna radiata var. radiata (Mung bean)
• Saccharomyces cerevisiae (Baker's yeast)
• Schizosaccharomyces pombe (Fission yeast)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• Riftia pachyptila (Giant tubeworm)

Protein

• CD59 glycoprotein / Homo sapiens    P13987
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Serotransferrin / Homo sapiens    P02787
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens    P29965
• Uromodulin / Homo sapiens    P07911
• Beta-lactoglobulin / Bos taurus    P02754
• Uncharacterized protein from Ovary / Cricetulus griseus
• Carbohydrate sulfotransferase 8 / Mus musculus    Q8BQ86
• Contactin-associated protein 1 / Mus musculus    O54991
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus    P46978
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus    Q3TDQ1
• Galactose-3-O-sulfotransferase 3 / Mus musculus    P61315
• Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus    Q9WV18
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Leucine rich repeat protein 2, neuronal / Mus musculus    Q6PHP6
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus    Q9D1T0
• Lysosome membrane protein 2 / Mus musculus    O35114
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• P2X purinoceptor 7 / Mus musculus    Q9Z1M0
• Phosphatidylcholine-sterol acyltransferase / Mus musculus    P16301
• Platelet glycoprotein 4 / Mus musculus    Q08857
• Prostaglandin g/h synthase 2 / Mus musculus    Q05769
• Protein kinase C-binding protein NELL2 / Mus musculus    Q61220
• Sortilin / Mus musculus    Q6PHU5
• Sortilin-related receptor / Mus musculus    O88307
• Translocon-associated protein subunit beta / Mus musculus    Q9CPW5
• Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus    Q6PHS9
• Uncharacterized protein from Root / Daucus carota
• Uncharacterized protein from Fruit / Lycopersicon esculentum
• Uncharacterized protein from Ovary / Asterias rubens
• Immunoglobulin gamma / Columba livia
• Immunoglobulin y / Coturnix coturnix japonica
• Immunoglobulin gamma / Gallus gallus
• Immunoglobulin y / Gallus gallus
• Gp273 / Unio elongatulus
• Uncharacterized protein from Seed / Fagopyrum esculentum
• Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
• Alpha-galactosidase a / Aspergillus niger    P28351
• Alpha-glucosidase / Aspergillus niger    P56526
• Endopolygalacturonase II / Aspergillus niger    P26214
• Uncharacterized protein from Undefined tissue / Agaricus bisporus
• Arylphorin / Antheraea pernyi    Q7Z1F8
• Sex-specific storage-protein 2 / Bombyx mori    P20613
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
• Uncharacterized protein from Whole Cell / Leptomonas Samueli
• Uncharacterized protein from Fruit / Persea americana
• Uncharacterized protein from Tuber / Allium cepa
• Uncharacterized protein from Undefined tissue / Asparagus officinalis
• Uncharacterized protein from Fruit / Musa acuminata
• Alpha-amylase / Oryza sativa    P17654
• Vitellogenin / Cherax quadricarinatus    Q9GSG2
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus    P03393
• Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
• Uncharacterized protein from Floret / Brassica oleracea var. botrytis
• Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis    Q6YDN9
• Alpha-mannosidase / Canavalia ensiformis    C0HJB3
• Uncharacterized protein from Fruit / Citrus sinensis
• Uncharacterized protein from Fruit / Fragaria x ananassa
• Uncharacterized protein from Fruit / Malus domestica var. golden delicious
• Uncharacterized protein from Seed / Pisum sativum
• Uncharacterized protein from Fruit / Pyrus communis var. williams
• Uncharacterized protein from Seed / Vigna radiata var. radiata
• Invertase / Saccharomyces cerevisiae
• Invertase 2 / Saccharomyces cerevisiae    P00724
• Invertase [secreted form] / Saccharomyces cerevisiae
• Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
• Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
• Whole-cell glycoproteins / Schizosaccharomyces pombe
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Hemoglobin extracellular / Riftia pachyptila

Source

• Blood (UBERON_0000178)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Coelomic Fluid (UBERON_0036217)  
• Hemolymph (UBERON_0001011)  
• Kidney (UBERON_0002113)   NRK (CVCL_3758)   Fibroblast (CL_0000057)  
• Ovary (UBERON_0000992)   Lec23 (CVCL_VU64)  
• Ovary (UBERON_0000992)   Sf9 (CVCL_0549)  
• Ovary (UBERON_0000992)  
• Placenta (UBERON_0001987)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• BW5147 (CVCL_3896)   Leukocyte (CL_0000738)  
• BW5147.PHAR2.7 (CVCL_VT60)   Leukocyte (CL_0000738)  
• HEK293 (CVCL_0045)  
• Rat1 (CVCL_0492)  
• Egg Cell   Jelly Coat  
• Floret (BTO_0000468)  
• Fruit (BTO_0000486)  
• Root (BTO_0001188)  
• Seed (BTO_0001226)  
• Tuber (BTO_0001400)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Gal(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Gal(a1-2)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Gal(a1-3)[Man(a1-2)]Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Gal(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(?1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
• N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-2)Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 5 x Man"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 5 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 7 x Man"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Glc + 6 x Man"
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)"
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-2)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-?)[Man(a1-2)Man(a1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:10 HexNAc:2 (avg mass : 2045.8293 )

Disease

• COVID-19 (DOID:0080600)
• Erythroleukemia with associated Polycythemia
• Lymphoma (DOID:0060058)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Structural characterization of the N-glycan moiety and site of glycosylation in vitellogenin from the decapod crustacean Cherax quadricarinatus. (2004 - Khalaila I, Peter-Katalinic J, Tsang C, Radcliffe CM, Aflalo ED, Harvey DJ, Dwek RA, Rudd PM, Sagi A) / Status : Reviewed
• N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
• Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
• N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A. (2003 - Henriksson H, Denman SE, Campuzano ID, Ademark P, Master ER, Teeri TT, Brumer H) / Status : Reviewed
• Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
• Structural characterization of the N-glycans of gp273, the ligand for sperm-egg interaction in the mollusc bivalve Unio elongatulus. (2001 - Di Patrizi L, Capone A, Focarelli R, Rosati F, Gallego RG, Gerwig GJ, Vliegenthart JF) / Status : Reviewed
• Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
• Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
• Characterization of glycosylated variants of beta-lactoglobulin expressed in Pichia pastoris (2001 - Kalidas, Joshi, Batt) / Status : Reviewed
• Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• The N-glycans of jack bean alpha-mannosidase. Structure, topology and function. (1999 - Kimura Y, Hess D, Sturm A) / Status : Reviewed
• Novel Schizosaccharomyces pombe N-linked GalMan9GlcNAc isomers: role of the Golgi GMA12 galactosyltransferase in core glycan galactosylation. (1999 - Ziegler F, Cavanagh J, Lubowski C, Trimble R) / Status : Reviewed
• Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
• Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
• The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
• Glycosylation of glycoprotein 55 encoded by the anaemia-inducing strain of Friend spleen focus-forming virus. (1994 - Volker J, Geyer H, Geyer R) / Status : Reviewed
• Novel structures of N-linked high-mannose type oligosaccharides containing alpha-D-galactofuranosyl linkages in Aspergillus niger alpha-D-glucosidase. (1994 - Takayanagi T, Kimura A, Chiba S, Ajisaka K) / Status : Reviewed
• Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
• Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
• Novel N-linked oligo-mannose type oligosaccharides containing an alpha-D-galactofuranosyl linkage found in alpha-D-galactosidase from Aspergillus niger. (1992 - Takayanagi T, Kushida K, Idonuma K, Ajisaka K) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
• A novel glycosylation phenotype expressed by Lec23, a Chinese hamster ovary mutant deficient in alpha-glucosidase I. (1991 - Ray M, Yang J, Sundaram S, Stanley P) / Status : Reviewed
• Structure and biosynthesis of the xylose-containing carbohydrate moiety of rice alpha-amylase. (1990 - Hayashi M, Tsuru A, Mitsui T, Takahashi N, Hanzawa H, Arata Y, Akazawa T) / Status : Reviewed
• Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
• Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
• Characterization of N-linked gluco-oligomannose type of carbohydrate chains of glycoproteins from the ovary of the starfish Asterias rubens (L.). (1987 - De Waard P, Kamerling JP, Van Halbeek H, Vliegenthart JF, Broertjes JJ) / Status : Reviewed
• The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed

Reported glycosite

• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Serotransferrin / Homo sapiens
  •        Undefined site
• Transferrin receptor protein 1 / Homo sapiens
  •        Asn-727
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Asn-513
• Beta-lactoglobulin / Bos taurus
  •        Undefined site
• Uncharacterized protein from Ovary / Cricetulus griseus
  •        Undefined site
• Carbohydrate sulfotransferase 8 / Mus musculus
  •        Asn-360
• Contactin-associated protein 1 / Mus musculus
  •        Asn-805
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-752
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus
  •        Asn-544
  •        Asn-548
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus
  •        Asn-624
• Galactose-3-O-sulfotransferase 3 / Mus musculus
  •        Asn-110
• Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
  •        Asn-439
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-517
• Leucine rich repeat protein 2, neuronal / Mus musculus
  •        Asn-381
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus
  •        Asn-287
• Lysosome membrane protein 2 / Mus musculus
  •        Asn-412
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
  •        Asn-427
  •        Asn-501
• P2X purinoceptor 7 / Mus musculus
  •        Asn-202
• Phosphatidylcholine-sterol acyltransferase / Mus musculus
  •        Asn-108
• Platelet glycoprotein 4 / Mus musculus
  •        Asn-220
• Prostaglandin g/h synthase 2 / Mus musculus
  •        Asn-130
• Protein kinase C-binding protein NELL2 / Mus musculus
  •        Asn-56
• Sortilin / Mus musculus
  •        Asn-404
• Sortilin-related receptor / Mus musculus
  •        Asn-1895
• Translocon-associated protein subunit beta / Mus musculus
  •        Asn-88
• Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
  •        Undefined site
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
  •        Asn-789
• Uncharacterized protein from Root / Daucus carota
  •        Undefined site
• Uncharacterized protein from Fruit / Lycopersicon esculentum
  •        Undefined site
• Uncharacterized protein from Ovary / Asterias rubens
  •        Undefined site
• Immunoglobulin gamma / Columba livia
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Gp273 / Unio elongatulus
  •        Undefined site
• Uncharacterized protein from Seed / Fagopyrum esculentum
  •        Undefined site
• Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
  •        Undefined site
• Alpha-galactosidase a / Aspergillus niger
  •        Undefined site
• Alpha-glucosidase / Aspergillus niger
  •        Undefined site
• Endopolygalacturonase II / Aspergillus niger
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Agaricus bisporus
  •        Undefined site
• Arylphorin / Antheraea pernyi
  •        Undefined site
• Sex-specific storage-protein 2 / Bombyx mori
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Drosophila melanogaster
  •        Undefined site
• Uncharacterized protein from Whole Cell / Leptomonas Samueli
  •        Undefined site
• Uncharacterized protein from Fruit / Persea americana
  •        Undefined site
• Uncharacterized protein from Tuber / Allium cepa
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Asparagus officinalis
  •        Undefined site
• Uncharacterized protein from Fruit / Musa acuminata
  •        Undefined site
• Alpha-amylase / Oryza sativa
  •        Undefined site
• Vitellogenin / Cherax quadricarinatus
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
  •        Undefined site
• Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
  •        Undefined site
• Uncharacterized protein from Floret / Brassica oleracea var. botrytis
  •        Undefined site
• Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
  •        Undefined site
• Alpha-mannosidase / Canavalia ensiformis
  •        Undefined site
• Uncharacterized protein from Fruit / Citrus sinensis
  •        Undefined site
• Uncharacterized protein from Fruit / Fragaria x ananassa
  •        Undefined site
• Uncharacterized protein from Fruit / Malus domestica var. golden delicious
  •        Undefined site
• Uncharacterized protein from Seed / Pisum sativum
  •        Undefined site
• Uncharacterized protein from Fruit / Pyrus communis var. williams
  •        Undefined site
• Uncharacterized protein from Seed / Vigna radiata var. radiata
  •        Undefined site
• Invertase / Saccharomyces cerevisiae
  •        Undefined site
• Invertase 2 / Saccharomyces cerevisiae
  •        Undefined site
• Invertase [secreted form] / Saccharomyces cerevisiae
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
  •        Undefined site
• Whole-cell glycoproteins / Schizosaccharomyces pombe
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-709
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-602
  •        Asn-657
• Hemoglobin extracellular / Riftia pachyptila
  •        Undefined site

Mass spectrometry observed peptide

• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43
• QVPGLHNGTK (10aa)
  •    Q61220    Asn-56
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
  •    P0DTC2    Asn-74
• SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
  •    P0DTC2    Asn-74
• SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
  •    P0DTC2    Asn-61
• FSNVTW (6aa)
  •    P0DTC2    Asn-61
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78
• FHAIHVSGTNGTK (13aa)
  •    P0DTC2    Asn-74
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74
• IAPASNVSHTVVLRPLK (17aa)
  •    Q9CPW5    Asn-88
• IVYNHSSGR (9aa)
  •    P16301    Asn-108
• NFSAHFVHPATRPPHMLASHLR (22aa)
  •    P61315    Asn-110
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• SEFRVYSSANNCTFE (15aa)
  •    P0DTC2    Asn-165
• NNIHFPGHNYTTR (13aa)
  •    Q9Z1M0    Asn-202
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217
• VFNGKDNISK (10aa)
  •    Q08857    Asn-220
• FLNLSYNPIGTIEGSMLHELLR (22aa)
  •    Q9D1T0    Asn-287
• VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
  •    P0DTC2    Asn-331
• VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
  •    P0DTC2    Asn-343
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343
• LIHAPGNLTFPR (12aa)
  •    Q8BQ86    Asn-360
• WANATGTHVR (10aa)
  •    Q6PHP6    Asn-381
• HLYTTTGGETDFTNVTSLR (19aa)
  •    Q6PHU5    Asn-404
• TMVFPVMYLNESVLIDKETANQLK (24aa)
  •    O35114    Asn-412
• KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
  •    Q810U4    Asn-427
• SISNMTSQEFVEK (13aa)
  •    Q9WV18    Asn-439
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513
• EICSGNSSQCAPNVHK (16aa)
  •    Q9R1V6-16    Asn-517
• TILVDNNTWNNTHISR (16aa)
  •    P46978    Asn-548
• TILVDNNTWNNTHISR (16aa)
  •    P46978    Asn-544
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-602
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615
• TTLVDNNTWNNSHIALVGK (19aa)
  •    Q3TDQ1    Asn-624
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-717
• NSVAYSNNSIAIPTNFTISVTTE (23aa)
  •    P0DTC2    Asn-709
• GKANYSLQIYPDESHYFHSVALK (23aa)
  •    Q9Z218    Asn-752
• ANYSLQIYPDESHYFHSVALK (21aa)
  •    Q9Z218    Asn-752
• AAEDWTENPEPFNASFYR (18aa)
  •    Q6PHS9    Asn-789
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• DFGGFNFSQILPDPSKPSK (19aa)
  •    P0DTC2    Asn-801
• ANHSLDVSFYFR (12aa)
  •    O54991    Asn-805
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098
• VSNGTHWF (8aa)
  •    P0DTC2    Asn-1098
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1174
• ELDKYFKNHTSPDVDLGDISGINASVVNIQKE (32aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1174
• VAKNLNE (7aa)
  •    P0DTC2    Asn-1194
• VAKNLNESLIDLQE (14aa)
  •    P0DTC2    Asn-1194
• SVTTSLHNK (9aa)
  •    O88307    Asn-1895