taxonomy (31)
protein (229)
source (38)
structure (21)
composition (1)
disease (9)
reference (59)
site (354)
peptide (354)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Cricetulus griseus (Chinese hamster)
- Felis catus (Cat)
- Mus musculus (House mouse)
- Nasua narica (White-nosed coati)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Acremonium sp. HI-25
- Gallus gallus (Chicken)
- Trichinella spiralis
- Aspergillus awamori
- Megathura crenulata (Californian giant keyhole limpet)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Leishmania amazonensis
- Trypanosoma brucei brucei
- Trimeresurus stejnegeri (Chinese green tree viper)
- Pontastacus leptodactylus (Narrow-clawed crayfish)
- Limulus polyphemus (Atlantic horseshoe crab)
- Arachis hypogaea (Peanut)
- Glycine max (Soybean)
- Malus domestica var. golden delicious (Cultivated apple - golden delicious)
- Prunus dulcis var. sativa (Sweet almond)
- Ricinus communis (Castor bean)
- Vigna radiata var. radiata (Mung bean)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Riftia pachyptila (Giant tubeworm)
Taxonomy
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Arylsulfatase a / Homo sapiens P15289
- Cadherin-5 / Homo sapiens P33151
- Complement c3 / Homo sapiens P01024
- Complement factor i / Homo sapiens P05156
- Ephrin-A1 / Homo sapiens P20827
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Lactadherin / Homo sapiens Q08431
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Plasminogen / Homo sapiens P00747
- Plexin-c1 / Homo sapiens O60486
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Protein-lysine 6-oxidase / Homo sapiens P28300
- Transferrin receptor protein 1 / Homo sapiens P02786
- Uromodulin / Homo sapiens P07911
- Thyrotropin-aplha and beta chains / Bos taurus P01223 P01217
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Uncharacterized protein from Ovary / Cricetulus griseus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- 4F2 cell-surface antigen heavy chain / Mus musculus P10852
- Acid ceramidase / Mus musculus Q9WV54
- Adhesion G protein-coupled receptor B2 / Mus musculus Q8CGM1
- Adipocyte plasma membrane-associated protein / Mus musculus Q9D7N9
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus P56528
- Aminopeptidase N / Mus musculus P97449
- Arylsulfatase B / Mus musculus P50429
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus A2AL83 Q8BSY0
- Attractin / Mus musculus Q9WU60
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-13 / Mus musculus Q9WTR5
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Cadherin-6 / Mus musculus P97326
- Carboxypeptidase D / Mus musculus O89001
- Carboxypeptidase E / Mus musculus Q00493
- Cathepsin D / Mus musculus P18242
- Cathepsin L1 / Mus musculus P06797
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- Cation-independent mannose-6-phosphate receptor / Mus musculus Q07113
- CD166 antigen / Mus musculus Q61490
- Choline transporter-like protein 1 / Mus musculus Q6X893
- Choline transporter-like protein 2 / Mus musculus Q8BY89
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus Q8BXA5
- Contactin-1 / Mus musculus P12960
- Contactin-2 / Mus musculus Q61330
- Contactin-3 / Mus musculus Q07409
- Contactin-4 / Mus musculus Q69Z26
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Contactin-associated protein-like 4 / Mus musculus Q99P47
- CUB and sushi domain-containing protein 1 / Mus musculus Q923L3
- CUB and sushi domain-containing protein 3 / Mus musculus Q80T79
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus Q61072
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus O55026
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Ephrin-A3 / Mus musculus O08545
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus P26048
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus Q9D6F4
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus Q8BHJ7
- Gamma-aminobutyric acid receptor subunit beta-3 / Mus musculus P63080
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glucosidase 2 subunit beta / Mus musculus O08795
- Glutamate receptor ionotropic, delta-2 / Mus musculus Q61625
- Glutamate receptor ionotropic, kainate 3 / Mus musculus B1AS29
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glutamate receptor ionotropic, NMDA 3A / Mus musculus A2AIR5
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- GPI transamidase component PIG-S / Mus musculus Q6PD26
- Group XV phospholipase A2 / Mus musculus Q8VEB4
- Heat shock 70 kDa protein 13 / Mus musculus Q8BM72
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Iduronate 2-sulfatase / Mus musculus Q08890
- Immunoglobulin superfamily member 21 / Mus musculus Q7TNR6
- Immunoglobulin superfamily member 3 / Mus musculus Q6ZQA6
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Insulin receptor / Mus musculus P15208
- Integrin alpha 7 / Mus musculus Q61738
- Integrin alpha-6 / Mus musculus Q61739
- Integrin alpha-V / Mus musculus P43406
- Intercellular adhesion molecule 5 / Mus musculus Q60625
- Interleukin-6 receptor subunit beta / Mus musculus Q00560
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2 of Catenin delta-1 / Mus musculus P30999-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus P11881-3
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-10
- Isoform J of Receptor-type tyrosine-protein phosphatase delta / Mus musculus Q64487-10
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit gamma-1 / Mus musculus P02468
- Leucine-rich glioma-inactivated protein 1 / Mus musculus Q9JIA1
- Leucine-rich repeat-containing protein 4 / Mus musculus Q99PH1
- Leucine-rich repeat-containing protein 55 / Mus musculus Q3UY51
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal alpha-glucosidase / Mus musculus P70699
- Lysosomal thioesterase PPT2 / Mus musculus O35448
- Lysosome membrane protein 2 / Mus musculus O35114
- Lysosome-associated membrane glycoprotein 1 / Mus musculus P11438
- Lysosome-associated membrane glycoprotein 2 / Mus musculus P17047
- Mammalian ependymin-related protein 1 / Mus musculus Q99M71
- Metabotropic glutamate receptor 3 / Mus musculus Q9QYS2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Mucin / Mus musculus
- Myelin protein zero-like protein 1 / Mus musculus Q3TEW6
- Myelin-associated glycoprotein / Mus musculus P20917
- N-acetylglucosamine-6-sulfatase / Mus musculus Q8BFR4
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neurexin-1 / Mus musculus Q9CS84
- Neurocan core protein / Mus musculus P55066
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal growth regulator 1 / Mus musculus Q80Z24
- Neuroplastin / Mus musculus P97300
- Nicastrin / Mus musculus P57716
- Nodal modulator 1 / Mus musculus Q6GQT9
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Opioid-binding protein/cell adhesion molecule / Mus musculus G5E8G3
- P2X purinoceptor 7 / Mus musculus Q9Z1M0
- Phospholipase D3 / Mus musculus O35405
- Phospholipase D4 / Mus musculus Q8BG07
- Plexin-A1 / Mus musculus P70206
- Plexin-A2 / Mus musculus P70207
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Probable C-mannosyltransferase DPY19L4 / Mus musculus A2AJQ3
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Proteasome-associated protein ECM29 homolog / Mus musculus Q6PDI5
- Protein CREG1 / Mus musculus O88668
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Protein ELFN1 / Mus musculus Q8C8T7
- Protein FAM171A2 / Mus musculus A2A699
- Protein kinase C-binding protein NELL2 / Mus musculus Q61220
- Protein O-glucosyltransferase 1 / Mus musculus Q8BYB9
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus Q68FM6
- Protein sidekick-2 / Mus musculus Q6V4S5
- Protocadherin-17 / Mus musculus E9PXF0
- Protocadherin-7 / Mus musculus E9Q2S0
- Protocadherin-9 / Mus musculus A0A0A6YY09
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus Q64455
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Semaphorin-3E / Mus musculus P70275
- Semaphorin-4D / Mus musculus O09126
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium channel subunit beta-4 / Mus musculus Q7M729
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Sortilin-related receptor / Mus musculus O88307
- SUN domain-containing protein 2 / Mus musculus Q8BJS4
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- Tenascin / Mus musculus Q80YX1
- Tenascin-r / Mus musculus Q8BYI9
- Teneurin-2 / Mus musculus Q9WTS5
- Tetraspanin-3 / Mus musculus Q9QY33
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus Q69ZU6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane protein 106B / Mus musculus Q80X71
- Transmembrane protein 106C / Mus musculus Q80VP8
- Transmembrane protein 132A / Mus musculus Q922P8
- Transmembrane protein 2 / Mus musculus Q5FWI3
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Tyrosine-protein kinase Mer / Mus musculus Q60805
- Tyrosine-protein kinase receptor / Mus musculus Q6VNS1
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- VPS10 domain-containing receptor SorCS1 / Mus musculus Q9JLC4
- VPS10 domain-containing receptor SorCS3 / Mus musculus Q8VI51
- Zinc finger protein 521 / Mus musculus Q6KAS7
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Amiloride-sensitive amine oxidase / Sus scrofa Q9TRC7
- Ascorbate oxidase / Acremonium sp. HI-25
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Tsl-1 antigens / Trichinella spiralis
- Glucoamylase / Aspergillus awamori P69327
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Phospholipase a2 / Apis mellifera P00630
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Membrane glycoproteins / Bombyx mori
- Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Leishmanolysin / Leishmania amazonensis Q27673
- Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Galactose-binding lectin / Trimeresurus stejnegeri Q9YGP1
- Hemocyanin / Pontastacus leptodactylus P83180
- C-reactive protein / Limulus polyphemus
- Allergen ara h1, clone p17 / Arachis hypogaea P43237
- Uncharacterized protein from Seed / Arachis hypogaea
- Uncharacterized protein from Undefined tissue / Glycine max
- Uncharacterized protein from Fruit / Malus domestica var. golden delicious
- Uncharacterized protein from Seed / Prunus dulcis var. sativa
- Agglutinin / Ricinus communis P06750
- Ricin / Ricinus communis P02879
- Uncharacterized protein from Cotyledon / Ricinus communis
- Uncharacterized protein from Endosperm / Ricinus communis
- Uncharacterized protein from Seed / Vigna radiata var. radiata
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Hemoglobin extracellular / Riftia pachyptila
Protein
- Blood (UBERON_0000178)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107) Cytoplasm (GO_0005737)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO 15B (CVCL_VU04)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Pituitary Gland (UBERON_0000007)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966)
- Royal Jelly
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Submandibular Gland (UBERON_0001736)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Adipocytes (CL_0000136)
- Delipidated Cell
- Egg Cell
- Egg Cell Egg White
- Cotyledon (BTO_0000300)
- Endosperm (BTO_0000390)
- Fruit (BTO_0000486)
- Seed (BTO_0001226)
Source
- Free / Lactose / [Gal(b1-4)GlcNAc(b1-6)][Gal(b1-3)GlcNAc(b1-3)]Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)Glc
- Free / Lactose / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)Glc(b1-
- N-Linked / High-Mannose / Man(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Man"
- N-Linked / High-Mannose / Structure 9637
- N-Linked / No-core / Gal(b1-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 1786
- N-Linked / Pauci-Mannose / Gal(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9653
- N-Linked / Undefined core / Structure 9625
Reported structure
- Hex:4 HexNAc:2 (avg mass : 1072.9749 )
Composition
- Carcinoma, Hepatocellular (DOID:684)
- COVID-19 (DOID:0080600)
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Hyperimmune condition
- IgE myeloma (DOID:9538)
- Mannosidosis, alpha (DOID:3413)
- Myeloma, Multiple (DOID:9538)
- Prostate cancer (DOID:10283)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Unreviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Unreviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Unreviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Unreviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Unreviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- N-Glycan analysis by matrix-assisted laser desorption/ionization mass spectrometry of electrophoretically separated nonmammalian proteins: application to peanut allergen Ara h 1 and olive pollen allergen Ole e 1. (2000 - Kolarich D, Altmann F) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- Characterization and analysis of a novel glycoprotein from snake venom using liquid chromatography-electrospray mass spectrometry and Edman degradation. (1999 - Zeng R, Xu Q, Shao X, Wang K, Xia Q) / Status : Reviewed
- Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
- The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
- Characterization of asparagine-linked oligosaccharides on a mouse submandibular mucin. (1995 - Denny P, Hong-Le N) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Molecular characterization of Limulus polyphemus C-reactive protein. II. Asparagine-linked oligosaccharides. (1993 - Amatayakul-Chantler S, Dwek R, Tennent G, Pepys M, Rademacher T) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
- Crystal structure of glucoamylase from Aspergillus awamori var. X100 to 2.2-A resolution. (1992 - Aleshin A, Golubev A, Firsov L, Honzatko R) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Characterization of a novel type of chain-terminator Gal beta 1-6Gal beta 1-4)GlcNAc in an oligosaccharide related to N-glycosylated protein glycans isolated from GM1 the urine of patients with gangliosidosis. (1991 - Michalski J, Lemoine J, Wieruszeski J, Fournet B, Montreuil J, Strecker G) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Structures of the N-linked oligosaccharides of Gp63, the major surface glycoprotein, from Leishmania mexicana amazonensis. (1990 - Olafson R, Thomas J, Ferguson M, Dwek R, Chaudhuri M, Chang K, Rademacher T) / Status : Reviewed
- Structures of sugar chains of water-soluble glycoproteins in developing castor bean cotyledons. (1990 - Kimura Y, Suehisa H, Yamaguchi O, Nakajima S, Takagi S) / Status : Reviewed
- Possible pathway for the processing of sugar chains containing xylose in plant glycoproteins deduced on structural analyses of sugar chains from Ricinus communis lectins. (1987 - Kimura Y, Hase S, Kobayashi Y, Kyogoku Y, Funatsu G, Ikenaka T) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Structure of the altered oligosaccharide present in glycoproteins from a clone of Chinese hamster ovary cells deficient in N-acetylglucosaminyltransferase activity. (1978 - Li E, Kornfeld S) / Status : Reviewed
Reference
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Arylsulfatase a / Homo sapiens
- Undefined site
- Cadherin-5 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement factor i / Homo sapiens
- Ephrin-A1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
- Lactadherin / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Plexin-c1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- Protein-lysine 6-oxidase / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Uromodulin / Homo sapiens
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- 4F2 cell-surface antigen heavy chain / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Aminopeptidase N / Mus musculus
- Arylsulfatase B / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Cadherin-6 / Mus musculus
- Carboxypeptidase D / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cathepsin D / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Choline transporter-like protein 1 / Mus musculus
- Choline transporter-like protein 2 / Mus musculus
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-3 / Mus musculus
- Contactin-4 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- CUB and sushi domain-containing protein 1 / Mus musculus
- CUB and sushi domain-containing protein 3 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Ephrin-A3 / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glucosidase 2 subunit beta / Mus musculus
- Glutamate receptor ionotropic, delta-2 / Mus musculus
- Glutamate receptor ionotropic, kainate 3 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glutamate receptor ionotropic, NMDA 3A / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI transamidase component PIG-S / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Heat shock 70 kDa protein 13 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Iduronate 2-sulfatase / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Immunoglobulin superfamily member 3 / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Insulin receptor / Mus musculus
- Integrin alpha 7 / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Interleukin-6 receptor subunit beta / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2 of Catenin delta-1 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform J of Receptor-type tyrosine-protein phosphatase delta / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine-rich glioma-inactivated protein 1 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
- Leucine-rich repeat-containing protein 55 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal thioesterase PPT2 / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metal transporter CNNM4 / Mus musculus
-
Mucin / Mus musculus
- Undefined site
- Myelin protein zero-like protein 1 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- N-acetylglucosamine-6-sulfatase / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurexin-1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Neuroplastin / Mus musculus
- Nicastrin / Mus musculus
- Nodal modulator 1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- P2X purinoceptor 7 / Mus musculus
- Phospholipase D3 / Mus musculus
- Phospholipase D4 / Mus musculus
- Plexin-A1 / Mus musculus
- Plexin-A2 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Probable C-mannosyltransferase DPY19L4 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Proteasome-associated protein ECM29 homolog / Mus musculus
- Protein CREG1 / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protein ELFN1 / Mus musculus
- Protein FAM171A2 / Mus musculus
- Protein kinase C-binding protein NELL2 / Mus musculus
- Protein O-glucosyltransferase 1 / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-17 / Mus musculus
- Protocadherin-7 / Mus musculus
- Protocadherin-9 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Semaphorin-3E / Mus musculus
- Semaphorin-4D / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- SUN domain-containing protein 2 / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- Tenascin / Mus musculus
- Tenascin-r / Mus musculus
- Teneurin-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane protein 106B / Mus musculus
- Transmembrane protein 106C / Mus musculus
- Transmembrane protein 132A / Mus musculus
- Transmembrane protein 2 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Tyrosine-protein kinase Mer / Mus musculus
- Tyrosine-protein kinase receptor / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- VPS10 domain-containing receptor SorCS3 / Mus musculus
- Zinc finger protein 521 / Mus musculus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
-
Ascorbate oxidase / Acremonium sp. HI-25
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
- Glucoamylase / Aspergillus awamori
-
Hemocyanin / Megathura crenulata
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Leishmanolysin / Leishmania amazonensis
- Undefined site
-
Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Undefined site
- Galactose-binding lectin / Trimeresurus stejnegeri
-
Hemocyanin / Pontastacus leptodactylus
- Undefined site
-
C-reactive protein / Limulus polyphemus
- Undefined site
- Allergen ara h1, clone p17 / Arachis hypogaea
-
Uncharacterized protein from Seed / Arachis hypogaea
- Undefined site
-
Uncharacterized protein from Undefined tissue / Glycine max
- Undefined site
-
Uncharacterized protein from Fruit / Malus domestica var. golden delicious
- Undefined site
-
Uncharacterized protein from Seed / Prunus dulcis var. sativa
- Undefined site
-
Agglutinin / Ricinus communis
- Undefined site
-
Ricin / Ricinus communis
- Undefined site
-
Uncharacterized protein from Cotyledon / Ricinus communis
- Undefined site
-
Uncharacterized protein from Endosperm / Ricinus communis
- Undefined site
-
Uncharacterized protein from Seed / Vigna radiata var. radiata
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Hemoglobin extracellular / Riftia pachyptila
- Undefined site
Reported glycosite
- QCVNLTTR (8aa)
- RHTVFWNSSNPKF (13aa)
- HAVYWNSSNQHLR (13aa)
- HENNTKDNSIQHEFSLTR (18aa)
- EIFVVNGTQGK (11aa)
- WYSAGLASNSSWFR (14aa)
- SVSVAAGDSTVLNCTLTSLLPVGPIR (26aa)
- GGSLWLNCSTNCPRPER (17aa)
- QVPGLHNGTK (10aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- QGNASDVILR (10aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- WKLNK (5aa)
- SCNISVTEK (9aa)
- EEEAIQLDGLNASQIR (16aa)
- INGTDVDIGMDFR (13aa)
- ASVDVFGNR (9aa)
- VQQVGHYPPANSSLASR (17aa)
- GAWLNR (6aa)
- NK (2aa)
- NLSLAHNR (8aa)
- SNVSVEENVILEKPSHVELK (20aa)
- VAWLNR (6aa)
- WSYNNSETSR (10aa)
- GIAEVTENVTEGGVTK (16aa)
- ANTTQPGIVEGGQVLK (16aa)
- MNGTEMNLEPGSR (13aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- EQVTVINR (8aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- WINDTVVVYK (10aa)
- LLPPVAFNHTIGHIVLSEHK (20aa)
- TVNVSVPKK (9aa)
- NVSDTTKR (8aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- VVWNGSR (7aa)
- VLTLANFTTK (10aa)
- NLTIVDSGLK (10aa)
- NCTLLLSTLSPELGGK (16aa)
- LVYNR (5aa)
- YNLSEVLQGK (10aa)
- LAYSGIPLNLTLDNR (15aa)
- VILRPYLTPNNQGLYIFQGNSTVR (24aa)
- DAMVGNYTCEVTELSR (16aa)
- ISNVTPADAGIYYCVK (16aa)
- TNNISILLSDLEFSDTGR (18aa)
- NVETNNSTVLIEGK (14aa)
- EASHYSIHDIVLSYNTSDSTVFPGAVAK (28aa)
- YSVQHMYFTYNLSDTEHFPNAISK (24aa)
- VHSGNFSTIPQYFK (14aa)
- DEGDYFCELQVSGANPMSSNK (21aa)
- FLEPYNDSIQAQK (13aa)
- LVNVSR (6aa)
- HINFTR (6aa)
- ANATLLLGPLR (11aa)
- HRANATLLLGPLR (13aa)
- LIVNNATNVVIK (12aa)
- NQSVGDPNVDLIR (13aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIKVCE (19aa)
- GVYELTHNNK (10aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- NTTLYIDR (8aa)
- VLHHYNR (7aa)
- KLNYTLK (7aa)
- LLNLTSPEATAK (12aa)
- FAEINGSALCSYNIKPSEYTLTSK (24aa)
- LQAQDSGFYECYTPSTDTQYLGNYSAK (27aa)
- SVAHNMTMPNK (11aa)
- GNETIVNLIHSTR (13aa)
- LENLSSTESGYTATLTR (17aa)
- KSIAHNMTTPNK (12aa)
- RLRNVSWATGRS (12aa)
- ACQFNR (6aa)
- RACQFNR (7aa)
- CNSVLTYNLTPVVQK (15aa)
- NGTILYTMR (9aa)
- VYMKNVTVVLR (11aa)
- AGPNGTLFVVDAYK (14aa)
- NVTVVLR (7aa)
- VNKTEEDYAR (10aa)
- EHYLSSVNK (9aa)
- SSANNCTFEY (10aa)
- VYSSANNCTFE (11aa)
- SEFRVYSSANNCTFE (15aa)
- VYSSANNCTF (10aa)
- DSYPDGNITWYR (12aa)
- NQSVPLSCCR (10aa)
- GIPDQKVNFTCK (12aa)
- HNLTIFFDVK (10aa)
- VNFTCK (6aa)
- LVDNGTLLYTMR (12aa)
- NYTVVMSTR (9aa)
- DHIHCLGNR (9aa)
- LNNITNIGPLDMK (13aa)
- SEHLVNFTVK (10aa)
- NSTIQAANLAGLK (13aa)
- DGKPLLNDSR (10aa)
- VNSSQALPVDGGEVK (15aa)
- NSSHSPLR (8aa)
- KNASNMEYR (9aa)
- LLNQTLR (7aa)
- NASNMEYR (8aa)
- LLNQTLRENLKK (12aa)
- VINFYAGANQSMNVTCVGKR (20aa)
- VINFYAGANQSMNVTCVGK (19aa)
- RNESHLIDFR (10aa)
- NVTALLMEAR (10aa)
- KNSTAYFR (8aa)
- VLVAPPSEEANTTK (14aa)
- DHPNATAWR (9aa)
- RIPVTNLSQLHK (12aa)
- GNYSCFVSSPSITK (14aa)
- TNSSFIQGFVDHVKEDCDR (19aa)
- DIILHSTGHNISR (13aa)
- HNNDTQHIWESDSNEFSVIADPR (23aa)
- FNHTQTIQQK (10aa)
- DEDAENLGHFVMFPANGSIDLMYFPYYGK (29aa)
- AEFAVANDTGFVDIPQQEK (19aa)
- YRAEFAVANDTGFVDIPQQEK (21aa)
- NSTFGSVEVFSLDPNKVHK (19aa)
- NSTFGSVEVFSLDPNK (16aa)
- ANATIEVK (8aa)
- ELGVVMYNCSCLAR (14aa)
- QNITYLLK (8aa)
- WSCDHKQNITYLLK (14aa)
- GINIT (5aa)
- KFHVNYTQPLVAVK (14aa)
- FHVNYTQPLVAVK (13aa)
- KNNSIPDKQ (9aa)
- HMNETSHTQGSLR (13aa)
- LLFPTNSSSR (10aa)
- NTTEVVK (7aa)
- GIANLSNFIR (10aa)
- SVLENTTSYEEAK (13aa)
- LAFLMINDSLVPNMIIPR (18aa)
- LAYATINDSR (10aa)
- LVAIAVIDEKNTSLEHTR (18aa)
- YYHGELSYLNVTRK (14aa)
- YYHGELSYLNVTR (13aa)
- NLSEDR (6aa)
- NGTGVIRK (8aa)
- TNSTQVSDVR (10aa)
- LFNGQQGIIIQNFSTR (16aa)
- RLFNGQQGIIIQNFSTR (17aa)
- VTQQSPTSMNQVNLTCR (17aa)
- SAVSTSWLLPYNHTWSHEK (19aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- NFSSHINR (8aa)
- ANHSGAVVLLKR (12aa)
- ANHSGAVVLLK (11aa)
- QVNFTVDEHRR (11aa)
- LGKQVNFTVDEHRR (14aa)
- VFVYTPTTNYTLR (13aa)
- SINLTLDR (8aa)
- SHGLWNNTVFIFSTDNGGQTR (21aa)
- VIYQNHNK (8aa)
- ACPLDPATNK (10aa)
- IENISYQDR (9aa)
- NDTPKNLTK (9aa)
- ITNVSEEDSGEYFCLASNK (19aa)
- FFHVNGSAFLPR (12aa)
- EDGMLPANR (9aa)
- KMSNITFR (8aa)
- VLKDAVNNITAK (12aa)
- FPNITNLCPF (10aa)
- FPNITNL (7aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGE (12aa)
- YLINVTFEGR (10aa)
- GEVFNATR (8aa)
- VFNATR (6aa)
- AQNVSILTLCDATTGVCTK (19aa)
- CLNHTTQKNLSFATIYDVLSTKPVLNK (27aa)
- NLSFATIYDVLSTKPVLNK (19aa)
- MYTLEQYNNSK (11aa)
- ADGSFRLENITTGTYTIHAQK (21aa)
- DLNISEDR (8aa)
- KLVQVGIYNGTHVIPNDRK (19aa)
- LVQVGIYNGTHVIPNDRK (18aa)
- KLVQVGIYNGTHVIPNDR (18aa)
- IYNASELPVR (10aa)
- RFNHTCLTFTTR (12aa)
- NFSSCSAEDFEK (12aa)
- IVFNK (5aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- VQPIASSTLIHSDLTSVYGTVVMNR (25aa)
- NALGTANQTINGHFLK (16aa)
- DLQGNPIANATISVDGIDHDVTSAK (25aa)
- QVVENMTR (8aa)
- HQNQTLR (7aa)
- GDRNLTWR (8aa)
- INTTIGSVAAQDPDAAR (17aa)
- INTTIGSVAAQDPDAARNPVK (21aa)
- VPAELNGSMYR (11aa)
- IDSTGNVTNELR (12aa)
- KTCNPETFPLRNESLQCPTAR (21aa)
- ATQLFTNQTDIPNMEDVYAVK (21aa)
- TTNLTSGQYLSR (12aa)
- VFHIHNESWVLLTPK (15aa)
- NISGVVLADHSGSFHNR (17aa)
- NISFGR (6aa)
- VGVHINNTQTK (11aa)
- ANQTALCGGGVQTR (14aa)
- INFTAPFNPNK (11aa)
- SISNMTSQEFVEK (13aa)
- VICTGPNDTSPGSPR (15aa)
- NHSLAFVGTK (10aa)
- LSEIHKDQPGHPVNR (15aa)
- SSSHLPPSSYFNASGR (16aa)
- VILYNR (6aa)
- FNSTEYQVVTR (11aa)
- IVASDSGKPSLNQTALVR (18aa)
- DGGSPPLNSTK (11aa)
- GTEWLVNSSR (10aa)
- KLVLYLEHNLEKNSTKEEILAALEK (25aa)
- LVLYLEHNLEKNSTKEEILAALEK (24aa)
- KLVLYLEHNLEKNSTK (16aa)
- LVLYLEHNLEKNSTK (15aa)
- NSTKEEILAALEK (13aa)
- GTEILGNSTR (10aa)
- YEQGTGCWQGPNR (13aa)
- YNCTATNR (8aa)
- FFPYANGTLSIR (12aa)
- IIISPEENVTLTCTAENQLER (21aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- CEGPGVPTVTVHNTTDKRR (19aa)
- CEGPGVPTVTVHNTTDK (17aa)
- CEGPGVPTVTVHNTTDKR (18aa)
- VFGSQNLTTVK (11aa)
- EICSGNSSQCAPNVHK (16aa)
- VVAVSPANISR (11aa)
- LVNSTFLHNK (10aa)
- YIDKGNR (7aa)
- GTNESEASSTQFTTEIDAPK (20aa)
- VLSAGGNDSR (10aa)
- NLSDSLAR (8aa)
- FNFTNCASLK (10aa)
- YTCTAQTIVDNSSASADLVVR (21aa)
- NLSVVILGASDK (12aa)
- NLSVVILGASDKDLHPNTDPFK (22aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- LYQDVNCT (8aa)
- NNSNNFDLNR (10aa)
- NYTWVPIR (8aa)
- TLNCSGAHVK (10aa)
- NVTDTFKR (8aa)
- INNTHALVSLLQNLNK (16aa)
- ALSPNSTISSAPK (13aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- AGCLIGAEHVNNSYE (15aa)
- NWTITR (6aa)
- VPGNQTSTTLK (11aa)
- ANYNLPIMVTDSGKPPMTNITDLR (24aa)
- FGTVPNGSTER (11aa)
- SNISILR (7aa)
- AIQLNCSVK (9aa)
- YSNNSIAIPT (10aa)
- KVEVEAVNATAVK (13aa)
- SNGSENNVLESQAGIQK (17aa)
- VSHVLNDTHMK (11aa)
- NFTIS (5aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- VFLNGTHR (8aa)
- NISYTLLPPSSNVR (14aa)
- LVVNISDLGYPK (12aa)
- LQVTLYNCSFGR (12aa)
- GLLTFVDHLPVTQVVVGDTNR (21aa)
- NESIVPFSPYEVK (13aa)
- VVSNNCTDGVR (11aa)
- KVVSNNCTDGVR (12aa)
- IWCLGNETR (9aa)
- FHINK (5aa)
- IVSNNCTDGLR (11aa)
- NFSQILPDPSK (11aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- VDVMNSTLVK (10aa)
- VLNSTAISLQWNR (13aa)
- GYNVTYWWK (9aa)
- YVPFNGTK (8aa)
- NATLAEQAK (9aa)
- LTIVNSSVLDRPR (13aa)
- GLSPGNYSVR (10aa)
- LLTTNK (6aa)
- YQTLNCSVNVR (11aa)
- AEPPLNASAGDQEEK (15aa)
- YIITWDHVVALSNESTVTGYK (21aa)
- ENQNHSYSLK (10aa)
- NVTLDCAQGTAK (12aa)
- QSCITEQTQYFFKNDTK (17aa)
- HPNCVNVTK (9aa)
- NLNFSTR (7aa)
- LNYSLPTGQSMEVQLPK (17aa)
- YNYTEDPTILR (11aa)
- TGNGSSVQTTGR (12aa)
- VPAQEKNF (8aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPR (46aa)
- KNFTTAPAICHDGK (14aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- EGVFVSNGTHW (11aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- GVFVSNGTHWFVTQR (15aa)
- NFTTAPAICHDGK (13aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- VNSSLHSQISR (11aa)
- NMANGQPHSVNITR (14aa)
- EELDKYFKNHTSPDVDLGDISGINASVVNIQKE (33aa)
- NLTSNMWR (8aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- VAKNLNE (7aa)
- VAKNLNESLIDLQE (14aa)
- TANETSAEAYNLLLR (15aa)
- NVTSILELR (9aa)
- FWLVEGNSSR (10aa)
- QHVVPEKFEEPCLVNSSHLLMCR (23aa)
- NISCVVSDGSAEDFSK (16aa)
- RIPAINR (7aa)
- SLSPHAGTEPCPPEAAVCLLNGSKPVNLGK (30aa)
- WTGHNVTVVQR (11aa)
- GPCSHLCLINHNR (13aa)
- DNTTCYEFKK (10aa)
- DNTTCYEFK (9aa)
- LHKDNTTCYEFK (12aa)
- LHKDNTTCYEFKK (13aa)
- NLTRPSLTQYELDNLSK (17aa)
- TLETHSNK (8aa)
- LYWISSGNGTINR (13aa)
- LYWISSGNHTINR (13aa)
- NSTTLVMHMK (10aa)
- SVTTSLHNK (9aa)
- THANGSIK (8aa)
- THANGSIKR (9aa)
- GCKDNATDSVPLR (13aa)
- VETGENCTSPAPK (13aa)
- DGSCIGNSSR (10aa)
- IVNGSHYEYK (10aa)
- GGQILTGNSTR (11aa)
- CNASSQFLCSSGR (13aa)
- TCLSNGSWTGR (11aa)
- VGMDGTNQSVVIETK (15aa)
- VNATFTAASR (10aa)
- FGTCSQLCNNTK (12aa)
- GVTHLNISGLK (11aa)
- LNGTDPIVAADSK (13aa)
Mass spectrometry observed peptide
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Unreviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Unreviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Unreviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Unreviewed
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Unreviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Unreviewed
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
- Creating a Mass Spectral Reference Library for Oligosaccharides in Human Milk (2018 - Connie A Remoroza, Tytus D Mak, Maria Lorna A De Leoz, Yuri A Mirokhin, Stephen E Stein) / Status : Unreviewed
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Unreviewed
- Systematic Review of the Concentrations of Oligosaccharides in Human Milk (2017 - Stephan Thurl, Manfred Munzert, Günther Boehm, Catherine Matthews, Bernd Stahl) / Status : Unreviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Unreviewed
- Development of an Annotated Library of Neutral Human Milk Oligosaccharides (2010 - Shuai Wu, Nannan Tao, J Bruce German, Rudolf Grimm, Carlito B Lebrilla) / Status : Unreviewed
- Chemical characterisation of the oligosaccharides in a sample of milk of a white-nosed coati, Nasua narica (Procyonidae: Carnivora). (1999 - Urashima T, Yamamoto M, Nakamura T, Arai I, Saito T, Namiki M, Yamaoka K, Kawahara K) / Status : Reviewed
-
- Free / Lactose
(avg mass : 1072.9749)
- Milk (UBERON_0001913)
- Synthesis of Asymmetrical Multiantennary Human Milk Oligosaccharides (2017 - Anthony R Prudden, Lin Liu, Chantelle J Capicciotti, Margreet A Wolfert, Shuo Wang, Zhongwei Gao, Lu Meng, Kelley W Moremen, Geert-Jan Boons) / Status : Unreviewed
- Human Milk Oligosaccharides (HMOS): Structure, Function, and Enzyme-Catalyzed Synthesis (2015 - Xi Chen) / Status : Unreviewed
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Detected as released in some experiments - Mannosidosis, alpha (DOID:3413)
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
-
Plasminogen / Homo sapiens
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Released - Urine (UBERON_0001088)
- Mannosidosis, alpha (DOID:3413)
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Kidney (UBERON_0002113)
- Placenta (UBERON_0001987)
- Seminal Fluid (UBERON_0006530)
- Venom (UBERON_0007113)
- Fruit (BTO_0000486)
- Seed (BTO_0001226)
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- N-Glycan analysis by matrix-assisted laser desorption/ionization mass spectrometry of electrophoretically separated nonmammalian proteins: application to peanut allergen Ara h 1 and olive pollen allergen Ole e 1. (2000 - Kolarich D, Altmann F) / Status : Reviewed
- N-linked oligosaccharide structures in the diamine oxidase from porcine kidney. (2000 - Huang Y, Mechref Y, Novotny M) / Status : Reviewed
- Characterization and analysis of a novel glycoprotein from snake venom using liquid chromatography-electrospray mass spectrometry and Edman degradation. (1999 - Zeng R, Xu Q, Shao X, Wang K, Xia Q) / Status : Reviewed
- The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
- Prostate-specific antigen (psa-1) / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
-
Amiloride-sensitive amine oxidase / Sus scrofa
- Undefined site
- Galactose-binding lectin / Trimeresurus stejnegeri
- Allergen ara h1, clone p17 / Arachis hypogaea
-
Uncharacterized protein from Seed / Arachis hypogaea
- Undefined site
-
Uncharacterized protein from Undefined tissue / Glycine max
- Undefined site
-
Uncharacterized protein from Fruit / Malus domestica var. golden delicious
- Undefined site
-
Uncharacterized protein from Seed / Prunus dulcis var. sativa
- Undefined site
-
Uncharacterized protein from Seed / Vigna radiata var. radiata
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Blood (UBERON_0000178)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Ovary (UBERON_0000992) CHO 15B (CVCL_VU04)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Royal Jelly
- Spleen (UBERON_0002106)
- Venom (UBERON_0007113)
- Delipidated Cell
- Cotyledon (BTO_0000300)
- Endosperm (BTO_0000390)
- Seed (BTO_0001226)
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- Structural analysis and localization of the carbohydrate moieties of a soluble human interferon gamma receptor produced in baculovirus-infected insect cells. (1994 - Manneberg M, Friedlein A, Kurth H, Lahm H, Fountoulakis M) / Status : Reviewed
- Primary structures of the N-linked carbohydrate chains from honeybee venom phospholipase A2. (1993 - Kubelka V, Altmann F, Staudacher E, Tretter V, Mrz L, Hrd K, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Crystal structure of glucoamylase from Aspergillus awamori var. X100 to 2.2-A resolution. (1992 - Aleshin A, Golubev A, Firsov L, Honzatko R) / Status : Reviewed
- Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
- Structures of sugar chains of water-soluble glycoproteins in developing castor bean cotyledons. (1990 - Kimura Y, Suehisa H, Yamaguchi O, Nakajima S, Takagi S) / Status : Reviewed
- Possible pathway for the processing of sugar chains containing xylose in plant glycoproteins deduced on structural analyses of sugar chains from Ricinus communis lectins. (1987 - Kimura Y, Hase S, Kobayashi Y, Kyogoku Y, Funatsu G, Ikenaka T) / Status : Reviewed
- Structure of the altered oligosaccharide present in glycoproteins from a clone of Chinese hamster ovary cells deficient in N-acetylglucosaminyltransferase activity. (1978 - Li E, Kornfeld S) / Status : Reviewed
-
Interferon-gamma receptor alpha chain / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Ascorbate oxidase / Acremonium sp. HI-25
- Undefined site
- Glucoamylase / Aspergillus awamori
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
- Phospholipase a2 / Apis mellifera
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Undefined site
-
Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Undefined site
-
Agglutinin / Ricinus communis
- Undefined site
-
Ricin / Ricinus communis
- Undefined site
-
Uncharacterized protein from Cotyledon / Ricinus communis
- Undefined site
-
Uncharacterized protein from Endosperm / Ricinus communis
- Undefined site
-
Hemoglobin extracellular / Riftia pachyptila
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Molecular characterization of Limulus polyphemus C-reactive protein. II. Asparagine-linked oligosaccharides. (1993 - Amatayakul-Chantler S, Dwek R, Tennent G, Pepys M, Rademacher T) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
C-reactive protein / Limulus polyphemus
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Metalloproteinase inhibitor 1 / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- High-mannose-type oligosaccharides from human placental arylsulfatase A are core fucosylated as confirmed by MALDI MS. (2000 - Hoja-Lukowicz D, Cioczyk D, Bergquist J, Lityska A, Laidler P) / Status : Reviewed
- Characterization of asparagine-linked oligosaccharides on a mouse submandibular mucin. (1995 - Denny P, Hong-Le N) / Status : Reviewed
- Structures of the N-linked oligosaccharides of Gp63, the major surface glycoprotein, from Leishmania mexicana amazonensis. (1990 - Olafson R, Thomas J, Ferguson M, Dwek R, Chaudhuri M, Chang K, Rademacher T) / Status : Reviewed
-
Arylsulfatase a / Homo sapiens
- Undefined site
-
Mucin / Mus musculus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Leishmanolysin / Leishmania amazonensis
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- BM-N (CVCL_Z633)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Released - Adipocytes (CL_0000136)
-
- N-Linked / No-core
(avg mass : 1072.9749)
Released - Urine (UBERON_0001088)
- Gangliosidosis GM1 (DOID:3322)
-
- N-Linked / No-core
(avg mass : 1072.9749)
Released - Urine (UBERON_0001088)
- Mannosidosis, alpha (DOID:3413)
-
- N-Linked / No-core
(avg mass : 1072.9749)
Detected as released in some experiments - Hemolymph (UBERON_0001011)
- Liver (UBERON_0002107) Cytoplasm (GO_0005737)
- Ovary (UBERON_0000992) CHO 15B (CVCL_VU04)
- Urine (UBERON_0001088)
- Egg Cell Egg White
- Mannosidosis, alpha (DOID:3413)
- Quantitation and isomeric structure analysis of free oligosaccharides present in the cytosol fraction of mouse liver: detection of a free disialobiantennary oligosaccharide and glucosylated oligomannosides. (1999 - Ohashi S, Iwai K, Mega T, Hase S) / Status : Reviewed
- Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
- Different oligosaccharides accumulate in the brain and urine of a cat with alpha-mannosidosis: structure determination of five brain-derived and seventeen urinary oligosaccharides. (1991 - Hard K, Mekking A, Kamerling J, Dacremont G, Vliegenthart J) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Structure of the altered oligosaccharide present in glycoproteins from a clone of Chinese hamster ovary cells deficient in N-acetylglucosaminyltransferase activity. (1978 - Li E, Kornfeld S) / Status : Reviewed
-
Uncharacterized protein from Ovary / Cricetulus griseus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Hemocyanin / Pontastacus leptodactylus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1072.9749)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Milk (UBERON_0001913)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Ephrin-A1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Lactadherin / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- RHTVFWNSSNPKF (13aa)
- RLRNVSWATGRS (12aa)
- KNNSIPDKQ (9aa)
-
- N-Linked / Pauci-Mannose
(avg mass : 1072.9749)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1072.9749)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Undefined core
(avg mass : 1072.9749)
Released - Embryo (UBERON_0000922)
-
- Hex:4 HexNAc:2 / N-Linked
(avg mass : 1072.9749)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Retina (UBERON_0000966)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / High-Mannose / Man(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 3 x Man"
- N-Linked / High-Mannose / Structure 9637
- N-Linked / No-core / Gal(b1-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)Man(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-2)Man(a1-6)Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / Man(a1-3)[Man(a1-6)]Man(a1-6)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 1786
- N-Linked / Pauci-Mannose / Gal(b1-4)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Structure 9653
- N-Linked / Undefined core / Structure 9625
- Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Cadherin-5 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement factor i / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Plexin-c1 / Homo sapiens
- Protein-lysine 6-oxidase / Homo sapiens
- Uromodulin / Homo sapiens
- Uncharacterized protein (gene name abca4) / Bos taurus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- 4F2 cell-surface antigen heavy chain / Mus musculus
- Acid ceramidase / Mus musculus
- Adhesion G protein-coupled receptor B2 / Mus musculus
- Adipocyte plasma membrane-associated protein / Mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Aminopeptidase N / Mus musculus
- Arylsulfatase B / Mus musculus
- Aspartyl/asparaginyl beta-hydroxylase / Mus musculus
- Attractin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-13 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Cadherin-6 / Mus musculus
- Carboxypeptidase D / Mus musculus
- Carboxypeptidase E / Mus musculus
- Cathepsin D / Mus musculus
- Cathepsin L1 / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- Cation-independent mannose-6-phosphate receptor / Mus musculus
- CD166 antigen / Mus musculus
- Choline transporter-like protein 1 / Mus musculus
- Choline transporter-like protein 2 / Mus musculus
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-2 / Mus musculus
- Contactin-3 / Mus musculus
- Contactin-4 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- CUB and sushi domain-containing protein 1 / Mus musculus
- CUB and sushi domain-containing protein 3 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 9 / Mus musculus
- Ectonucleoside triphosphate diphosphohydrolase 2 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Ephrin-A3 / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-4 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
- Gamma-aminobutyric acid receptor subunit beta-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glucosidase 2 subunit beta / Mus musculus
- Glutamate receptor ionotropic, delta-2 / Mus musculus
- Glutamate receptor ionotropic, kainate 3 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glutamate receptor ionotropic, NMDA 3A / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- GPI transamidase component PIG-S / Mus musculus
- Group XV phospholipase A2 / Mus musculus
- Heat shock 70 kDa protein 13 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
- Iduronate 2-sulfatase / Mus musculus
- Immunoglobulin superfamily member 21 / Mus musculus
- Immunoglobulin superfamily member 3 / Mus musculus
- Immunoglobulin superfamily member 8 / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Insulin receptor / Mus musculus
- Integrin alpha 7 / Mus musculus
- Integrin alpha-6 / Mus musculus
- Integrin alpha-V / Mus musculus
- Intercellular adhesion molecule 5 / Mus musculus
- Interleukin-6 receptor subunit beta / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2 of Catenin delta-1 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
- Isoform 8 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform J of Receptor-type tyrosine-protein phosphatase delta / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leucine-rich glioma-inactivated protein 1 / Mus musculus
- Leucine-rich repeat-containing protein 4 / Mus musculus
- Leucine-rich repeat-containing protein 55 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal alpha-glucosidase / Mus musculus
- Lysosomal thioesterase PPT2 / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 1 / Mus musculus
- Lysosome-associated membrane glycoprotein 2 / Mus musculus
- Mammalian ependymin-related protein 1 / Mus musculus
- Metabotropic glutamate receptor 3 / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Myelin protein zero-like protein 1 / Mus musculus
- Myelin-associated glycoprotein / Mus musculus
- N-acetylglucosamine-6-sulfatase / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neurexin-1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal growth regulator 1 / Mus musculus
- Neuroplastin / Mus musculus
- Nicastrin / Mus musculus
- Nodal modulator 1 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Opioid-binding protein/cell adhesion molecule / Mus musculus
- P2X purinoceptor 7 / Mus musculus
- Phospholipase D3 / Mus musculus
- Phospholipase D4 / Mus musculus
- Plexin-A1 / Mus musculus
- Plexin-A2 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Probable C-mannosyltransferase DPY19L4 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Proteasome-associated protein ECM29 homolog / Mus musculus
- Protein CREG1 / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protein ELFN1 / Mus musculus
- Protein FAM171A2 / Mus musculus
- Protein kinase C-binding protein NELL2 / Mus musculus
- Protein O-glucosyltransferase 1 / Mus musculus
- Protein phosphatase 1 regulatory subunit 29 / Mus musculus
- Protein sidekick-2 / Mus musculus
- Protocadherin-17 / Mus musculus
- Protocadherin-7 / Mus musculus
- Protocadherin-9 / Mus musculus
- Receptor-type tyrosine-protein phosphatase eta / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Semaphorin-3E / Mus musculus
- Semaphorin-4D / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium channel subunit beta-4 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Sortilin-related receptor / Mus musculus
- SUN domain-containing protein 2 / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- Tenascin / Mus musculus
- Tenascin-r / Mus musculus
- Teneurin-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thrombospondin type-1 domain-containing protein 7A / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane protein 106B / Mus musculus
- Transmembrane protein 106C / Mus musculus
- Transmembrane protein 132A / Mus musculus
- Transmembrane protein 2 / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Tyrosine-protein kinase Mer / Mus musculus
- Tyrosine-protein kinase receptor / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- VPS10 domain-containing receptor SorCS3 / Mus musculus
- Zinc finger protein 521 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- HAVYWNSSNQHLR (13aa)
- HENNTKDNSIQHEFSLTR (18aa)
- EIFVVNGTQGK (11aa)
- WYSAGLASNSSWFR (14aa)
- SVSVAAGDSTVLNCTLTSLLPVGPIR (26aa)
- GGSLWLNCSTNCPRPER (17aa)
- QVPGLHNGTK (10aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- QGNASDVILR (10aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- WKLNK (5aa)
- SCNISVTEK (9aa)
- EEEAIQLDGLNASQIR (16aa)
- INGTDVDIGMDFR (13aa)
- ASVDVFGNR (9aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:2 / N-Linked
(avg mass : 1072.9749)
Source
Reported glycosite
- N-Linked / Undefined core
(avg mass : 1072.9749)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1072.9749)
Source
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1072.9749)
Source
Disease
Reference
Reported glycosite
- N-Linked / No-core
(avg mass : 1072.9749)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1072.9749)
Source
Disease
Reported glycosite
- N-Linked / No-core
(avg mass : 1072.9749)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Source
Disease
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Disease
Reference
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Source
Reported glycosite
- N-Linked / High-Mannose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1072.9749)
Source
Reference
Reported glycosite
- Free / Lactose
(avg mass : 1072.9749)