taxonomy (79)
protein (655)
source (59)
structure (29)
composition (1)
disease (11)
reference (102)
site (921)
peptide (785)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Acremonium sp
- Androctonus australis (Sahara scorpion)
- Actinidia chinensis (Kiwi fruit)
- Apium graveolens var. oulce (Celery)
- Artemisia vulgaris (Mugwort)
- Daucus carota (Carrot)
- Lycopersicon esculentum (Tomato)
- Nicotiana alata (Persian tobacco)
- Solanum tuberosum (Potato)
- Asterias rubens (European starfish)
- Columba livia (Domestic pigeon)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Unio elongatus
- Physomitrella patens
- Fagopyrum esculentum (Common buckwheat)
- Torpedo californica (Pacific electric ray)
- Caenorhabditis elegans
- Trichinella spiralis
- Aspergillus niger
- Agaricus bisporus (Common mushroom)
- Aedes aegypti (Yellow fever mosquito)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Trypanosoma brucei brucei
- Trypansoma brucei
- Persea americana (Avocado)
- Naja kaouthia (Monocled cobra)
- Kinetoplastids
- Allium cepa (Onion)
- Asparagus officinalis (Garden asparagus)
- Musa acuminata (Banana)
- Oryza sativa (Rice)
- Cherax quadricarinatus (Australian red claw crayfish)
- Pontastacus leptodactylus (Narrow-clawed crayfish)
- Friend mink cell focus-forming virus
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (anemia inducing strain)
- Friend spleen focus-forming virus (gm1 mutant)
- Friend spleen focus-forming virus (gm1.2 mutant)
- Friend spleen focus-forming virus (gm1.2.3 mutant)
- Friend spleen focus-forming virus (gm3 mutant)
- Friend spleen focus-forming virus (gm3.4 mutant)
- Human immunodeficiency virus (Hiv)
- Human immunodeficiency virus type 1 (bh8 isolate) (Hiv-1 (bh8 isolate))
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Arabidopsis thaliana (Thale cress)
- Brassica oleracea var. botrytis (Cauliflower)
- Canavalia ensiformis (Jack bean)
- Carica papaya (Papaya)
- Citrus sinensis (Orange)
- Corylus avellana (Hazelnut)
- Fragaria x ananassa (Strawberry)
- Glycine max (Soybean)
- Juglans regia (English walnut)
- Malus domestica var. golden delicious (Cultivated apple - golden delicious)
- Phaseolus lunatus (Lima bean)
- Phaseolus vulgaris (Kidney bean)
- Pistacia vera (Pistachio)
- Pisum sativum (Pea)
- Prunus dulcis var. sativa (Sweet almond)
- Pyrus communis var. williams (Pear)
- Ricinus communis (Castor bean)
- Vigna radiata var. radiata (Mung bean)
- Saccharomyces cerevisiae (Baker's yeast)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Schistosoma mansoni
- Riftia pachyptila (Giant tubeworm)
Taxonomy
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens P04035
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Acid ceramidase / Homo sapiens Q13510
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Agrin / Homo sapiens O00468
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-2-macroglobulin-like protein 1 / Homo sapiens A8K2U0
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Amphoterin-induced protein 2 / Homo sapiens Q86SJ2
- Angiotensin-converting enzyme / Homo sapiens P12821
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein b-100 / Homo sapiens P04114
- Apolipoprotein d / Homo sapiens P05090
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- ATP-binding cassette sub-family A member 1 / Homo sapiens O95477
- ATP-binding cassette sub-family A member 2 / Homo sapiens Q9BZC7
- ATP-binding cassette sub-family A member 7 / Homo sapiens Q8IZY2
- Attractin / Homo sapiens O75882
- Basigin / Homo sapiens P35613
- Beta-glucuronidase / Homo sapiens P08236
- Beta-hexosaminidase subunit alpha / Homo sapiens P06865
- Beta-secretase / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- C-type mannose receptor 2 / Homo sapiens Q9UBG0
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens Q9NYQ6
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens Q9HCU4
- Cadherin-5 / Homo sapiens P33151
- Calcium-activated chloride channel regulator 2 / Homo sapiens Q9UQC9
- Calponin-3 / Homo sapiens Q15417
- Calreticulin / Homo sapiens P27797
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Cartilage oligomeric matrix protein / Homo sapiens P49747
- Cartilage-associated protein / Homo sapiens O75718
- Cathepsin D / Homo sapiens P07339
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD109 antigen / Homo sapiens Q6YHK3
- CD166 antigen / Homo sapiens Q13740
- CD82 antigen / Homo sapiens P27701
- Ceramide synthase 2 / Homo sapiens Q96G23
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Choline transporter-like protein 4 / Homo sapiens Q53GD3
- Chondroitin sulfate glucuronyltransferase / Homo sapiens Q9P2E5
- Cleft lip and palate transmembrane protein 1 / Homo sapiens O96005
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Coagulation factor VIII / Homo sapiens P00451
- Coiled-coil domain-containing protein 80 / Homo sapiens Q76M96
- Collagen alpha-1(I) chain / Homo sapiens P02452
- Collagen alpha-1(III) chain / Homo sapiens P02461
- Collagen alpha-1(V) chain / Homo sapiens P20908
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(I) chain / Homo sapiens P08123
- Collagen alpha-2(V) chain / Homo sapiens P05997
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-6(VI) chain / Homo sapiens A6NMZ7
- Complement C2 / Homo sapiens P06681
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- CUB domain-containing protein 1 / Homo sapiens Q9H5V8
- Cytokine receptor-like factor 1 / Homo sapiens O75462
- Deoxyribonuclease-2-alpha / Homo sapiens O00115
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens O14672
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens P78536
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens P46977
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Dystroglycan / Homo sapiens Q14118
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens Q14264
- Endoplasmin / Homo sapiens P14625
- Ephrin-A3 / Homo sapiens P52797
- Epidermal growth factor receptor / Homo sapiens P00533
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens Q9BZQ6
- ER membrane protein complex subunit 1 / Homo sapiens Q8N766
- ER membrane protein complex subunit 10 / Homo sapiens Q5UCC4
- Erlin-1 / Homo sapiens O75477
- Erlin-2 / Homo sapiens O94905
- ERO1-like protein alpha / Homo sapiens Q96HE7
- Extracellular sulfatase Sulf-1 / Homo sapiens Q8IWU6
- Extracellular sulfatase Sulf-2 / Homo sapiens Q8IWU5
- Fibrillin-1 / Homo sapiens P35555
- Fibroblast growth factor receptor 1 / Homo sapiens P11362
- Fibronectin / Homo sapiens P02751
- Folate receptor alpha / Homo sapiens P15328
- Follistatin-related protein 1 / Homo sapiens Q12841
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glucoside xylosyltransferase 1 / Homo sapiens Q4G148
- Glucosylceramidase / Homo sapiens P04062
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- GPI ethanolamine phosphate transferase 1 / Homo sapiens O95427
- Heat shock 70 kDa protein 13 / Homo sapiens P48723
- Hemopexin / Homo sapiens P02790
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens Q68CP4
- HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens P01892
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens P30450
- HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens P30512
- HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens P04439
- HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens P16188
- HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens P16189
- HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens P16190
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens P30453
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens P30456
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens P30457
- HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens P01891
- HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens P10316
- HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens P30459
- HLA class I histocompatibility antigen, alpha chain E / Homo sapiens P13747
- HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens P30462
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens P30464
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens P30466
- HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens P30685
- HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens P18463
- HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens Q95365
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens P30475
- HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens Q04826
- HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens P30480
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens P30484
- HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens P30485
- HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens P30486
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens Q29836
- HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens P01889
- HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens P30460
- HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens Q31610
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens Q29718
- HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens P30499
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens P30508
- HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens P30510
- HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens Q07000
- HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens Q29960
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens Q95604
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens Q29865
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens P30501
- HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens P04222
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens P30504
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens Q9TNN7
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens P10321
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens P30505
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Hyaluronidase-4 / Homo sapiens Q2M3T9
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens P35858
- Integrin alpha-1 / Homo sapiens P56199
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-6 / Homo sapiens P23229
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Integrin alpha-X / Homo sapiens P20702
- Integrin beta-1 / Homo sapiens P05556
- Integrin beta-3 / Homo sapiens P05106
- Integrin beta-5 / Homo sapiens P18084
- Integrin beta-6 / Homo sapiens P18564
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Interleukin-6 receptor subunit beta / Homo sapiens P40189
- KDEL motif-containing protein 2 / Homo sapiens Q7Z4H8
- Lactadherin / Homo sapiens Q08431
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit beta-2 / Homo sapiens P55268
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens Q14767
- Lipase member J / Homo sapiens Q5W064
- Lipase member K / Homo sapiens Q5VXJ0
- Liver carboxylesterase 1 / Homo sapiens P23141
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens Q9NZR2
- Low-density lipoprotein receptor-related protein 5 / Homo sapiens O75197
- Lumican / Homo sapiens P51884
- Lymphoid enhancer-binding factor 1 / Homo sapiens Q9UJU2
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal acid phosphatase / Homo sapiens P11117
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrosialin / Homo sapiens P34810
- Mammaglobin-A / Homo sapiens Q13296
- Mammaglobin-B / Homo sapiens O75556
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Melanoma inhibitory activity protein 3 / Homo sapiens Q5JRA6
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Monoacylglycerol lipase ABHD12 / Homo sapiens Q8N2K0
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- Myelin protein zero-like protein 2 / Homo sapiens O60487
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens Q9NY97
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Neurofascin / Homo sapiens O94856
- Neuroplastin / Homo sapiens Q9Y639
- Neutral amino acid transporter B(0) / Homo sapiens Q15758
- Nicalin / Homo sapiens Q969V3
- Nicastrin / Homo sapiens Q92542
- Nodal modulator 1 / Homo sapiens Q15155
- Nodal modulator 2 / Homo sapiens Q5JPE7
- Nodal modulator 3 / Homo sapiens P69849
- Nuclear envelope integral membrane protein 1 / Homo sapiens O14524
- Nuclear pore membrane glycoprotein 210 / Homo sapiens Q8TEM1
- Nucleolar protein 56 / Homo sapiens O00567
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens Q86WC4
- P2X purinoceptor 7 / Homo sapiens Q99572
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens O95302
- Peroxidasin homolog / Homo sapiens Q92626
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Phospholipase D3 / Homo sapiens Q8IV08
- PI-PLC X domain-containing protein 3 / Homo sapiens Q63HM9
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Platelet glycoprotein 4 / Homo sapiens P16671
- Platelet-derived growth factor subunit b / Homo sapiens P01127
- Plexin-B2 / Homo sapiens O15031
- Plexin-c1 / Homo sapiens O60486
- Plexin-D1 / Homo sapiens Q9Y4D7
- Podocalyxin / Homo sapiens O00592
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Probable C-mannosyltransferase DPY19L4 / Homo sapiens Q7Z388
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Progranulin / Homo sapiens P28799
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Prosalusin / Homo sapiens Q8N2E6
- Prosaposin / Homo sapiens P07602
- Prostaglandin G/H synthase 1 / Homo sapiens P23219
- Prostaglandin G/H synthase 2 / Homo sapiens P35354
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Protein CREG1 / Homo sapiens O75629
- Protein O-mannosyl-transferase 2 / Homo sapiens Q9UKY4
- Protein OS-9 / Homo sapiens Q13438
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Protein turtle homolog A / Homo sapiens Q9P2J2
- Protein Wnt-5a / Homo sapiens P41221
- Protocadherin alpha-12 / Homo sapiens Q9UN75
- Protocadherin beta-10 / Homo sapiens Q9UN67
- Protocadherin beta-11 / Homo sapiens Q9Y5F2
- Protocadherin beta-14 / Homo sapiens Q9Y5E9
- Protocadherin beta-15 / Homo sapiens Q9Y5E8
- Protocadherin beta-16 / Homo sapiens Q9NRJ7
- Protocadherin beta-2 / Homo sapiens Q9Y5E7
- Protocadherin beta-3 / Homo sapiens Q9Y5E6
- Protocadherin beta-5 / Homo sapiens Q9Y5E4
- Protocadherin beta-8 / Homo sapiens Q9UN66
- Protocadherin beta-9 / Homo sapiens Q9Y5E1
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant plasminogen - [r580e] / Homo sapiens P00750
- Recombinant plasminogen - [r580s] / Homo sapiens P00750
- Rho-related BTB domain-containing protein 3 / Homo sapiens O94955
- Seipin / Homo sapiens Q96G97
- Semaphorin-4D / Homo sapiens Q92854
- Serine--tRNA ligase, cytoplasmic / Homo sapiens P49591
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Sialomucin core protein 24 / Homo sapiens Q04900
- Signal transducer CD24 / Homo sapiens P25063
- Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens O43166
- Sodium channel protein type 4 subunit alpha / Homo sapiens P35499
- Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens Q9UN76
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Solute carrier family 12 member 7 / Homo sapiens Q9Y666
- Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens P11166
- Sortilin / Homo sapiens Q99523
- Sortilin-related receptor / Homo sapiens Q92673
- Sparc / Homo sapiens P09486
- Stromal interaction molecule 1 / Homo sapiens Q13586
- SUN domain-containing ossification factor / Homo sapiens Q9UBS9
- Superoxide dismutase [Cu-Zn] / Homo sapiens P00441
- Suppressor of tumorigenicity 14 protein / Homo sapiens Q9Y5Y6
- Synaptonemal complex protein SC65 / Homo sapiens Q92791
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- Tapasin / Homo sapiens O15533
- Tetraspanin-3 / Homo sapiens O60637
- Tetratricopeptide repeat protein 17 / Homo sapiens Q96AE7
- Thioredoxin domain-containing protein 15 / Homo sapiens Q96J42
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Thrombospondin-3 / Homo sapiens P49746
- Thyroglobulin / Homo sapiens P01266
- TM2 domain-containing protein 1 / Homo sapiens Q9BX74
- TM2 domain-containing protein 3 / Homo sapiens Q9BRN9
- Toll-like receptor 2 / Homo sapiens O60603
- Torsin-1A / Homo sapiens O14656
- Torsin-1B / Homo sapiens O14657
- Torsin-2A / Homo sapiens Q5JU69
- Transcobalamin-1 / Homo sapiens P20061
- Transferrin receptor protein 1 / Homo sapiens P02786
- Transforming growth factor beta-3 / Homo sapiens P10600
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Transmembrane protein 131 / Homo sapiens Q92545
- Transmembrane protein 2 / Homo sapiens Q9UHN6
- Transmembrane protein 231 / Homo sapiens Q9H6L2
- Transmembrane protein 8A / Homo sapiens Q9HCN3
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Twisted gastrulation protein homolog 1 / Homo sapiens Q9GZX9
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens Q6NSJ0
- Uncharacterized protein from Serum / Homo sapiens
- UPF0577 protein KIAA1324 / Homo sapiens Q6UXG2
- Uromodulin / Homo sapiens P07911
- Uroplakin-3b-like protein / Homo sapiens B0FP48
- V-type proton ATPase subunit e 1 / Homo sapiens O15342
- V-type proton ATPase subunit S1 / Homo sapiens Q15904
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Von willebrand factor / Homo sapiens P04275
- Zinc transporter ZIP6 / Homo sapiens Q13433
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- Beta-lactoglobulin / Bos taurus P02754
- Lactotransferrin / Bos taurus P24627
- Platelet glycoprotein IV / Bos taurus P26201
- Ribonuclease pancreatic [b] / Bos taurus P61823
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Adhesion G protein-coupled receptor F5 / Mus musculus G5E8Q8
- Alpha-(1,3)-fucosyltransferase 11 / Mus musculus Q8BHC9
- Alpha-L-iduronidase / Mus musculus P48441
- ATP-binding cassette sub-family A member 1 / Mus musculus P41233
- ATP-binding cassette sub-family A member 2 / Mus musculus P41234
- ATP-binding cassette sub-family A member 7 / Mus musculus Q91V24
- ATPase family AAA domain-containing protein 1 / Mus musculus Q9D5T0
- Attractin / Mus musculus Q9WU60
- Basigin / Mus musculus P18572
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Beta-hexosaminidase subunit alpha / Mus musculus P29416
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus Q8BTJ4
- Bone morphogenetic protein receptor type-2 / Mus musculus O35607
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-10 / Mus musculus P70408
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Calsyntenin-2 / Mus musculus Q9ER65
- Carbohydrate sulfotransferase 8 / Mus musculus Q8BQ86
- Carbonic anhydrase-related protein 11 / Mus musculus O70354
- Carboxypeptidase E / Mus musculus Q00493
- Carboxypeptidase M / Mus musculus Q80V42
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- CD180 antigen / Mus musculus Q62192
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus Q8VBZ3
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus Q8BXA5
- Clusterin / Mus musculus Q06890
- Contactin-1 / Mus musculus P12960
- Contactin-3 / Mus musculus Q07409
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- CUB and sushi domain-containing protein 1 / Mus musculus Q923L3
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus F6VAN0
- Cystatin-C / Mus musculus P21460
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus O35598
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus Q9R1V7
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus P46978
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus Q3TDQ1
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus Q4VA61
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus Q9R1E6
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Ephrin-A1 / Mus musculus P52793
- ER membrane protein complex subunit 1 / Mus musculus Q8C7X2
- ER membrane protein complex subunit 10 / Mus musculus Q3TAS6
- Erlin-1 / Mus musculus Q91X78
- Erlin-2 / Mus musculus Q8BFZ9
- ERO1-like protein alpha / Mus musculus Q8R180
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Galactose-3-O-sulfotransferase 3 / Mus musculus P61315
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus Q9CW73
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus P26048
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus Q8BHJ7
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glia-derived nexin / Mus musculus Q07235
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Glutamate receptor 4 / Mus musculus Q9Z2W8
- Glutamate receptor ionotropic, kainate 2 / Mus musculus P39087
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- Glycine receptor subunit beta / Mus musculus P48168
- GPI inositol-deacylase / Mus musculus Q3UUQ7
- Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus Q3UDW8
- Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus Q9QYK5
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Insulin receptor / Mus musculus P15208
- Integrin alpha-1 / Mus musculus Q3V3R4
- Integrin alpha-M / Mus musculus P05555
- Integrin alpha-V / Mus musculus P43406
- Integrin beta-1 / Mus musculus P09055
- Integrin beta-2 / Mus musculus P11835
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus P59823
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2 of Catenin delta-1 / Mus musculus P30999-2
- Isoform 2 of Integrin alpha-3 / Mus musculus Q62470-2
- Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus Q2VLH6-2
- Isoform 2 of Teneurin-4 / Mus musculus Q3UHK6-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Kinesin-like protein / Mus musculus P33173
- Lactadherin / Mus musculus P21956
- Laminin subunit alpha-1 / Mus musculus P19137
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit alpha-5 / Mus musculus Q61001
- Leucine rich repeat protein 2, neuronal / Mus musculus Q6PHP6
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus Q9D1T0
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus Q3URE9
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus Q6GQU6
- Leucine-rich repeat-containing protein 24 / Mus musculus Q8BHA1
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal protective protein / Mus musculus P16675
- Lysosome membrane protein 2 / Mus musculus O35114
- Lysosome-associated membrane glycoprotein 5 / Mus musculus Q9D387
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus Q0PMG2
- Membralin / Mus musculus Q8CIV2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus P60882
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus Q6S5C2
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus Q61477
- Neuroendocrine convertase 2 / Mus musculus P21661
- Neurofascin / Mus musculus Q810U3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal pentraxin-1 / Mus musculus Q62443
- Neuroplastin / Mus musculus P97300
- Nicastrin / Mus musculus P57716
- Niemann-Pick C1 protein / Mus musculus O35604
- Nodal modulator 1 / Mus musculus Q6GQT9
- Noelin / Mus musculus O88998
- Nuclear pore membrane glycoprotein 210 / Mus musculus Q9QY81
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus Q8BGT0
- P2X purinoceptor 4 / Mus musculus Q9JJX6
- P2X purinoceptor 7 / Mus musculus Q9Z1M0
- Phosphatidylcholine-sterol acyltransferase / Mus musculus P16301
- Phospholipase D3 / Mus musculus O35405
- Platelet glycoprotein 4 / Mus musculus Q08857
- Plexin-A2 / Mus musculus P70207
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus Q9R0E2
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus Q9R0E1
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin g/h synthase 2 / Mus musculus Q05769
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Protein FAM234B / Mus musculus Q8BYI8
- Protein kinase C-binding protein NELL2 / Mus musculus Q61220
- Protein O-glucosyltransferase 1 / Mus musculus Q8BYB9
- Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus Q8BW41
- Protein OS-9 / Mus musculus Q8K2C7
- Protein sel-1 homolog 1 / Mus musculus Q9Z2G6
- Protocadherin Fat 1 / Mus musculus F2Z4A3
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Reelin / Mus musculus Q60841
- Semaphorin-3E / Mus musculus P70275
- Semaphorin-4D / Mus musculus O09126
- Semaphorin-4F / Mus musculus Q9Z123
- Semaphorin-7A / Mus musculus Q9QUR8
- Serotransferrin / Mus musculus Q921I1
- Serpin H1 / Mus musculus P19324
- Serum paraoxonase/arylesterase 2 / Mus musculus Q62086
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus Q64689
- Sialic acid-binding Ig-like lectin / Mus musculus B7ZMQ5
- Sodium channel protein type 1 subunit alpha / Mus musculus A2APX8
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus Q8BJI1
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Solute carrier family 12 member 5 / Mus musculus Q91V14
- Sortilin / Mus musculus Q6PHU5
- Sortilin-related receptor / Mus musculus O88307
- SPARC / Mus musculus P07214
- SPARC-like protein 1 / Mus musculus P70663
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- T-cell immunomodulatory protein / Mus musculus Q99KW9
- Teneurin-2 / Mus musculus Q9WTS5
- Testican-2 / Mus musculus Q9ER58
- Tetraspanin-3 / Mus musculus Q9QY33
- Thioredoxin domain-containing protein 15 / Mus musculus Q6P6J9
- Thy-1 membrane glycoprotein / Mus musculus P01831
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Torsin-1B / Mus musculus Q9ER41
- Translocon-associated protein subunit alpha / Mus musculus Q9CY50
- Translocon-associated protein subunit beta / Mus musculus Q9CPW5
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus Q8BG19
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane protein 106B / Mus musculus Q80X71
- Transmembrane protein 131 / Mus musculus O70472
- Transmembrane protein 158 / Mus musculus Q6F5E0
- Transmembrane protein 181a / Mus musculus Q3U3W2
- Transmembrane protein 8B / Mus musculus B1AWJ4
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Tyrosine-protein kinase Mer / Mus musculus Q60805
- Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus Q9D906
- UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus Q920V1
- Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- UPF0577 protein KIAA1324-like homolog / Mus musculus Q3UZV7
- V-type proton ATPase subunit S1 / Mus musculus Q9R1Q9
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- VPS10 domain-containing receptor SorCS1 / Mus musculus Q9JLC4
- Zinc transporter ZIP12 / Mus musculus Q5FWH7
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 P10761 Q62005
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
- Coagulation factor VIII / Sus scrofa P12263
- Ascorbate oxidase / Acremonium sp
- Hemocyanin / Androctonus australis
- Uncharacterized protein from Fruit / Actinidia chinensis
- Uncharacterized protein from Tuber / Apium graveolens var. oulce
- Art v II / Artemisia vulgaris
- Uncharacterized protein from Root / Daucus carota
- Uncharacterized protein from Fruit / Lycopersicon esculentum
- Ribonuclease s-6 / Nicotiana alata Q40379
- Uncharacterized protein from Tuber / Solanum tuberosum
- Uncharacterized protein from Ovary / Asterias rubens
- Immunoglobulin gamma / Columba livia
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin gamma / Gallus gallus
- Immunoglobulin y / Gallus gallus
- Gp273 / Unio elongatus
- Uncharacterized protein from Whole Plant / Physomitrella patens
- Uncharacterized protein from Seed / Fagopyrum esculentum
- Acetylcholine receptor protein / Torpedo californica P02718 P02712 P02714 P02710
- Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Uncharacterized protein from Whole Organism / Caenorhabditis elegans
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein from Whole Organism / Trichinella spiralis
- Alpha-galactosidase a / Aspergillus niger P28351
- Alpha-glucosidase / Aspergillus niger P56526
- Endopolygalacturonase II / Aspergillus niger P26214
- Uncharacterized protein from Undefined tissue / Agaricus bisporus
- Uncharacterized protein from Cell Surface / Aedes aegypti
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Apisin / Apis mellifera O18330
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Membrane glycoproteins / Bombyx mori
- Sex-specific storage-protein 2 / Bombyx mori P20613
- Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei P26334
- Variant surface glycoprotein mitat 1.4a / Trypansoma brucei P02896
- Uncharacterized protein from Fruit / Persea americana
- Cobra venom factor / Naja kaouthia Q91132
- Uncharacterized protein from Whole Cell / Kinetoplastids
- Uncharacterized protein from Tuber / Allium cepa
- Uncharacterized protein from Undefined tissue / Asparagus officinalis
- Uncharacterized protein from Fruit / Musa acuminata
- Alpha-amylase / Oryza sativa P17654
- Vitellogenin / Cherax quadricarinatus Q9GSG2
- Hemocyanin / Pontastacus leptodactylus P83180
- Knob protein gp70 / Friend mink cell focus-forming virus
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus P03393
- Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) P03393
- Gp120 / Human immunodeficiency virus
- Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (bh8 isolate) P04582
- Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Uncharacterized protein from Leaf / Arabidopsis thaliana
- Uncharacterized protein from Leaf / Arabidopsis thaliana
- Uncharacterized protein from Floret / Brassica oleracea var. botrytis
- Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis Q6YDN9
- Alpha-mannosidase / Canavalia ensiformis C0HJB3
- Uncharacterized protein from Fruit / Carica papaya
- Uncharacterized protein from Leaf / Carica papaya
- Uncharacterized protein from Fruit / Citrus sinensis
- Uncharacterized protein from Seed / Corylus avellana
- Uncharacterized protein from Fruit / Fragaria x ananassa
- Lectin / Glycine max P05046
- Uncharacterized protein from Undefined tissue / Glycine max
- Uncharacterized protein from Seed / Juglans regia
- Uncharacterized protein from Fruit / Malus domestica var. golden delicious
- Uncharacterized protein from Seed / Phaseolus lunatus
- Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris P02873
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Phaseolin, alpha-type / Phaseolus vulgaris P07219
- Phaseolin, beta-type / Phaseolus vulgaris P02853
- Uncharacterized protein from Seed / Phaseolus vulgaris
- Uncharacterized protein from Seed / Pistacia vera
- Uncharacterized protein from Seed / Pisum sativum
- Uncharacterized protein from Seed / Prunus dulcis var. sativa
- Uncharacterized protein from Fruit / Pyrus communis var. williams
- Uncharacterized protein from Endosperm / Ricinus communis
- Uncharacterized protein from Seed / Vigna radiata var. radiata
- Invertase / Saccharomyces cerevisiae
- Invertase 2 / Saccharomyces cerevisiae P00724
- Invertase [secreted form] / Saccharomyces cerevisiae
- Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Uncharacterized protein from Whole Organism / Schistosoma mansoni
- Hemoglobin extracellular / Riftia pachyptila
Protein
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Coelomic Fluid (UBERON_0036217)
- Electric Organ (UBERON_0006869)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Kidney (UBERON_0002113) NRK (CVCL_3758) Fibroblast (CL_0000057)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048) Mv1Lu (CVCL_0593)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) Lec1 (CVCL_3440)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966)
- Royal Jelly
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BW5147 (CVCL_3896) Leukocyte (CL_0000738)
- BW5147.PHAR2.7 (CVCL_VT60) Leukocyte (CL_0000738)
- CE (CVCL_6D96)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LSTM-AA-20A (CVCL_Z354) Cell Surface (GO_0009986)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- Rat1 (CVCL_0492)
- SPC-Mb-92-C6 (CVCL_VT62)
- Delipidated Cell
- Egg Cell Jelly Coat
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Cotyledon (BTO_0000300)
- Endosperm (BTO_0000390)
- Floret (BTO_0000468)
- Fruit (BTO_0000486)
- Leaf (BTO_0000713)
- Pollen (BTO_0001097)
- Root (BTO_0001188)
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Tuber (BTO_0001400)
- Low-Density Lipoprotein Particle (GO_0034362)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(?1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)Man(a1-3)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 3677
Reported structure
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Erythroleukemia with associated Polycythemia
- Healthy
- Hypercholesterolemia, Familial (DOID:13810)
- Hyperimmune condition
- Leukemia, Acute lymphoblastic (DOID:9952)
- Lymphoma (DOID:0060058)
- Prostate cancer (DOID:10283)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Structural characterization of the N-glycan moiety and site of glycosylation in vitellogenin from the decapod crustacean Cherax quadricarinatus. (2004 - Khalaila I, Peter-Katalinic J, Tsang C, Radcliffe CM, Aflalo ED, Harvey DJ, Dwek RA, Rudd PM, Sagi A) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
- N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A. (2003 - Henriksson H, Denman SE, Campuzano ID, Ademark P, Master ER, Teeri TT, Brumer H) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Tandem mass spectrometry of ribonuclease A and B: N-linked glycosylation site analysis of whole protein ions (2002 - Reid, Stephenson, McLuckey) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- Characterization of glycosylated variants of beta-lactoglobulin expressed in Pichia pastoris (2001 - Kalidas, Joshi, Batt) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- N-linked oligosaccharides of cobra venom factor contain novel alpha(1-3)galactosylated Le(x) structures. (2001 - Gowda DC, Glushka J, van-Halbeek H , Thotakura RN, Bredehorst R, Vogel C-W) / Status : Reviewed
- Structural characterization of the N-glycans of gp273, the ligand for sperm-egg interaction in the mollusc bivalve Unio elongatulus. (2001 - Di Patrizi L, Capone A, Focarelli R, Rosati F, Gallego RG, Gerwig GJ, Vliegenthart JF) / Status : Reviewed
- Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- The nematode Caenorhabditis elegans synthesizes unusual O-linked glycans: identification of glucose-substituted mucin-type O-glycans and short chondroitin-like oligosaccharides (2001 - Guerardel, Balanzino, Maes, Leroy, Coddeville, Oriol, Strecker) / Status : Reviewed
- In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
- The N-glycans of jack bean alpha-mannosidase. Structure, topology and function. (1999 - Kimura Y, Hess D, Sturm A) / Status : Reviewed
- Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
- Characterization of N-glycans from Arabidopsis. Application to a fucose-deficient mutant. (1999 - Rayon C, Cabanes-Macheteau M, Loutelier-Bourhis C, Salliot-Maire I, Lemoine J, Reiter W, Lerouge P, Faye L) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
- Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- N-linked sugar chains of 350-kDa royal jelly glycoprotein. (1995 - Kimura Y, Washino N, Yonekura M) / Status : Reviewed
- Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Novel structures of N-linked high-mannose type oligosaccharides containing alpha-D-galactofuranosyl linkages in Aspergillus niger alpha-D-glucosidase. (1994 - Takayanagi T, Kimura A, Chiba S, Ajisaka K) / Status : Reviewed
- Glycosylation of glycoprotein 55 encoded by the anaemia-inducing strain of Friend spleen focus-forming virus. (1994 - Volker J, Geyer H, Geyer R) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- A detailed structural characterization of ribonuclease B oligosaccharides by 1H NMR spectroscopy and mass spectrometry. (1994 - Fu D, Chen L, O'Neill R) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Site-specific N-glycosylation and oligosaccharide structures of recombinant HIV-1 gp120 derived from a baculovirus expression system. (1993 - Yeh J, Seals J, Murphy C, van Halbeek H, Cummings R) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- The carbohydrate structures of Trypanosoma brucei brucei MITat 1.6 variant surface glycoprotein. A re-investigation of the C-terminal glycan. (1993 - Strang A, Allen A, Holder A, van Halbeek H) / Status : Reviewed
- Isolation of oligomannose-type glycans from bean glycoproteins. (1993 - Lu Y, Ye J, Wold F) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Novel N-linked oligo-mannose type oligosaccharides containing an alpha-D-galactofuranosyl linkage found in alpha-D-galactosidase from Aspergillus niger. (1992 - Takayanagi T, Kushida K, Idonuma K, Ajisaka K) / Status : Reviewed
- Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
- Structural analysis of the glycoprotein allergen Art v II from the pollen of mugwort (Artemisia vulgaris L.). (1991 - Nilsen B, Sletten K, Paulsen B, O'Neill M, van Halbeek H) / Status : Reviewed
- The conformational effects of N-glycosylation on the tailpiece from serum IgM. (1991 - Wormald M, Wooten E, Bazzo R, Edge C, Feinstein A, Rademacher T, Dwek R) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- Structure and biosynthesis of the xylose-containing carbohydrate moiety of rice alpha-amylase. (1990 - Hayashi M, Tsuru A, Mitsui T, Takahashi N, Hanzawa H, Arata Y, Akazawa T) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Structures of the asparagine-linked sugar chain of glucose transporter from human erythrocytes. (1990 - Endo T, Kasahara M, Kobata A) / Status : Reviewed
- Characterisation of the asparagine-linked oligosaccharides from Trypanosoma brucei type-I variant surface glycoproteins. (1990 - Zamze SE, Wooten EW, Ashford DA, Ferguson MA, Dwek RA, Rademacher TW) / Status : Reviewed
- Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
- Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
- Characterization of the high mannose asparagine-linked oligosaccharides synthesized by Schistosoma mansoni adult male worms. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Structure, position, and biosynthesis of the high mannose and the complex oligosaccharide side chains of the bean storage protein phaseolin. (1987 - Sturm A, Van Kuik J, Vliegenthart J, Chrispeels M) / Status : Reviewed
- Characterization of N-linked gluco-oligomannose type of carbohydrate chains of glycoproteins from the ovary of the starfish Asterias rubens (L.). (1987 - De Waard P, Kamerling JP, Van Halbeek H, Vliegenthart JF, Broertjes JJ) / Status : Reviewed
- Primary structure of the oligosaccharide moiety of hemocyanin from the scorpion Androctonus australis. (1986 - Debeire P, Montreuil J, Goyffon M, Van Kuik AJ, Halbeek HV, Vliegenthart JFG) / Status : Reviewed
- High-mannose structure of apolipoprotein-B from low-density lipoproteins of human plasma. (1985 - Vauhkonen M, Viitala J, Parkkinen J, Rauvala H) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
- Primary structure of the carbohydrate chain of soybean agglutinin. A reinvestigation by high resolution 1H NMR spectroscopy (1981 - Dorland L, van Halbeek H, Vliegenthart JFG, Lis H, Sharon N) / Status : Reviewed
- Isolation and characterization of mosquito cell membrane glycoproteins. (1981 - Butters T, Hughes R) / Status : Reviewed
- Soybean agglutinin--a plant glycoprotein. Structure of the carboxydrate unit. (1978 - Lis H, Sharon N) / Status : Reviewed
Reference
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Acid ceramidase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Agrin / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-2-macroglobulin-like protein 1 / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Amphoterin-induced protein 2 / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Antithrombin-III / Homo sapiens
-
Apolipoprotein b-100 / Homo sapiens
- Undefined site
- Asn-185
- Apolipoprotein d / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- ATP-binding cassette sub-family A member 1 / Homo sapiens
- ATP-binding cassette sub-family A member 2 / Homo sapiens
- ATP-binding cassette sub-family A member 7 / Homo sapiens
- Attractin / Homo sapiens
- Basigin / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Beta-hexosaminidase subunit alpha / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
- C-type mannose receptor 2 / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
-
Cadherin-5 / Homo sapiens
- Undefined site
- Calcium-activated chloride channel regulator 2 / Homo sapiens
- Calponin-3 / Homo sapiens
- Calreticulin / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cartilage oligomeric matrix protein / Homo sapiens
- Cartilage-associated protein / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- CD82 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Choline transporter-like protein 4 / Homo sapiens
- Chondroitin sulfate glucuronyltransferase / Homo sapiens
- Cleft lip and palate transmembrane protein 1 / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Coiled-coil domain-containing protein 80 / Homo sapiens
- Collagen alpha-1(I) chain / Homo sapiens
- Collagen alpha-1(III) chain / Homo sapiens
- Collagen alpha-1(V) chain / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(I) chain / Homo sapiens
- Collagen alpha-2(V) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Complement C2 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- CUB domain-containing protein 1 / Homo sapiens
- Cytokine receptor-like factor 1 / Homo sapiens
- Deoxyribonuclease-2-alpha / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Dystroglycan / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens
- Endoplasmin / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens
- ER membrane protein complex subunit 1 / Homo sapiens
- ER membrane protein complex subunit 10 / Homo sapiens
- Erlin-1 / Homo sapiens
- Erlin-2 / Homo sapiens
- ERO1-like protein alpha / Homo sapiens
- Extracellular sulfatase Sulf-1 / Homo sapiens
- Extracellular sulfatase Sulf-2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroblast growth factor receptor 1 / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucoside xylosyltransferase 1 / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- GPI ethanolamine phosphate transferase 1 / Homo sapiens
- Heat shock 70 kDa protein 13 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
- HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, alpha chain E / Homo sapiens
- HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Hyaluronidase-4 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin epsilon chain c region / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
- Integrin alpha-1 / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-6 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin alpha-X / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Integrin beta-3 / Homo sapiens
- Integrin beta-5 / Homo sapiens
- Integrin beta-6 / Homo sapiens
- Interferon-gamma receptor alpha chain / Homo sapiens
- Interleukin-6 receptor subunit beta / Homo sapiens
- KDEL motif-containing protein 2 / Homo sapiens
- Lactadherin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit beta-2 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Lipase member J / Homo sapiens
- Lipase member K / Homo sapiens
- Liver carboxylesterase 1 / Homo sapiens
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens
- Low-density lipoprotein receptor-related protein 5 / Homo sapiens
- Lumican / Homo sapiens
- Lymphoid enhancer-binding factor 1 / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrosialin / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Mammaglobin-B / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Melanoma inhibitory activity protein 3 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Monoacylglycerol lipase ABHD12 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myelin protein zero-like protein 2 / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neurofascin / Homo sapiens
- Neuroplastin / Homo sapiens
- Neutral amino acid transporter B(0) / Homo sapiens
- Nicalin / Homo sapiens
- Nicastrin / Homo sapiens
- Nodal modulator 1 / Homo sapiens
- Nodal modulator 2 / Homo sapiens
- Nodal modulator 3 / Homo sapiens
- Nuclear envelope integral membrane protein 1 / Homo sapiens
- Nuclear pore membrane glycoprotein 210 / Homo sapiens
- Nucleolar protein 56 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens
- P2X purinoceptor 7 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- PI-PLC X domain-containing protein 3 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
- Platelet glycoprotein 4 / Homo sapiens
- Platelet-derived growth factor subunit b / Homo sapiens
- Plexin-B2 / Homo sapiens
- Plexin-c1 / Homo sapiens
- Plexin-D1 / Homo sapiens
- Podocalyxin / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Probable C-mannosyltransferase DPY19L4 / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
- Progranulin / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl 3-hydroxylase 1 / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Prosalusin / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin G/H synthase 1 / Homo sapiens
- Prostaglandin G/H synthase 2 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein CREG1 / Homo sapiens
- Protein O-mannosyl-transferase 2 / Homo sapiens
- Protein OS-9 / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Protein turtle homolog A / Homo sapiens
- Protein Wnt-5a / Homo sapiens
- Protocadherin alpha-12 / Homo sapiens
- Protocadherin beta-10 / Homo sapiens
- Protocadherin beta-11 / Homo sapiens
- Protocadherin beta-14 / Homo sapiens
- Protocadherin beta-15 / Homo sapiens
- Protocadherin beta-16 / Homo sapiens
- Protocadherin beta-2 / Homo sapiens
- Protocadherin beta-3 / Homo sapiens
- Protocadherin beta-5 / Homo sapiens
- Protocadherin beta-8 / Homo sapiens
- Protocadherin beta-9 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Recombinant plasminogen - [r580e] / Homo sapiens
- Undefined site
-
Recombinant plasminogen - [r580s] / Homo sapiens
- Undefined site
- Rho-related BTB domain-containing protein 3 / Homo sapiens
- Seipin / Homo sapiens
- Semaphorin-4D / Homo sapiens
- Serine--tRNA ligase, cytoplasmic / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sialate O-acetylesterase / Homo sapiens
- Sialomucin core protein 24 / Homo sapiens
- Signal transducer CD24 / Homo sapiens
- Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens
- Sodium channel protein type 4 subunit alpha / Homo sapiens
- Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Solute carrier family 12 member 7 / Homo sapiens
-
Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens
- Undefined site
- Sortilin / Homo sapiens
- Sortilin-related receptor / Homo sapiens
- Sparc / Homo sapiens
- Stromal interaction molecule 1 / Homo sapiens
- SUN domain-containing ossification factor / Homo sapiens
- Superoxide dismutase [Cu-Zn] / Homo sapiens
- Suppressor of tumorigenicity 14 protein / Homo sapiens
- Synaptonemal complex protein SC65 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tapasin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Tetratricopeptide repeat protein 17 / Homo sapiens
- Thioredoxin domain-containing protein 15 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Thrombospondin-3 / Homo sapiens
- Thyroglobulin / Homo sapiens
- TM2 domain-containing protein 1 / Homo sapiens
- TM2 domain-containing protein 3 / Homo sapiens
- Toll-like receptor 2 / Homo sapiens
- Torsin-1A / Homo sapiens
- Torsin-1B / Homo sapiens
- Torsin-2A / Homo sapiens
- Transcobalamin-1 / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Transforming growth factor beta-3 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Transmembrane protein 131 / Homo sapiens
- Transmembrane protein 2 / Homo sapiens
- Transmembrane protein 231 / Homo sapiens
- Transmembrane protein 8A / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- Twisted gastrulation protein homolog 1 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
-
Uncharacterized protein from Serum / Homo sapiens
- Undefined site
- UPF0577 protein KIAA1324 / Homo sapiens
- Uromodulin / Homo sapiens
- Uroplakin-3b-like protein / Homo sapiens
- V-type proton ATPase subunit e 1 / Homo sapiens
- V-type proton ATPase subunit S1 / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc transporter ZIP6 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
-
Beta-lactoglobulin / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Ribonuclease pancreatic [b] / Bos taurus
- Undefined site
- Asn-60
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Adhesion G protein-coupled receptor F5 / Mus musculus
- Alpha-(1,3)-fucosyltransferase 11 / Mus musculus
- Alpha-L-iduronidase / Mus musculus
- ATP-binding cassette sub-family A member 1 / Mus musculus
- ATP-binding cassette sub-family A member 2 / Mus musculus
- ATP-binding cassette sub-family A member 7 / Mus musculus
- ATPase family AAA domain-containing protein 1 / Mus musculus
- Attractin / Mus musculus
- Basigin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Beta-hexosaminidase subunit alpha / Mus musculus
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
- Bone morphogenetic protein receptor type-2 / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-10 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Calsyntenin-2 / Mus musculus
- Carbohydrate sulfotransferase 8 / Mus musculus
- Carbonic anhydrase-related protein 11 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Carboxypeptidase M / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- CD180 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
- Clusterin / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-3 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- CUB and sushi domain-containing protein 1 / Mus musculus
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus
- Cystatin-C / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Ephrin-A1 / Mus musculus
- ER membrane protein complex subunit 1 / Mus musculus
- ER membrane protein complex subunit 10 / Mus musculus
- Erlin-1 / Mus musculus
- Erlin-2 / Mus musculus
- ERO1-like protein alpha / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Galactose-3-O-sulfotransferase 3 / Mus musculus
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glia-derived nexin / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor 4 / Mus musculus
- Glutamate receptor ionotropic, kainate 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- Glycine receptor subunit beta / Mus musculus
- GPI inositol-deacylase / Mus musculus
- Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus
- Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Insulin receptor / Mus musculus
- Integrin alpha-1 / Mus musculus
- Integrin alpha-M / Mus musculus
- Integrin alpha-V / Mus musculus
- Integrin beta-1 / Mus musculus
- Integrin beta-2 / Mus musculus
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2 of Catenin delta-1 / Mus musculus
- Isoform 2 of Integrin alpha-3 / Mus musculus
- Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus
- Isoform 2 of Teneurin-4 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Kinesin-like protein / Mus musculus
- Lactadherin / Mus musculus
- Laminin subunit alpha-1 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit alpha-5 / Mus musculus
- Leucine rich repeat protein 2, neuronal / Mus musculus
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus
- Leucine-rich repeat-containing protein 24 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal protective protein / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 5 / Mus musculus
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus
- Membralin / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus
- Neuroendocrine convertase 2 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Neuroplastin / Mus musculus
- Nicastrin / Mus musculus
- Niemann-Pick C1 protein / Mus musculus
- Nodal modulator 1 / Mus musculus
- Noelin / Mus musculus
- Nuclear pore membrane glycoprotein 210 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus
- P2X purinoceptor 4 / Mus musculus
- P2X purinoceptor 7 / Mus musculus
- Phosphatidylcholine-sterol acyltransferase / Mus musculus
- Phospholipase D3 / Mus musculus
- Platelet glycoprotein 4 / Mus musculus
- Plexin-A2 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin g/h synthase 2 / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protein FAM234B / Mus musculus
- Protein kinase C-binding protein NELL2 / Mus musculus
- Protein O-glucosyltransferase 1 / Mus musculus
- Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
- Protein OS-9 / Mus musculus
- Protein sel-1 homolog 1 / Mus musculus
- Protocadherin Fat 1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Reelin / Mus musculus
- Semaphorin-3E / Mus musculus
- Semaphorin-4D / Mus musculus
- Semaphorin-4F / Mus musculus
- Semaphorin-7A / Mus musculus
- Serotransferrin / Mus musculus
- Serpin H1 / Mus musculus
- Serum paraoxonase/arylesterase 2 / Mus musculus
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus
- Sialic acid-binding Ig-like lectin / Mus musculus
- Sodium channel protein type 1 subunit alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 5 / Mus musculus
- Sortilin / Mus musculus
- Sortilin-related receptor / Mus musculus
- SPARC / Mus musculus
- SPARC-like protein 1 / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- T-cell immunomodulatory protein / Mus musculus
- Teneurin-2 / Mus musculus
- Testican-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thioredoxin domain-containing protein 15 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Torsin-1B / Mus musculus
- Translocon-associated protein subunit alpha / Mus musculus
- Translocon-associated protein subunit beta / Mus musculus
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane protein 106B / Mus musculus
- Transmembrane protein 131 / Mus musculus
- Transmembrane protein 158 / Mus musculus
- Transmembrane protein 181a / Mus musculus
- Transmembrane protein 8B / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Tyrosine-protein kinase Mer / Mus musculus
- Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus
- UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus
-
Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- Undefined site
- UPF0577 protein KIAA1324-like homolog / Mus musculus
- V-type proton ATPase subunit S1 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- Zinc transporter ZIP12 / Mus musculus
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Ascorbate oxidase / Acremonium sp
- Undefined site
-
Hemocyanin / Androctonus australis
- Undefined site
-
Uncharacterized protein from Fruit / Actinidia chinensis
- Undefined site
-
Uncharacterized protein from Tuber / Apium graveolens var. oulce
- Undefined site
-
Art v II / Artemisia vulgaris
- Undefined site
-
Uncharacterized protein from Root / Daucus carota
- Undefined site
-
Uncharacterized protein from Fruit / Lycopersicon esculentum
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Uncharacterized protein from Tuber / Solanum tuberosum
- Undefined site
-
Uncharacterized protein from Ovary / Asterias rubens
- Undefined site
-
Immunoglobulin gamma / Columba livia
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Gp273 / Unio elongatus
- Undefined site
-
Uncharacterized protein from Whole Plant / Physomitrella patens
- Undefined site
-
Uncharacterized protein from Seed / Fagopyrum esculentum
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein from Whole Organism / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
-
Alpha-galactosidase a / Aspergillus niger
- Undefined site
-
Alpha-glucosidase / Aspergillus niger
- Undefined site
-
Endopolygalacturonase II / Aspergillus niger
- Undefined site
-
Uncharacterized protein from Undefined tissue / Agaricus bisporus
- Undefined site
-
Uncharacterized protein from Cell Surface / Aedes aegypti
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Apisin / Apis mellifera
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Sex-specific storage-protein 2 / Bombyx mori
- Undefined site
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Undefined site
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei
-
Variant surface glycoprotein mitat 1.4a / Trypansoma brucei
- Undefined site
-
Uncharacterized protein from Fruit / Persea americana
- Undefined site
-
Cobra venom factor / Naja kaouthia
- Undefined site
-
Uncharacterized protein from Whole Cell / Kinetoplastids
- Undefined site
-
Uncharacterized protein from Tuber / Allium cepa
- Undefined site
-
Uncharacterized protein from Undefined tissue / Asparagus officinalis
- Undefined site
-
Uncharacterized protein from Fruit / Musa acuminata
- Undefined site
-
Alpha-amylase / Oryza sativa
- Undefined site
-
Vitellogenin / Cherax quadricarinatus
- Undefined site
-
Hemocyanin / Pontastacus leptodactylus
- Undefined site
-
Knob protein gp70 / Friend mink cell focus-forming virus
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
- Undefined site
-
Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
- Undefined site
-
Gp120 / Human immunodeficiency virus
- Undefined site
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (bh8 isolate)
- Undefined site
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Uncharacterized protein from Leaf / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein from Leaf / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein from Floret / Brassica oleracea var. botrytis
- Undefined site
-
Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
- Undefined site
-
Alpha-mannosidase / Canavalia ensiformis
- Undefined site
-
Uncharacterized protein from Fruit / Carica papaya
- Undefined site
-
Uncharacterized protein from Leaf / Carica papaya
- Undefined site
-
Uncharacterized protein from Fruit / Citrus sinensis
- Undefined site
-
Uncharacterized protein from Seed / Corylus avellana
- Undefined site
-
Uncharacterized protein from Fruit / Fragaria x ananassa
- Undefined site
-
Lectin / Glycine max
- Undefined site
-
Uncharacterized protein from Undefined tissue / Glycine max
- Undefined site
-
Uncharacterized protein from Seed / Juglans regia
- Undefined site
-
Uncharacterized protein from Fruit / Malus domestica var. golden delicious
- Undefined site
-
Uncharacterized protein from Seed / Phaseolus lunatus
- Undefined site
-
Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
- Phaseolin, alpha-type / Phaseolus vulgaris
- Phaseolin, beta-type / Phaseolus vulgaris
-
Uncharacterized protein from Seed / Phaseolus vulgaris
- Undefined site
-
Uncharacterized protein from Seed / Pistacia vera
- Undefined site
-
Uncharacterized protein from Seed / Pisum sativum
- Undefined site
-
Uncharacterized protein from Seed / Prunus dulcis var. sativa
- Undefined site
-
Uncharacterized protein from Fruit / Pyrus communis var. williams
- Undefined site
-
Uncharacterized protein from Endosperm / Ricinus communis
- Undefined site
-
Uncharacterized protein from Seed / Vigna radiata var. radiata
- Undefined site
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
Invertase [secreted form] / Saccharomyces cerevisiae
- Undefined site
-
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- Asn-424
-
Uncharacterized protein from Whole Organism / Schistosoma mansoni
- Undefined site
-
Hemoglobin extracellular / Riftia pachyptila
- Undefined site
Reported glycosite
- IWIPVNITWADIEDRDGR (18aa)
- HIVFWNSSNPK (11aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- LVPVPITNATLDR (13aa)
- LVPVPITNATLDQITGK (17aa)
- CIEKEVNK (8aa)
- NITQIVGHSGCEAK (14aa)
- VIEAVNGTDAR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- ADVGGEAAGTAINHSHMLLQR (21aa)
- AELSNHTRPVILVPGCLGNR (20aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- VNFTIEASEGCYR (13aa)
- IYIPLNK (7aa)
- KIYIPLNK (8aa)
- KIYIPINK (8aa)
- GLFPAILNLATNAHISANATCGEK (24aa)
- IYIPINK (7aa)
- NNSDISSTR (9aa)
- FECHFFNGTER (11aa)
- FECHFFNGTER (11aa)
- FECHFFNGTER (11aa)
- CGWCTNSTFLQEGMPTSAR (19aa)
- SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
- EIFVANGTQGK (11aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- WYSAGLASNSSWFR (14aa)
- DVNCSVMGPQEK (12aa)
- TGFYGENCSTPEFLTR (16aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FVGTPEVNQTTIYQR (15aa)
- LLNATHQIGCQSSISGDTGVIHVVEKEEDLK (31aa)
- ISHENGTILCSK (12aa)
- GLFPAVLNLASNALITTNATCGEK (24aa)
- QVPGLHNGTK (10aa)
- SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
- YETTNK (6aa)
- LRPLFNK (7aa)
- YFYIQAVNSEGQNITR (16aa)
- WKLNK (5aa)
- QGNASDVILR (10aa)
- TDDEVVQREEEAIQLDGLNASQIR (24aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- HAPDIPDDSTDNITIFTR (18aa)
- SAEFFNYTVR (10aa)
- SNAPIVNVTIYYEAICGGCR (20aa)
- EERPINASAIK (11aa)
- ATTLDDNGTMLFFKGE (16aa)
- FTECCHEERPLNTSALK (17aa)
- CIQANYSIMENGK (13aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- TGYSGPNCTIPGIWTWIR (18aa)
- YGENNSISVEGFR (13aa)
- QCFLNQSHR (9aa)
- AIGFENATQAIGR (13aa)
- NSTGAYCGMGENK (13aa)
- NETIWYIK (8aa)
- SNVSVEENVILEKPSHVELK (20aa)
- FAAPHTYNYSALLVDPASHTLYVGAR (26aa)
- GQTEIQVNCPPAVTENK (17aa)
- GAAAPSAPHWNETAEK (16aa)
- AGPEEAPAAPCNISVQR (17aa)
- NQNGTFK (7aa)
- TVVAPSTEGGLNLTSTFLR (19aa)
- NATSYPPMCTQDPK (14aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- DNATEEEILVYLEK (14aa)
- NYSDTPPTSK (10aa)
- WLATQTMNFTGQLGAGIR (18aa)
- EQYTIINR (8aa)
- EASNHSSGAGLVQINK (16aa)
- ENTSDPSIVIAFGR (14aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- AHLNNLSFPIR (11aa)
- KEDALNETR (9aa)
- SNTSQIAFIIYNDQPPQPSK (20aa)
- LPADCIDCTTNFSCTYGK (18aa)
- NCSAAPQPEPAAGLASYPELR (21aa)
- NVTADK (6aa)
- TDCDSSTTSICSFPVANVSITK (22aa)
- IAPASNVSHTVVIRPIK (17aa)
- IAPASNVSH (9aa)
- YEFCPFHNVTQHEQTFR (17aa)
- IAPASNVSHTVVLRPLK (17aa)
- IAPASNVSHTVVIR (14aa)
- TLGVLADEDNTLQQNSSSR (19aa)
- VVWNGSR (7aa)
- QDQCIYNTTYINVQR (15aa)
- IVGGPVAGGDPNQTIR (16aa)
- TENLDVIVNISDTESWGQHVQK (22aa)
- TAIWVATDHNMDNTSTVIR (19aa)
- NSSDIVQIAPQSLILK (16aa)
- YPTPGEAPGVVGNFNK (16aa)
- IHGQELPFEAVVLNK (15aa)
- SQTNLTDCPFHDQPHLMR (18aa)
- TCNASQGFK (9aa)
- TCDWIPKPNMSASCK (15aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- GHTITINFTR (10aa)
- SNYTPITNVPPEVTVITNSPVEIR (24aa)
- SLWNMSAANNNIK (13aa)
- VQNMSQSIEVLDR (13aa)
- ATTLGVSSDSPGTTTLAQQVSGPVNTTVAR (30aa)
- EGDLLNQTK (9aa)
- TFYWDFYTNR (10aa)
- NYTADYDK (8aa)
- NYTADYDK (8aa)
- IEVVNFLVPNAVYDIVKNYTADYDK (25aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- NYTADYDKTLIFNK (14aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- IVYNHSSGR (9aa)
- DIVEYYNDSNGSHVIQGR (18aa)
- AVIVNNITTGER (12aa)
- TNQDIPAPANFSQR (14aa)
- GYYNQSEAGSHTVQR (15aa)
- GYYNQSEAGSHTVQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- NFSAHFVHPATRPPHMLASHLR (22aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- GYYNQSEAGSHIIQR (15aa)
- GYYNQSEAGSHIIQR (15aa)
- GYYNQSEAGSHIIQR (15aa)
- ANATIEVK (8aa)
- ANATIEVK (8aa)
- TNMSIGIIITR (11aa)
- DMSDGFISNITIQR (14aa)
- NVETNNSTVLIEGK (14aa)
- SDGFISNLTIQR (12aa)
- QEILQHVDVIKNFSLTK (17aa)
- WNCSTVDNTSVFGR (14aa)
- VCSNDNKTFDSSCHFFATK (19aa)
- SANASFNIK (9aa)
- LVNVSR (6aa)
- SISNSTAR (8aa)
- QGNGTFVQTDKPLYTPGQQVYFR (23aa)
- ATISTIAVAVNR (12aa)
- HINFTR (6aa)
- NQSVGDPNVDLIR (13aa)
- KPQDQGLNHTCN (12aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- GVYEITHNNK (10aa)
- LHINHNNLTESVGPLPK (17aa)
- NVTWK (5aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- INDTYVNVGIYSTK (14aa)
- DAGVVCTNETR (11aa)
- VLHHYNR (7aa)
- ESHNTSKGPEATWNLNK (17aa)
- SIAHNMTTPNK (11aa)
- KLHINHNNLTESVGPLPK (18aa)
- FGCEIENNR (9aa)
- LKFNSTIK (8aa)
- HPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPR (42aa)
- ENPVEFDSLFNESK (14aa)
- TVIELKNR (8aa)
- MATPIIMQAIPMGAIPQGPMQNATK (25aa)
- SWEAFSNLSYYTR (13aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)