Taxonomy (79)
Protein (657)
Source (59)
Structure (29)
Composition (1)
Disease (11)
Site (923)
Peptide (785)
- Corylus avellana (Hazelnut)
- Physomitrella patens
- Trichinella spiralis
- Antheraea pernyi (Chinese oak silkmoth)
- Homo sapiens (Human)
- Human immunodeficiency virus type 1 (bh8 isolate) (Hiv-1 (bh8 isolate))
- Aspergillus niger
- Phaseolus vulgaris (Kidney bean)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Pistacia vera (Pistachio)
- Juglans regia (English walnut)
- Fagopyrum esculentum (Common buckwheat)
- Saccharomyces cerevisiae (Baker's yeast)
- Daucus carota (Carrot)
- Musa acuminata (Banana)
- Arabidopsis thaliana (Thale cress)
- Friend spleen focus-forming virus (gm3.4 mutant)
- Vigna radiata var. radiata (Mung bean)
- Fragaria x ananassa (Strawberry)
- Allium cepa (Onion)
- Cherax quadricarinatus (Australian red claw crayfish)
- Mamestra brassicae
- Friend spleen focus-forming virus (gm3 mutant)
- Human immunodeficiency virus (Hiv)
- Citrus sinensis (Orange)
- Brassica oleracea var. botrytis (Cauliflower)
- Artemisia vulgaris (Mugwort)
- Nicotiana alata (Persian tobacco)
- Coturnix coturnix japonica (Japanese quail)
- Androctonus australis (Sahara scorpion)
- Schistosoma mansoni
- Oryza sativa (Rice)
- Trypansoma brucei
- Mesocricetus auratus (Golden hamster)
- Riftia pachyptila (Giant tubeworm)
- Spodoptera frugiperda (Fall armyworm)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Friend spleen focus-forming virus (gm1 mutant)
- Lycopersicon esculentum (Tomato)
- Torpedo californica (Pacific electric ray)
- Asparagus officinalis (Garden asparagus)
- Canavalia ensiformis (Jack bean)
- Sus scrofa (Pig)
- Mus musculus (House mouse)
- Persea americana (Avocado)
- Carica papaya (Papaya)
- Prunus dulcis var. sativa (Sweet almond)
- Rattus norvegicus (Norway rat)
- Apis mellifera (Honeybee)
- Naja kaouthia (Monocled cobra)
- Malus domestica var. golden delicious (Cultivated apple - golden delicious)
- Asterias rubens (European starfish)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Solanum tuberosum (Potato)
- Friend spleen focus-forming virus (anemia inducing strain)
- Actinidia chinensis (Kiwi fruit)
- Friend spleen focus-forming virus
- Phaseolus lunatus (Lima bean)
- Pisum sativum (Pea)
- Glycine max (Soybean)
- Ricinus communis (Castor bean)
- Unio elongatus
- Agaricus bisporus (Common mushroom)
- Apium graveolens var. oulce (Celery)
- Bos taurus (Bovine)
- Friend spleen focus-forming virus (gm1.2 mutant)
- Kinetoplastids
- Trypanosoma brucei brucei
- Friend mink cell focus-forming virus
- Bombyx mori (Domestic silkworm)
- Columba livia (Domestic pigeon)
- Drosophila melanogaster (Fruit fly)
- Friend spleen focus-forming virus (gm1.2.3 mutant)
- Pyrus communis var. williams (Pear)
- Caenorhabditis elegans
- Pontastacus leptodactylus (Narrow-clawed crayfish)
- Gallus gallus (Chicken)
- Acremonium sp
- Aedes aegypti (Yellow fever mosquito)
Taxonomy
- Erlin-2 / Mus musculus Q8BFZ9
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus Q9D1T0
- Desmocollin-2 / Homo sapiens Q02487
- HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens P01889
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843
- Alpha-amylase / Oryza sativa P17654
- UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus Q920V1
- Uncharacterized protein from Cell Surface / Aedes aegypti
- Uncharacterized protein from Seed / Vigna radiata var. radiata
- HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens P01891
- Sortilin-related receptor / Mus musculus O88307
- ATP-binding cassette sub-family A member 1 / Homo sapiens O95477
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus Q8VBZ3
- Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens P11166
- Semaphorin-4D / Homo sapiens Q92854
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus P46978
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus P03393
- Uncharacterized protein from Whole Organism / Schistosoma mansoni
- Platelet glycoprotein 4 / Mus musculus Q08857
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant) P03393
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens P30504
- Integrin alpha-X / Homo sapiens P20702
- Uncharacterized protein from Seed / Fagopyrum esculentum
- Cathepsin D / Homo sapiens P07339
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Plexin-c1 / Homo sapiens O60486
- Transmembrane protein 8A / Homo sapiens Q9HCN3
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Laminin subunit alpha-5 / Homo sapiens O15230
- Protocadherin beta-15 / Homo sapiens Q9Y5E8
- Integrin alpha-1 / Mus musculus Q3V3R4
- Integrin beta-2 / Mus musculus P11835
- Ig alpha-1 chain c region / Homo sapiens P01876
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens Q9NZR2
- Immunoglobulin m / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens P10321
- Cadherin-2 / Mus musculus P15116
- Macrosialin / Homo sapiens P34810
- Leucine rich repeat protein 2, neuronal / Mus musculus Q6PHP6
- Transmembrane protein 131 / Homo sapiens Q92545
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Ephrin-A3 / Homo sapiens P52797
- Integrin alpha-V / Mus musculus P43406
- Translocon-associated protein subunit alpha / Mus musculus Q9CY50
- Neuroendocrine convertase 2 / Mus musculus P21661
- HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens P18463
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Ig gamma-2 chain c region / Homo sapiens P01859
- Basigin / Homo sapiens P35613
- Tapasin / Homo sapiens O15533
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Adhesion G protein-coupled receptor F5 / Mus musculus G5E8Q8
- Thrombospondin-1 / Homo sapiens P07996
- Plexin-A4 / Mus musculus Q80UG2
- Cadherin-4 / Mus musculus P39038
- Calreticulin / Homo sapiens P27797
- Transmembrane protein 2 / Homo sapiens Q9UHN6
- Protein O-glucosyltransferase 1 / Mus musculus Q8BYB9
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Angiotensin-converting enzyme / Homo sapiens P12821
- Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Erlin-2 / Homo sapiens O94905
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Phosphatidylcholine-sterol acyltransferase / Mus musculus P16301
- Membralin / Mus musculus Q8CIV2
- Neutral amino acid transporter B(0) / Homo sapiens Q15758
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Contactin-1 / Mus musculus P12960
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Lactadherin / Mus musculus P21956
- Semaphorin-4D / Mus musculus O09126
- Biglycan / Homo sapiens P21810
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens P30501
- Cystatin-C / Mus musculus P21460
- Glucosylceramidase / Homo sapiens P04062
- Uncharacterized protein from Undefined tissue / Asparagus officinalis
- Integrin alpha-M / Mus musculus P05555
- Lysosome membrane protein 2 / Homo sapiens Q14108
- 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens P04035
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Prostaglandin G/H synthase 1 / Homo sapiens P23219
- Mammaglobin-B / Homo sapiens O75556
- Coagulation factor VIII / Homo sapiens P00451
- Platelet glycoprotein IV / Bos taurus P26201
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Uncharacterized protein from Seed / Pistacia vera
- Uncharacterized protein from Seed / Phaseolus lunatus
- Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus Q8BW41
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus Q3URE9
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Apisin / Apis mellifera O18330
- ER membrane protein complex subunit 10 / Mus musculus Q3TAS6
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens P35858
- Cadherin-5 / Homo sapiens P33151
- Isoform 2 of Integrin alpha-3 / Mus musculus Q62470-2
- Ig alpha-2 chain c region / Homo sapiens P01877
- Attractin / Mus musculus Q9WU60
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Torsin-1B / Mus musculus Q9ER41
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Phaseolin, alpha-type / Phaseolus vulgaris P07219
- Serpin h1 / Homo sapiens P50454
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- Integrin alpha-V / Homo sapiens P06756
- Synaptonemal complex protein SC65 / Homo sapiens Q92791
- Extracellular sulfatase Sulf-1 / Homo sapiens Q8IWU6
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens Q9NY97
- Uncharacterized protein from Fruit / Actinidia chinensis
- Carbonic anhydrase-related protein 11 / Mus musculus O70354
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens P16188
- Glycine receptor subunit beta / Mus musculus P48168
- Uncharacterized protein from Fruit / Musa acuminata
- Chondroitin sulfate glucuronyltransferase / Homo sapiens Q9P2E5
- Granulins / Homo sapiens P28799
- V-type proton ATPase subunit S1 / Homo sapiens Q15904
- Uroplakin-3b-like protein / Homo sapiens B0FP48
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Platelet glycoprotein 4 / Homo sapiens P16671
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Acid ceramidase / Homo sapiens Q13510
- Uncharacterized protein from Leaf / Arabidopsis thaliana
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- Sex-specific storage-protein 2 / Bombyx mori P20613
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Neuroplastin / Mus musculus P97300
- ERO1-like protein alpha / Mus musculus Q8R180
- Leucine-rich repeat-containing protein 24 / Mus musculus Q8BHA1
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Complement c3 / Homo sapiens P01024
- Ephrin-A1 / Mus musculus P52793
- Teneurin-2 / Mus musculus Q9WTS5
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens Q14767
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei
- Membrane glycoproteins / Mamestra brassicae
- Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans
- Protocadherin beta-14 / Homo sapiens Q9Y5E9
- Semaphorin-4F / Mus musculus Q9Z123
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens Q9TNN7
- Beta-hexosaminidase subunit alpha / Homo sapiens P06865
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Semaphorin-7A / Mus musculus Q9QUR8
- Uncharacterized protein from Whole Cell / Kinetoplastids
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei P26334
- Uncharacterized protein from Fruit / Pyrus communis var. williams
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Arylphorin / Antheraea pernyi Q7Z1F8
- Prosaposin / Homo sapiens P07602
- Von willebrand factor / Homo sapiens P04275
- Tyrosine-protein kinase Mer / Mus musculus Q60805
- Basigin / Mus musculus P18572
- CD109 antigen / Homo sapiens Q6YHK3
- HLA class I histocompatibility antigen, alpha chain E / Homo sapiens P13747
- HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens P30485
- Transcobalamin-1 / Homo sapiens P20061
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus Q64689
- HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens P04222
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus O35598
- HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens P30460
- Serotransferrin / Mus musculus Q921I1
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- V-type proton ATPase subunit S1 / Mus musculus Q9R1Q9
- Cytokine receptor-like factor 1 / Homo sapiens O75462
- Membrane glycoproteins / Bombyx mori
- Transferrin receptor protein 1 / Homo sapiens P02786
- ATP-binding cassette sub-family A member 7 / Homo sapiens Q8IZY2
- Sodium channel subunit beta-1 / Mus musculus P97952
- Transmembrane protein 231 / Homo sapiens Q9H6L2
- Lipase member J / Homo sapiens Q5W064
- Embigin / Mus musculus P21995
- UPF0577 protein KIAA1324 / Homo sapiens Q6UXG2
- ATP-binding cassette sub-family A member 7 / Mus musculus Q91V24
- Collagen alpha-1(I) chain / Homo sapiens P02452
- CD166 antigen / Homo sapiens Q13740
- Erlin-1 / Homo sapiens O75477
- Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus Q9QYK5
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Solute carrier family 12 member 5 / Mus musculus Q91V14
- Sortilin-related receptor / Homo sapiens Q92673
- Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris P02873
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- ER membrane protein complex subunit 10 / Homo sapiens Q5UCC4
- Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (bh8 isolate) P04582
- Integrin beta-5 / Homo sapiens P18084
- Low-density lipoprotein receptor-related protein 5 / Homo sapiens O75197
- Immunoglobulin gamma / Gallus gallus
- PI-PLC X domain-containing protein 3 / Homo sapiens Q63HM9
- Cadherin-10 / Mus musculus P70408
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus Q9R1E6
- Vitellogenin / Cherax quadricarinatus Q9GSG2
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens Q6NSJ0
- Zinc transporter ZIP6 / Homo sapiens Q13433
- Liver carboxylesterase 1 / Homo sapiens P23141
- Ribonuclease s-6 / Nicotiana alata Q40379
- Alpha-galactosidase A / Homo sapiens P06280
- Uncharacterized protein from Seed / Phaseolus vulgaris
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens P30456
- Uncharacterized protein from Leaf / Carica papaya
- Tetratricopeptide repeat protein 17 / Homo sapiens Q96AE7
- HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens P30459
- Sialic acid-binding Ig-like lectin / Mus musculus B7ZMQ5
- ATPase family AAA domain-containing protein 1 / Mus musculus Q9D5T0
- Uncharacterized protein from Floret / Brassica oleracea var. botrytis
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus Q4VA61
- P2X purinoceptor 7 / Homo sapiens Q99572
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens Q9HCU4
- Serum paraoxonase/arylesterase 2 / Mus musculus Q62086
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Mammaglobin-A / Homo sapiens Q13296
- Prosalusin / Homo sapiens Q8N2E6
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens P46977
- Uncharacterized protein from Mononuclear Leukocyte / Mus musculus
- Protein OS-9 / Mus musculus Q8K2C7
- Glutamate receptor 4 / Mus musculus Q9Z2W8
- Neuroplastin / Homo sapiens Q9Y639
- Amphoterin-induced protein 2 / Homo sapiens Q86SJ2
- Thyroglobulin / Homo sapiens P01266
- Protein OS-9 / Homo sapiens Q13438
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Alpha-(1,3)-fucosyltransferase 11 / Mus musculus Q8BHC9
- Nuclear envelope integral membrane protein 1 / Homo sapiens O14524
- Integrin beta-1 / Homo sapiens P05556
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Serotransferrin / Homo sapiens P02787
- Torsin-2A / Homo sapiens Q5JU69
- Tsl-1 antigens / Trichinella spiralis
- ER membrane protein complex subunit 1 / Homo sapiens Q8N766
- Galactose-3-O-sulfotransferase 3 / Mus musculus P61315
- Collagen alpha-6(VI) chain / Homo sapiens A6NMZ7
- Uromodulin / Homo sapiens P07911
- Protocadherin beta-10 / Homo sapiens Q9UN67
- Gp120 / Human immunodeficiency virus
- Suppressor of tumorigenicity 14 protein / Homo sapiens Q9Y5Y6
- Podocalyxin / Homo sapiens O00592
- Plexin-B2 / Mus musculus B2RXS4
- Extracellular sulfatase Sulf-2 / Homo sapiens Q8IWU5
- Thrombospondin-2 / Homo sapiens P35442
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus Q8BGT0
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens Q68CP4
- Prolactin-inducible protein / Homo sapiens P12273
- Immunoglobulin y / Coturnix coturnix japonica
- Beta-hexosaminidase subunit alpha / Mus musculus P29416
- Uncharacterized protein from Fruit / Malus domestica var. golden delicious
- Complement C2 / Homo sapiens P06681
- Protocadherin beta-5 / Homo sapiens Q9Y5E4
- Fibrillin-1 / Homo sapiens P35555
- Integrin alpha-2 / Homo sapiens P17301
- Lysosome-associated membrane glycoprotein 5 / Mus musculus Q9D387
- Phaseolin, beta-type / Phaseolus vulgaris P02853
- Laminin subunit alpha-1 / Mus musculus P19137
- Hemopexin / Homo sapiens P02790
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Nodal modulator 1 / Homo sapiens Q15155
- Laminin subunit gamma-1 / Homo sapiens P11047
- Glucoside xylosyltransferase 1 / Homo sapiens Q4G148
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Alpha-glucosidase / Aspergillus niger P56526
- Bone morphogenetic protein receptor type-2 / Mus musculus O35607
- Nicalin / Homo sapiens Q969V3
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- SPARC / Mus musculus P07214
- Lactadherin / Homo sapiens Q08431
- Zona pellucida sperm-binding protein matrix / Mus musculus Q62005 P10761 P20239
- Torsin-1B / Homo sapiens O14657
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Protein O-mannosyl-transferase 2 / Homo sapiens Q9UKY4
- Prosaposin / Mus musculus Q61207
- CUB and sushi domain-containing protein 1 / Mus musculus Q923L3
- Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis Q6YDN9
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Isoform 2 of Catenin delta-1 / Mus musculus P30999-2
- GPI ethanolamine phosphate transferase 1 / Homo sapiens O95427
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Uncharacterized protein from Ovary / Asterias rubens
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Tetraspanin-3 / Homo sapiens O60637
- Attractin / Homo sapiens O75882
- Integrin beta-1 / Mus musculus P09055
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Transmembrane protein 131 / Mus musculus O70472
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus Q8BHJ7
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Transforming growth factor beta-3 / Homo sapiens P10600
- Immunoglobulin gamma / Columba livia
- ATP-binding cassette sub-family A member 1 / Mus musculus P41233
- Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Alpha-2-macroglobulin-like protein 1 / Homo sapiens A8K2U0
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Ig gamma-1 chain c region / Homo sapiens P01857
- Lymphoid enhancer-binding factor 1 / Homo sapiens Q9UJU2
- Hyaluronidase-4 / Homo sapiens Q2M3T9
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Tetraspanin-3 / Mus musculus Q9QY33
- Neuronal pentraxin-1 / Mus musculus Q62443
- GPI inositol-deacylase / Mus musculus Q3UUQ7
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens P30484
- T-cell immunomodulatory protein / Mus musculus Q99KW9
- Ig epsilon chain c region / Homo sapiens P01854
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Integrin beta-3 / Homo sapiens P05106
- Nuclear pore membrane glycoprotein 210 / Mus musculus Q9QY81
- HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens Q29960
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Uncharacterized protein from Serum / Homo sapiens
- Sparc / Homo sapiens P09486
- Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens Q14264
- Torsin-1A / Homo sapiens O14656
- Seipin / Homo sapiens Q96G97
- Noelin / Mus musculus O88998
- Recombinant plasminogen - [r580s] / Homo sapiens P00750
- Endoplasmin / Homo sapiens P14625
- HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens P04439
- Antithrombin-III / Homo sapiens P01008
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Plexin-C1 / Mus musculus Q9QZC2
- Clusterin / Homo sapiens P10909
- Serpin H1 / Mus musculus P19324
- Cobra venom factor / Naja kaouthia Q91132
- Ceramide synthase 2 / Homo sapiens Q96G23
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) P03393
- Plexin-A2 / Mus musculus P70207
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus P60882
- Contactin-associated protein 1 / Mus musculus O54991
- Protocadherin beta-8 / Homo sapiens Q9UN66
- Protein FAM234B / Mus musculus Q8BYI8
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Clusterin / Mus musculus Q06890
- Integrin beta-6 / Homo sapiens P18564
- Laminin subunit alpha-5 / Mus musculus Q61001
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens P30508
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Carboxypeptidase M / Mus musculus Q80V42
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Niemann-Pick C1 protein / Mus musculus O35604
- Uncharacterized protein from Tuber / Solanum tuberosum
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens Q86WC4
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Uncharacterized protein from Tuber / Allium cepa
- Beta-secretase / Homo sapiens P56817
- Collagen alpha-1(III) chain / Homo sapiens P02461
- Solute carrier family 12 member 7 / Homo sapiens Q9Y666
- Zinc transporter ZIP12 / Mus musculus Q5FWH7
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens P30475
- Sortilin / Mus musculus Q6PHU5
- Serine--tRNA ligase, cytoplasmic / Homo sapiens P49591
- Thioredoxin domain-containing protein 15 / Homo sapiens Q96J42
- Invertase / Saccharomyces cerevisiae
- Carboxypeptidase E / Mus musculus Q00493
- VPS10 domain-containing receptor SorCS1 / Mus musculus Q9JLC4
- Invertase [secreted form] / Saccharomyces cerevisiae
- Protein kinase C-binding protein NELL2 / Mus musculus Q61220
- HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens P30499
- Sodium channel protein type 4 subunit alpha / Homo sapiens P35499
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens O95302
- CD180 antigen / Mus musculus Q62192
- ERO1-like protein alpha / Homo sapiens Q96HE7
- HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens P30510
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- Kinesin-like protein / Mus musculus P33173
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Folate receptor alpha / Homo sapiens P15328
- Stromal interaction molecule 1 / Homo sapiens Q13586
- SPARC-like protein 1 / Mus musculus P70663
- Art v II / Artemisia vulgaris
- Membrane glycoproteins / Spodoptera frugiperda
- Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens O43166
- CD82 antigen / Homo sapiens P27701
- Lumican / Homo sapiens P51884
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens P10316
- Collagen alpha-2(I) chain / Homo sapiens P08123
- Invertase 2 / Saccharomyces cerevisiae P00724
- Lactotransferrin / Bos taurus P24627
- Laminin subunit beta-1 / Homo sapiens P07942
- HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens Q95365
- Complement c4-a / Homo sapiens P0C0L4
- Uncharacterized protein from Seed / Prunus dulcis var. sativa
- Sortilin / Homo sapiens Q99523
- Nodal modulator 3 / Homo sapiens P69849
- Toll-like receptor 2 / Homo sapiens O60603
- Integrin alpha-6 / Homo sapiens P23229
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- Uncharacterized protein from Whole Organism / Trichinella spiralis
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Galectin-3-binding protein / Homo sapiens Q08380
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- Immunoglobulin mu / Homo sapiens
- Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
- Protein Wnt-5a / Homo sapiens P41221
- Contactin-3 / Mus musculus Q07409
- Ascorbate oxidase / Acremonium sp
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens P30450
- TM2 domain-containing protein 1 / Homo sapiens Q9BX74
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens P30453
- Phospholipase D3 / Homo sapiens Q8IV08
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Uncharacterized protein from Undefined tissue / Agaricus bisporus
- Transmembrane protein 106B / Mus musculus Q80X71
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus Q6GQU6
- HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens P16189
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- Nuclear pore membrane glycoprotein 210 / Homo sapiens Q8TEM1
- Transmembrane protein 181a / Mus musculus Q3U3W2
- Platelet-derived growth factor subunit b / Homo sapiens P01127
- Monoacylglycerol lipase ABHD12 / Homo sapiens Q8N2K0
- Interleukin-6 receptor subunit beta / Homo sapiens P40189
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Cartilage oligomeric matrix protein / Homo sapiens P49747
- Glutamate receptor ionotropic, kainate 2 / Mus musculus P39087
- HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens P30685
- Hemoglobin extracellular / Riftia pachyptila
- Glia-derived nexin / Mus musculus Q07235
- Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus Q2VLH6-2
- Protocadherin beta-2 / Homo sapiens Q9Y5E7
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens O14672
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus Q9R0E2
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus Q6S5C2
- C-type mannose receptor 2 / Homo sapiens Q9UBG0
- Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus Q8BJI1
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Uncharacterized protein from Undefined tissue / Drosophila melanogaster
- P2X purinoceptor 4 / Mus musculus Q9JJX6
- Carbohydrate sulfotransferase 8 / Mus musculus Q8BQ86
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Rho-related BTB domain-containing protein 3 / Homo sapiens O94955
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Deoxyribonuclease-2-alpha / Homo sapiens O00115
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Transmembrane protein 158 / Mus musculus Q6F5E0
- HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens P01892
- KDEL motif-containing protein 2 / Homo sapiens Q7Z4H8
- Acetylcholine receptor protein / Torpedo californica P02718 P02710 P02714 P02712
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus Q8BG19
- Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae
- Myelin protein zero-like protein 2 / Homo sapiens O60487
- Neurofascin / Homo sapiens O94856
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Integrin alpha-M / Homo sapiens P11215
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens Q29836
- Erlin-1 / Mus musculus Q91X78
- Calcium-activated chloride channel regulator 2 / Homo sapiens Q9UQC9
- Sialomucin core protein 24 / Homo sapiens Q04900
- Signal transducer CD24 / Homo sapiens P25063
- Neurofascin / Mus musculus Q810U3
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Thioredoxin domain-containing protein 15 / Mus musculus Q6P6J9
- Coagulation factor VIII / Sus scrofa P12263
- Peroxidasin homolog / Homo sapiens Q92626
- Reelin / Mus musculus Q60841
- Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Nicastrin / Mus musculus P57716
- Hemocyanin / Pontastacus leptodactylus P83180
- HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens P30486
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Heat shock 70 kDa protein 13 / Homo sapiens P48723
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens P30466
- Uncharacterized protein from Fruit / Persea americana
- ER membrane protein complex subunit 1 / Mus musculus Q8C7X2
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens Q95604
- Excitatory amino acid transporter 2 / Mus musculus P43006
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus Q0PMG2
- Alpha-mannosidase / Canavalia ensiformis C0HJB3
- Insulin receptor / Mus musculus P15208
- Protocadherin beta-16 / Homo sapiens Q9NRJ7
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Lipase member K / Homo sapiens Q5VXJ0
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus Q8BTJ4
- Nodal modulator 2 / Homo sapiens Q5JPE7
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens Q9BZQ6
- Nucleolar protein 56 / Homo sapiens O00567
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens P78536
- Variant surface glycoprotein mitat 1.4a / Trypansoma brucei P02896
- Prostaglandin G/H synthase 2 / Homo sapiens P35354
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Cartilage-associated protein / Homo sapiens O75718
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus Q3TDQ1
- Prostaglandin g/h synthase 2 / Mus musculus Q05769
- Uncharacterized protein from Tuber / Apium graveolens var. oulce
- HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens Q04826
- TM2 domain-containing protein 3 / Homo sapiens Q9BRN9
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Thy-1 membrane glycoprotein / Mus musculus P01831
- HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens Q07000
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- Plexin-B2 / Homo sapiens O15031
- ATP-binding cassette sub-family A member 2 / Homo sapiens Q9BZC7
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- P2X purinoceptor 7 / Mus musculus Q9Z1M0
- Laminin subunit alpha-2 / Mus musculus Q60675
- UPF0577 protein KIAA1324-like homolog / Mus musculus Q3UZV7
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Immunoglobulin y / Gallus gallus
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens P30512
- Apolipoprotein d / Homo sapiens P05090
- Calponin-3 / Homo sapiens Q15417
- Dystroglycan / Homo sapiens Q14118
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Protocadherin Fat 1 / Mus musculus F2Z4A3
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus Q9R0E1
- Calsyntenin-2 / Mus musculus Q9ER65
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens Q29865
- Agrin / Homo sapiens O00468
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Recombinant plasminogen - [r580e] / Homo sapiens P00750
- Protocadherin beta-11 / Homo sapiens Q9Y5F2
- Isoform 2 of Teneurin-4 / Mus musculus Q3UHK6-2
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal acid phosphatase / Homo sapiens P11117
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Apolipoprotein b-100 / Homo sapiens P04114
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Lysosome membrane protein 2 / Mus musculus O35114
- Uncharacterized protein from Seed / Pisum sativum
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Integrin alpha-1 / Homo sapiens P56199
- Thrombospondin-3 / Homo sapiens P49746
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Protocadherin alpha-12 / Homo sapiens Q9UN75
- Uncharacterized protein from Endosperm / Ricinus communis
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Alpha-L-iduronidase / Mus musculus P48441
- Nodal modulator 1 / Mus musculus Q6GQT9
- HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens P30462
- Nicastrin / Homo sapiens Q92542
- Complement C4-B / Homo sapiens P0C0L5
- V-type proton ATPase subunit e 1 / Homo sapiens O15342
- Collagen alpha-2(V) chain / Homo sapiens P05997
- Endoplasmin / Mus musculus P08113
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- Uncharacterized protein from Whole Organism / Caenorhabditis elegans
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus Q9R1V7
- Twisted gastrulation protein homolog 1 / Homo sapiens Q9GZX9
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens P30480
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Laminin subunit beta-2 / Homo sapiens P55268
- Plexin-D1 / Homo sapiens Q9Y4D7
- Choline transporter-like protein 4 / Homo sapiens Q53GD3
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) P03393
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Fibronectin / Homo sapiens P02751
- HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens P16190
- Lysosomal protective protein / Mus musculus P16675
- Protein turtle homolog A / Homo sapiens Q9P2J2
- Testican-2 / Mus musculus Q9ER58
- Uncharacterized protein from Fruit / Citrus sinensis
- CUB domain-containing protein 1 / Homo sapiens Q9H5V8
- Protocadherin beta-3 / Homo sapiens Q9Y5E6
- Coiled-coil domain-containing protein 80 / Homo sapiens Q76M96
- Fibroblast growth factor receptor 1 / Homo sapiens P11362
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens Q9NYQ6
- Beta-lactoglobulin / Bos taurus P02754
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) P03393
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Follistatin-related protein 1 / Homo sapiens Q12841
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Semaphorin-3E / Mus musculus P70275
- Uncharacterized protein from Undefined tissue / Glycine max
- Endopolygalacturonase II / Aspergillus niger P26214
- Knob protein gp70 / Friend mink cell focus-forming virus
- Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens Q9UN76
- Melanoma inhibitory activity protein 3 / Homo sapiens Q5JRA6
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Beta-glucuronidase / Homo sapiens P08236
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens P30505
- Protein CREG1 / Homo sapiens O75629
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Uncharacterized protein from Fruit / Carica papaya
- SUN domain-containing ossification factor / Homo sapiens Q9UBS9
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens P30457
- Uncharacterized protein from Seed / Juglans regia
- Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus Q61477
- Uncharacterized protein from Leaf / Arabidopsis thaliana
- Ribonuclease pancreatic [b] / Bos taurus P61823
- Alpha-galactosidase a / Aspergillus niger P28351
- Lectin / Glycine max P05046
- Translocon-associated protein subunit beta / Mus musculus Q9CPW5
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Superoxide dismutase [Cu-Zn] / Homo sapiens P00441
- Phospholipase D3 / Mus musculus O35405
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Protocadherin beta-9 / Homo sapiens Q9Y5E1
- Laminin subunit alpha-2 / Homo sapiens P24043
- Plexin-B1 / Mus musculus Q8CJH3
- Uncharacterized protein from Whole Plant / Physomitrella patens
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus Q9CW73
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Uncharacterized protein from Fruit / Lycopersicon esculentum
- Gp273 / Unio elongatus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus F6VAN0
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens Q29718
- Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus Q3UDW8
- Transmembrane protein 8B / Mus musculus B1AWJ4
- ATP-binding cassette sub-family A member 2 / Mus musculus P41234
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus P26048
- Uncharacterized protein from Seed / Corylus avellana
- Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus Q9D906
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus P59823
- Collagen alpha-1(V) chain / Homo sapiens P20908
- Probable C-mannosyltransferase DPY19L4 / Homo sapiens Q7Z388
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens P30464
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus Q8BXA5
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Protein sel-1 homolog 1 / Mus musculus Q9Z2G6
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- Sodium channel protein type 1 subunit alpha / Mus musculus A2APX8
- Epidermal growth factor receptor / Homo sapiens P00533
- Uncharacterized protein from Fruit / Fragaria x ananassa
- Hemocyanin / Androctonus australis
- HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens Q31610
- Cleft lip and palate transmembrane protein 1 / Homo sapiens O96005
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Uncharacterized protein from Root / Daucus carota
Protein
- BHK21/13/Py6 (CVCL_LM74) Kidney (UBERON_0002113) Plasma Membrane (GO_0005886)
- Floret (BTO_0000468)
- AH130 (CVCL_4367) Liver (UBERON_0002107)
- Root (BTO_0001188)
- Zona Pellucida (UBERON_0000086)
- Coelomic Fluid (UBERON_0036217)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Egg Cell Jelly Coat
- Milk (UBERON_0001913)
- Yolk (GO_0060417)
- Endosperm (BTO_0000390)
- Style (BTO_0001313)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- Leaf (BTO_0000713)
- Low-Density Lipoprotein Particle (GO_0034362)
- BHK-21 (CVCL_1914) Kidney (UBERON_0002113) Plasma Membrane (GO_0005886)
- LSTM-AA-20A (CVCL_Z354) Cell Surface (GO_0009986)
- Lymphocyte (CL_0000542)
- Pollen (BTO_0001097)
- Delipidated Cell
- Hemolymph (UBERON_0001011)
- Venom (UBERON_0007113)
- HUVEC-C (CVCL_2959) Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- NRK (CVCL_3758) Kidney (UBERON_0002113) Fibroblast (CL_0000057)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- Brain (UBERON_0000955)
- Leukocyte (CL_0000738)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Blood (UBERON_0000178)
- Endothelial Cell of Umbilical Vein (CL_0002618)
- Royal Jelly
- Blood Plasma (UBERON_0001969)
- Cotyledon (BTO_0000300)
- Placenta (UBERON_0001987)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- Pancreas (UBERON_0001264)
- BM-N (CVCL_Z633)
- Ovary (UBERON_0000992)
- Electric Organ (UBERON_0006869)
- CE (CVCL_6D96)
- BW5147.PHAR2.7 (CVCL_VT60) Leukocyte (CL_0000738)
- Sf21 (CVCL_0518) Ovary (UBERON_0000992)
- SPC-Mb-92-C6 (CVCL_VT62)
- Fruit (BTO_0000486)
- Tuber (BTO_0001400)
- BW5147 (CVCL_3896) Leukocyte (CL_0000738)
- HEK293T (CVCL_0063) Kidney (UBERON_0002113) Plasma Membrane (GO_0005886)
- Retina (UBERON_0000966)
- Lec1 (CVCL_3440) Ovary (UBERON_0000992)
- Rat1 (CVCL_0492)
- Seed (BTO_0001226)
- Blood Serum (UBERON_0001977)
- CHO (CVCL_0213) Ovary (UBERON_0000992)
- Microsome (GO_0005792)
- Sf9 (CVCL_0549) Ovary (UBERON_0000992)
- Mv1Lu (CVCL_0593) Lung (UBERON_0002048)
Source
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)Man(a1-3)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
- N-Linked / High-Mannose / Glc(?1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 3677
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
Reported structure
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
Composition
- Hyperimmune condition
- Hypercholesterolemia, Familial (DOID:13810)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
- Prostate cancer (DOID:10283)
- Cancer, breast (DOID:1612)
- Erythroleukemia with associated Polycythemia
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Carcinoma, Hepatocellular (DOID:684)
- Lymphoma (DOID:0060058)
- Healthy
Disease
- Transmembrane protein 231 / Homo sapiens :
-
Hemocyanin / Androctonus australis :
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus :
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus :
- HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens :
- Protein FAM234B / Mus musculus :
-
Recombinant plasminogen - [r580e] / Homo sapiens :
- Undefined site
- Interleukin-6 receptor subunit beta / Homo sapiens :
- UPF0577 protein KIAA1324-like homolog / Mus musculus :
- Low-density lipoprotein receptor-related protein 5 / Homo sapiens :
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens :
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus :
- Plexin-A4 / Mus musculus :
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens :
-
Art v II / Artemisia vulgaris :
- Undefined site
- Serotransferrin / Mus musculus :
- Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus :
- Melanoma inhibitory activity protein 3 / Homo sapiens :
- Ig epsilon chain c region / Homo sapiens :
- Bone morphogenetic protein receptor type-2 / Mus musculus :
-
Uncharacterized protein from Leaf / Arabidopsis thaliana :
- Undefined site
- V-type proton ATPase subunit e 1 / Homo sapiens :
- Gamma-glutamyl hydrolase / Homo sapiens :
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus :
- HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens :
- Contactin-3 / Mus musculus :
- Prolactin-inducible protein / Homo sapiens :
-
Uncharacterized protein from Whole Organism / Trichinella spiralis :
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus :
- Undefined site
- Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus :
- ER membrane protein complex subunit 10 / Homo sapiens :
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens :
-
Uncharacterized protein from Seed / Vigna radiata var. radiata :
- Undefined site
- ATP-binding cassette sub-family A member 1 / Homo sapiens :
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens :
- Laminin subunit alpha-2 / Homo sapiens :
- Extracellular sulfatase Sulf-1 / Homo sapiens :
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus :
- Protein OS-9 / Homo sapiens :
- Thyroglobulin / Homo sapiens :
- Solute carrier family 12 member 5 / Mus musculus :
- Sortilin-related receptor / Homo sapiens :
-
Uncharacterized protein from Serum / Homo sapiens :
- Undefined site
- Hyaluronidase-4 / Homo sapiens :
-
Immunoglobulin gamma / Gallus gallus :
- Undefined site
- Nodal modulator 3 / Homo sapiens :
- Tetratricopeptide repeat protein 17 / Homo sapiens :
- HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens :
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus :
- Fibronectin / Homo sapiens :
-
Uncharacterized protein from Whole Organism / Caenorhabditis elegans :
- Undefined site
- HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens :
-
Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris :
- Undefined site
- HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens :
-
Uncharacterized protein from Endosperm / Ricinus communis :
- Undefined site
- Macrosialin / Homo sapiens :
- Collagen alpha-6(VI) chain / Homo sapiens :
- Nuclear envelope integral membrane protein 1 / Homo sapiens :
- Clusterin / Mus musculus :
- Protocadherin beta-10 / Homo sapiens :
- Alpha-2-macroglobulin-like protein 1 / Homo sapiens :
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens :
-
Ascorbate oxidase / Acremonium sp :
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens :
- Semaphorin-4D / Mus musculus :
- Fibrillin-1 / Homo sapiens :
- HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens :
- ERO1-like protein alpha / Mus musculus :
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens :
- Thy-1 membrane glycoprotein / Mus musculus :
- Sortilin-related receptor / Mus musculus :
- Neuroendocrine convertase 2 / Mus musculus :
- Leukocyte surface antigen CD47 / Mus musculus :
- Synaptic vesicle glycoprotein 2A / Mus musculus :
- Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens :
- Ceramide synthase 2 / Homo sapiens :
-
Coagulation factor VIII / Sus scrofa :
- Undefined site
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens :
- V-type proton ATPase subunit S1 / Mus musculus :
-
Uncharacterized protein from Undefined tissue / Asparagus officinalis :
- Undefined site
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens :
- Semaphorin-3E / Mus musculus :
-
Uncharacterized protein from Seed / Phaseolus vulgaris :
- Undefined site
- Attractin / Homo sapiens :
- Leucine rich repeat protein 2, neuronal / Mus musculus :
-
Uncharacterized protein from Royal Jelly / Apis mellifera :
- Undefined site
- Angiotensin-converting enzyme / Homo sapiens :
- Torsin-2A / Homo sapiens :
-
Uncharacterized protein from Seed / Pistacia vera :
- Undefined site
- Tetraspanin-3 / Mus musculus :
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus :
- Phosphatidylcholine-sterol acyltransferase / Mus musculus :
- Nicastrin / Homo sapiens :
- Laminin subunit alpha-4 / Homo sapiens :
-
Gp55 / Friend spleen focus-forming virus (anemia inducing strain) :
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) :
- Undefined site
- Thrombospondin-2 / Homo sapiens :
- Prostaglandin G/H synthase 2 / Homo sapiens :
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens :
-
Endopolygalacturonase II / Aspergillus niger :
- Undefined site
- Glucosidase 2 subunit beta / Homo sapiens :
- Lysosomal Pro-X carboxypeptidase / Homo sapiens :
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens :
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus :
- Inactive tyrosine-protein kinase 7 / Homo sapiens :
-
Uncharacterized protein from Whole Cell / Kinetoplastids :
- Undefined site
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens :
- Lymphoid enhancer-binding factor 1 / Homo sapiens :
- Translocon-associated protein subunit alpha / Mus musculus :
- Torsin-1A / Homo sapiens :
- Hepatocyte cell adhesion molecule / Mus musculus :
- Tapasin / Homo sapiens :
- TM2 domain-containing protein 3 / Homo sapiens :
- Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus :
-
Uncharacterized protein from Fruit / Malus domestica var. golden delicious :
- Undefined site
- Heat shock 70 kDa protein 13 / Homo sapiens :
- Metal transporter CNNM4 / Mus musculus :
- Zinc transporter ZIP6 / Homo sapiens :
- Toll-like receptor 2 / Homo sapiens :
- Beta-hexosaminidase subunit alpha / Homo sapiens :
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens :
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate) :
- Undefined site
- Semaphorin-7A / Mus musculus :
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens :
-
Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis :
- Undefined site
- Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus :
- Twisted gastrulation protein homolog 1 / Homo sapiens :
-
Uncharacterized protein from Seed / Corylus avellana :
- Undefined site
- HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens :
-
Sex-specific storage-protein 2 / Bombyx mori :
- Undefined site
- HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens :
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris :
- Undefined site
- HLA class II histocompatibility antigen gamma chain / Homo sapiens :
- Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus :
- Immunoglobulin superfamily member 8 / Homo sapiens :
-
Apolipoprotein b-100 / Homo sapiens :
- Undefined site
- Asn-185
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus :
-
Uncharacterized protein from Floret / Brassica oleracea var. botrytis :
- Undefined site
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens :
- Tyrosine-protein kinase Mer / Mus musculus :
- CD82 antigen / Homo sapiens :
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus :
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus :
- Cadherin-4 / Mus musculus :
- Cystatin-C / Mus musculus :
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus :
- Oligodendrocyte-myelin glycoprotein / Mus musculus :
- Plexin-B1 / Mus musculus :
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens :
- Nuclear pore membrane glycoprotein 210 / Homo sapiens :
- KDEL motif-containing protein 2 / Homo sapiens :
- Lipase member K / Homo sapiens :
- Alpha-1-acid glycoprotein 1 / Homo sapiens :
- Anoctamin-6 / Homo sapiens :
- Sortilin / Mus musculus :
- Desmocollin-2 / Homo sapiens :
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens :
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus :
- P2X purinoceptor 7 / Homo sapiens :
- Dystroglycan / Homo sapiens :
- BDNF/NT-3 growth factors receptor / Mus musculus :
-
Alpha-glucosidase / Aspergillus niger :
- Undefined site
- Peroxidasin homolog / Homo sapiens :
-
Alpha-mannosidase / Canavalia ensiformis :
- Undefined site
- Glutamate receptor ionotropic, kainate 2 / Mus musculus :
- Protein OS-9 / Mus musculus :
-
Uncharacterized protein from Hemolymph / Antheraea pernyi :
- Undefined site
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus :
- HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens :
-
Uncharacterized protein from Whole Plant / Physomitrella patens :
- Undefined site
- Lysosome membrane protein 2 / Mus musculus :
- Choline transporter-like protein 4 / Homo sapiens :
- Prenylcysteine oxidase 1 / Homo sapiens :
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus :
- HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens :
- Probable C-mannosyltransferase DPY19L4 / Homo sapiens :
- Transmembrane protein 131 / Homo sapiens :
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus :
- Prenylcysteine oxidase / Mus musculus :
- Collagen alpha-2(I) chain / Homo sapiens :
- Cadherin-2 / Mus musculus :
-
Uncharacterized protein from Ovary / Asterias rubens :
- Undefined site
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens :
- Sortilin / Homo sapiens :
- Collagen alpha-1(I) chain / Homo sapiens :
- SPARC-like protein 1 / Mus musculus :
-
Uncharacterized protein from Tuber / Allium cepa :
- Undefined site
- ATP-binding cassette sub-family A member 2 / Mus musculus :
- CUB and sushi domain-containing protein 1 / Mus musculus :
- Nicalin / Homo sapiens :
- Glutamate carboxypeptidase 2 / Mus musculus :
- Protein sel-1 homolog 1 / Mus musculus :
- UPF0577 protein KIAA1324 / Homo sapiens :
-
Uncharacterized protein from Seed / Pisum sativum :
- Undefined site
- Adhesion G protein-coupled receptor F5 / Mus musculus :
- Cleft lip and palate transmembrane protein 1 / Homo sapiens :
- CUB domain-containing protein 1 / Homo sapiens :
-
Ribonuclease pancreatic [b] / Bos taurus :
- Undefined site
- Asn-60
- Lysosomal acid phosphatase / Mus musculus :
- Carboxypeptidase E / Mus musculus :
- Thrombospondin-1 / Homo sapiens :
- ATP-binding cassette sub-family A member 7 / Mus musculus :
- Immunoglobulin heavy constant mu / Homo sapiens :
- Laminin subunit alpha-5 / Mus musculus :
- Translocon-associated protein subunit beta / Homo sapiens :
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus :
- Nucleolar protein 56 / Homo sapiens :
- ER membrane protein complex subunit 1 / Mus musculus :
- HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens :
- Sodium channel subunit beta-1 / Mus musculus :
- Serum paraoxonase/arylesterase 2 / Mus musculus :
- Ig gamma-1 chain c region / Homo sapiens :
- Zymogen granule protein 16 homolog B / Homo sapiens :
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens :
- Follistatin-related protein 1 / Homo sapiens :
- Erlin-1 / Mus musculus :
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus :
- Undefined site
- Adipocyte plasma membrane-associated protein / Homo sapiens :
- Amphoterin-induced protein 2 / Homo sapiens :
- Transmembrane protein 106B / Mus musculus :
- Phaseolin, beta-type / Phaseolus vulgaris :
- Hemopexin / Homo sapiens :
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens :
- Undefined site
- Protein O-mannosyl-transferase 2 / Homo sapiens :
- Transmembrane protein 158 / Mus musculus :
-
Immunoglobulin gamma / Columba livia :
- Undefined site
- Contactin-associated protein-like 2 / Mus musculus :
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens :
- Gamma-glutamyltransferase 7 / Mus musculus :
-
Tsl-1 antigens / Trichinella spiralis :
- Undefined site
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens :
- HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens :
- Sialomucin core protein 24 / Homo sapiens :
- VPS10 domain-containing receptor SorCS1 / Mus musculus :
- Stromal interaction molecule 1 / Homo sapiens :
- Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens :
- Solute carrier family 12 member 7 / Homo sapiens :
- Lumican / Homo sapiens :
- CD180 antigen / Mus musculus :
- Laminin subunit alpha-2 / Mus musculus :
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus :
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens :
-
Hemoglobin extracellular / Riftia pachyptila :
- Undefined site
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens :
- Tripeptidyl-peptidase 1 / Mus musculus :
- Ephrin-A3 / Homo sapiens :
- Alpha-n-acetylglucosaminidase / Homo sapiens :
-
Invertase 2 / Saccharomyces cerevisiae :
- Undefined site
- Olfactomedin-like protein 3 / Homo sapiens :
-
Uncharacterized protein from Root / Daucus carota :
- Undefined site
- Nuclear pore membrane glycoprotein 210 / Mus musculus :
- ATP-binding cassette sub-family A member 7 / Homo sapiens :
- Alpha-(1,3)-fucosyltransferase 11 / Mus musculus :
- Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus :
-
Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus :
- Undefined site
- Insulin receptor / Mus musculus :
- HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens :
-
Uncharacterized protein from Fruit / Persea americana :
- Undefined site
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus :
- Undefined site
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens :
- ER membrane protein complex subunit 10 / Mus musculus :
- Integrin beta-1 / Homo sapiens :
- Neural cell adhesion molecule L1-like protein / Mus musculus :
- HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens :
- Laminin subunit alpha-5 / Homo sapiens :
- Phaseolin, alpha-type / Phaseolus vulgaris :
- Ig alpha-2 chain c region / Homo sapiens :
- Protocadherin beta-16 / Homo sapiens :
-
Apisin / Apis mellifera :
- Undefined site
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus :
- Acid ceramidase / Homo sapiens :
- Galactose-3-O-sulfotransferase 3 / Mus musculus :
-
Cadherin-5 / Homo sapiens :
- Undefined site
- Collagen alpha-1(VI) chain / Homo sapiens :
- Rho-related BTB domain-containing protein 3 / Homo sapiens :
- Metalloproteinase inhibitor 1 / Homo sapiens :
-
Uncharacterized protein from Whole Organism / Schistosoma mansoni :
- Undefined site
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens :
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus :
- Undefined site
- Prolyl 3-hydroxylase 1 / Homo sapiens :
- Golgi apparatus protein 1 / Homo sapiens :
- Calsyntenin-2 / Mus musculus :
- Erlin-2 / Homo sapiens :
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus :
- Isoform 2 of Integrin alpha-3 / Mus musculus :
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens :
- Nicastrin / Mus musculus :
- Sialic acid-binding Ig-like lectin / Mus musculus :
- Inactive dipeptidyl peptidase 10 / Mus musculus :
- Translocon-associated protein subunit alpha / Homo sapiens :
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus :
- Laminin subunit beta-2 / Homo sapiens :
- Serine--tRNA ligase, cytoplasmic / Homo sapiens :
- Mannosyl-oligosaccharide glucosidase / Homo sapiens :
-
Uncharacterized protein from Fruit / Lycopersicon esculentum :
- Undefined site
-
Invertase [secreted form] / Saccharomyces cerevisiae :
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae :
- Undefined site
- Integrin alpha-V / Homo sapiens :
- Neuronal pentraxin-1 / Mus musculus :
-
Uncharacterized protein from Undefined tissue / Saccharomyces cerevisiae :
- Undefined site
- Carboxypeptidase M / Mus musculus :
- Hypoxia up-regulated protein 1 / Mus musculus :
- Membralin / Mus musculus :
-
Gp273 / Unio elongatus :
- Undefined site
- Neutral amino acid transporter B(0) / Homo sapiens :
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens :
- Protein Wnt-5a / Homo sapiens :
- Mammaglobin-B / Homo sapiens :
- SPARC / Mus musculus :
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) :
- Undefined site
- P2X purinoceptor 4 / Mus musculus :
-
Membrane glycoproteins / Bombyx mori :
- Undefined site
-
Uncharacterized protein from Undefined tissue / Agaricus bisporus :
- Undefined site
-
Coagulation factor VIII / Homo sapiens :
- Undefined site
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens :
- 4F2 cell-surface antigen heavy chain / Homo sapiens :
- Teneurin-2 / Mus musculus :
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens :
- Integrin alpha-X / Homo sapiens :
- Kinesin-like protein / Mus musculus :
- Neural cell adhesion molecule L1 / Homo sapiens :
- Synaptophysin-like protein 1 / Homo sapiens :
- Cadherin-10 / Mus musculus :
- Epidermal growth factor receptor / Homo sapiens :
- Protein CREG1 / Homo sapiens :
-
Immunoglobulin gamma-2a heavy chain / Mus musculus :
- Undefined site
- Leucyl-cystinyl aminopeptidase / Mus musculus :
- Nodal modulator 1 / Homo sapiens :
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens :
-
Immunoglobulin m / Homo sapiens :
- Undefined site
-
Platelet-derived growth factor subunit b / Homo sapiens :
- Undefined site
- Transcobalamin-1 / Homo sapiens :
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens :
- Lactadherin / Mus musculus :
- Nodal modulator 1 / Mus musculus :
- Uroplakin-3b-like protein / Homo sapiens :
- Lysosomal acid phosphatase / Homo sapiens :
- Prostaglandin g/h synthase 2 / Mus musculus :
- Plexin-C1 / Mus musculus :
- Cartilage oligomeric matrix protein / Homo sapiens :
- Glia-derived nexin / Mus musculus :
- Protocadherin beta-15 / Homo sapiens :
- CD109 antigen / Homo sapiens :
- Chondroitin sulfate glucuronyltransferase / Homo sapiens :
-
Beta-secretase / Homo sapiens :
- Undefined site
- Golgi membrane protein 1 / Homo sapiens :
-
Knob protein gp70 / Friend mink cell focus-forming virus :
- Undefined site
- Alpha-1-acid glycoprotein 2 / Homo sapiens :
- Neurofascin / Mus musculus :
-
Immunoglobulin y / Gallus gallus :
- Undefined site
- Endoplasmin / Homo sapiens :
- Protocadherin beta-2 / Homo sapiens :
- Carbonic anhydrase-related protein 11 / Mus musculus :
-
Uncharacterized protein from Seed / Prunus dulcis var. sativa :
- Undefined site
-
Uncharacterized protein from Undefined tissue / Glycine max :
- Undefined site
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens :
- Platelet glycoprotein 4 / Mus musculus :
-
Uncharacterized protein from Tuber / Solanum tuberosum :
- Undefined site
- Complement C4-B / Homo sapiens :
- Cation-dependent mannose-6-phosphate receptor / Mus musculus :
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens :
- Integrin beta-2 / Mus musculus :
- Serpin h1 / Homo sapiens :
-
Uncharacterized protein from Fruit / Pyrus communis var. williams :
- Undefined site
- Calcium-activated chloride channel regulator 2 / Homo sapiens :
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens :
- Cell cycle control protein 50A / Mus musculus :
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus :
- Protein disulfide-isomerase TMX3 / Mus musculus :
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei :
- Lysosome membrane protein 2 / Homo sapiens :
- Sialate O-acetylesterase / Homo sapiens :
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens :
- PI-PLC X domain-containing protein 3 / Homo sapiens :
-
Cobra venom factor / Naja kaouthia :
- Undefined site
- Contactin-1 / Mus musculus :
- Glutamate receptor 4 / Mus musculus :
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens :
- GPI inositol-deacylase / Mus musculus :
- Plexin-A2 / Mus musculus :
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens :
- Undefined site
- Myelin protein zero-like protein 1 / Homo sapiens :
- Zinc transporter ZIP12 / Mus musculus :
- Semaphorin-4F / Mus musculus :
- Integrin alpha-1 / Mus musculus :
-
Variant surface glycoprotein mitat 1.4a / Trypansoma brucei :
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda :
- Undefined site
- Plexin-c1 / Homo sapiens :
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens :
- Lysosome-associated membrane glycoprotein 5 / Mus musculus :
-
Uncharacterized protein from Delipidated Cells / Trypanosoma brucei brucei :
- Undefined site
-
Uncharacterized protein from Seed / Fagopyrum esculentum :
- Undefined site
- Cartilage intermediate layer protein 1 / Homo sapiens :
-
Uncharacterized protein from Fruit / Musa acuminata :
- Undefined site
- Plexin-B2 / Homo sapiens :
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus :
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus :
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens :
- Nodal modulator 2 / Homo sapiens :
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus :
- HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens :
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus :
- ATP-binding cassette sub-family A member 1 / Mus musculus :
- Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus :
- Collagen alpha-1(III) chain / Homo sapiens :
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens :
- Integrin beta-6 / Homo sapiens :
- Neurofascin / Homo sapiens :
- Basigin / Mus musculus :
- Protocadherin beta-8 / Homo sapiens :
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) :
- Undefined site
- Protocadherin beta-11 / Homo sapiens :
- Protocadherin alpha-12 / Homo sapiens :
- Protocadherin Fat 1 / Mus musculus :
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens :
- Carbohydrate sulfotransferase 8 / Mus musculus :
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens :
- Transmembrane protein 106B / Homo sapiens :
-
Invertase / Saccharomyces cerevisiae :
- Undefined site
- Laminin subunit alpha-1 / Mus musculus :
- Torsin-1B / Mus musculus :
- Isoform 2 of Teneurin-4 / Mus musculus :
- Niemann-Pick C1 protein / Mus musculus :
-
Uncharacterized protein from Seed / Juglans regia :
- Undefined site
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus :
- HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens :
- Torsin-1B / Homo sapiens :
-
Uncharacterized protein from Cell Surface / Aedes aegypti :
- Undefined site
- Ig gamma-2 chain c region / Homo sapiens :
-
Uncharacterized protein (gene name abca4) / Bos taurus :
- Undefined site
- HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens :
- Transmembrane emp24 domain-containing protein 9 / Mus musculus :
- Endoplasmin / Mus musculus :
- Cathepsin D / Homo sapiens :
- Collagen alpha-2(V) chain / Homo sapiens :
- Galectin-3-binding protein / Homo sapiens :
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant) :
- Undefined site
- Cytokine receptor-like factor 1 / Homo sapiens :
- Antithrombin-III / Homo sapiens :
- Folate receptor alpha / Homo sapiens :
- Glucosylceramidase / Homo sapiens :
- Phospholipase B-like 1 / Homo sapiens :
- Sodium channel protein type 4 subunit alpha / Homo sapiens :
- Low-density lipoprotein receptor-related protein 1B / Mus musculus :
-
Acetylcholine receptor protein / Torpedo californica :
- Undefined site
- Collagen alpha-1(V) chain / Homo sapiens :
- Prostaglandin G/H synthase 1 / Homo sapiens :
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens :
- Probable lysosomal cobalamin transporter / Homo sapiens :
-
Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens :
- Undefined site
- TM2 domain-containing protein 3 / Mus musculus :
- Laminin subunit gamma-1 / Homo sapiens :
- Cation-independent mannose-6-phosphate receptor / Homo sapiens :
- Collagen alpha-2(VI) chain / Homo sapiens :
- Dipeptidyl peptidase 1 / Homo sapiens :
-
Serotransferrin / Homo sapiens :
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) :
- Undefined site
- SUN domain-containing ossification factor / Homo sapiens :
- Clusterin / Homo sapiens :
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus :
-
Ribonuclease s-6 / Nicotiana alata :
- Undefined site
- Transmembrane protein 8A / Homo sapiens :
-
Lectin / Glycine max :
- Undefined site
- Alpha-galactosidase A / Homo sapiens :
- Tetraspanin-3 / Homo sapiens :
- N-acetylglucosamine-6-sulfatase / Homo sapiens :
- Leucine-rich repeat-containing protein 24 / Mus musculus :
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus :
-
Hemocyanin / Pontastacus leptodactylus :
- Undefined site
- Integrin beta-3 / Homo sapiens :
- Cartilage-associated protein / Homo sapiens :
- Erlin-1 / Homo sapiens :
-
Arylphorin / Antheraea pernyi :
- Undefined site
- Seipin / Homo sapiens :
-
Zona pellucida sperm-binding protein matrix / Mus musculus :
- Undefined site
- Protocadherin beta-14 / Homo sapiens :
- Transferrin receptor protein 1 / Homo sapiens :
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus :
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus :
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens :
- BTB/POZ domain-containing protein 17 / Mus musculus :
- Uromodulin / Homo sapiens :
-
Uncharacterized protein from Mononuclear Leukocyte / Mus musculus :
- Undefined site
- Extracellular sulfatase Sulf-2 / Homo sapiens :
- Apolipoprotein d / Homo sapiens :
- Semaphorin-4D / Homo sapiens :
-
Uncharacterized protein from Fruit / Carica papaya :
- Undefined site
- Protein kinase C-binding protein NELL2 / Mus musculus :
- Integrin alpha-6 / Homo sapiens :
- Transmembrane glycoprotein NMB / Homo sapiens :
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus :
- Integrin alpha-1 / Homo sapiens :
-
Uncharacterized protein from Leaf / Arabidopsis thaliana :
- Undefined site
- Excitatory amino acid transporter 2 / Mus musculus :
- Protein turtle homolog A / Homo sapiens :
- Plasma protease c1 inhibitor / Homo sapiens :
- Monoacylglycerol lipase ABHD12 / Homo sapiens :
- Synaptonemal complex protein SC65 / Homo sapiens :
-
Uncharacterized protein from Seed / Phaseolus lunatus :
- Undefined site
- Integrin alpha-2 / Homo sapiens :
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens :
- Protein sel-1 homolog 1 / Homo sapiens :
- Transmembrane protein 131 / Mus musculus :
- Lipase member J / Homo sapiens :
-
Gp120 / Human immunodeficiency virus :
- Undefined site
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens :
- Reelin / Mus musculus :
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus :
- Protocadherin beta-5 / Homo sapiens :
- Serum paraoxonase/arylesterase 2 / Homo sapiens :
- Transmembrane protein 181a / Mus musculus :
- Coiled-coil domain-containing protein 80 / Homo sapiens :
- Palmitoyl-protein thioesterase 1 / Homo sapiens :
-
Alpha-amylase / Oryza sativa :
- Undefined site
- Neuronal cell adhesion molecule / Mus musculus :
- Prosalusin / Homo sapiens :
- Transforming growth factor beta-3 / Homo sapiens :
- Embigin / Mus musculus :
- Ig alpha-1 chain c region / Homo sapiens :
- TM2 domain-containing protein 1 / Homo sapiens :
- ATPase family AAA domain-containing protein 1 / Mus musculus :
-
Alpha-galactosidase a / Aspergillus niger :
- Undefined site
- Lysosomal alpha-glucosidase / Homo sapiens :
- Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens :
- Myelin protein zero-like protein 2 / Homo sapiens :
- HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens :
- Glycine receptor subunit beta / Mus musculus :
- Biglycan / Homo sapiens :
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens :
- Laminin subunit beta-1 / Homo sapiens :
- Integrin alpha-M / Homo sapiens :
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens :
- Thrombospondin-3 / Homo sapiens :
- Thioredoxin domain-containing protein 15 / Homo sapiens :
-
Uncharacterized protein from Fruit / Fragaria x ananassa :
- Undefined site
- Phospholipase D3 / Mus musculus :
- Prosaposin / Homo sapiens :
- Phospholipase D3 / Homo sapiens :
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens :
- Suppressor of tumorigenicity 14 protein / Homo sapiens :
- Prosaposin / Mus musculus :
- C-type mannose receptor 2 / Homo sapiens :
- Neuroplastin / Mus musculus :
- Zinc-alpha-2-glycoprotein / Homo sapiens :
- Transmembrane protein 2 / Homo sapiens :
- HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens :
- Integrin beta-1 / Mus musculus :
-
Beta-lactoglobulin / Bos taurus :
- Undefined site
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens :
- Integrin alpha-V / Mus musculus :
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus :
- Glucoside xylosyltransferase 1 / Homo sapiens :
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens :
- Noelin / Mus musculus :
-
Platelet glycoprotein IV / Bos taurus :
- Undefined site
- Testican-2 / Mus musculus :
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens :
- Protein O-glucosyltransferase 1 / Mus musculus :
- Translocon-associated protein subunit beta / Mus musculus :
- Prostaglandin-h2 d-isomerase / Homo sapiens :
- Contactin-associated protein 1 / Mus musculus :
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens :
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens :
- Complement c3 / Homo sapiens :
- UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus :
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus :
- Transmembrane 9 superfamily member 3 / Homo sapiens :
-
Uncharacterized protein from Fruit / Actinidia chinensis :
- Undefined site
- Neural cell adhesion molecule L1 / Mus musculus :
-
Uncharacterized protein from Crude Membrane Fraction / Caenorhabditis elegans :
- Undefined site
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens :
- HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens :
- ER membrane protein complex subunit 1 / Homo sapiens :
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens :
- Fibroblast growth factor receptor 1 / Homo sapiens :
-
Von willebrand factor / Homo sapiens :
- Undefined site
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus :
- Serpin H1 / Mus musculus :
- Transmembrane protein 8B / Mus musculus :
- Agrin / Homo sapiens :
- CD166 antigen / Homo sapiens :
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus :
- HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens :
- Liver carboxylesterase 1 / Homo sapiens :
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens :
-
Uncharacterized protein from Undefined tissue / Drosophila melanogaster :
- Undefined site
- Integrin beta-5 / Homo sapiens :
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus :
- Calreticulin / Homo sapiens :
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus :
-
Uncharacterized protein from Tuber / Apium graveolens var. oulce :
- Undefined site
- Superoxide dismutase [Cu-Zn] / Homo sapiens :
- Beta-glucuronidase / Homo sapiens :
- 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens :
-
Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (bh8 isolate) :
- Undefined site
- Basigin / Homo sapiens :
-
Recombinant plasminogen - [r580s] / Homo sapiens :
- Undefined site
- N-acetylgalactosamine-6-sulfatase / Homo sapiens :
- Sodium channel protein type 1 subunit alpha / Mus musculus :
-
Immunoglobulin mu / Homo sapiens :
- Undefined site
- Ephrin-A1 / Mus musculus :
- Interferon-gamma receptor alpha chain / Homo sapiens :
- Collagen alpha-1(XII) chain / Homo sapiens :
- GPI ethanolamine phosphate transferase 1 / Homo sapiens :
- Complement C2 / Homo sapiens :
- Granulins / Homo sapiens :
- Protocadherin beta-9 / Homo sapiens :
- Deoxyribonuclease-2-alpha / Homo sapiens :
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus :
- HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens :
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus :
- Lactadherin / Homo sapiens :
- ATP-binding cassette sub-family A member 2 / Homo sapiens :
-
Uncharacterized protein from Leaf / Carica papaya :
- Undefined site
- Isoform 2 of Catenin delta-1 / Mus musculus :
- T-cell immunomodulatory protein / Mus musculus :
-
Immunoglobulin y / Coturnix coturnix japonica :
- Undefined site
- Integrin alpha-M / Mus musculus :
- P2X purinoceptor 7 / Mus musculus :
-
Vitellogenin / Cherax quadricarinatus :
- Undefined site
- Attractin / Mus musculus :
- HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens :
-
Uncharacterized protein from Fruit / Citrus sinensis :
- Undefined site
- Signal transducer CD24 / Homo sapiens :
- Podocalyxin / Homo sapiens :
- Plexin-B2 / Mus musculus :
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens :
- V-type proton ATPase subunit S1 / Homo sapiens :
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens :
- HLA class I histocompatibility antigen, alpha chain E / Homo sapiens :
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens :
- Complement c4-a / Homo sapiens :
- Plexin-D1 / Homo sapiens :
- Neuroplastin / Homo sapiens :
- ERO1-like protein alpha / Homo sapiens :
- Lactotransferrin / Bos taurus :
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus :
- Protocadherin beta-3 / Homo sapiens :
- Erlin-2 / Mus musculus :
- Platelet glycoprotein 4 / Homo sapiens :
- Procollagen galactosyltransferase 1 / Homo sapiens :
- Mammaglobin-A / Homo sapiens :
- Prostaglandin-H2 D-isomerase / Mus musculus :
- HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens :
-
Hyaluronoglucosaminidase / Apis mellifera :
- Undefined site
- Lysosomal protective protein / Mus musculus :
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens :
- HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens :
- Alpha-L-iduronidase / Mus musculus :
-
Sparc / Homo sapiens :
- Undefined site
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens :
- Calponin-3 / Homo sapiens :
- Beta-hexosaminidase subunit alpha / Mus musculus :
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) :
- Undefined site
- Asn-424
- Thioredoxin domain-containing protein 15 / Mus musculus :
- Monocyte differentiation antigen cd14 / Homo sapiens :
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus :
Reported glycosite
- IWIPVNITWADIEDRDGR (18aa)
- HIVFWNSSNPK (11aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- LVPVPITNATLDR (13aa)
- LVPVPITNATLDQITGK (17aa)
- CIEKEVNK (8aa)
- NITQIVGHSGCEAK (14aa)
- VIEAVNGTDAR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- VNFTIEASEGCYR (13aa)
- ADVGGEAAGTAINHSHMLLQR (21aa)
- IYIPLNK (7aa)
- KIYIPLNK (8aa)
- AELSNHTRPVILVPGCLGNR (20aa)
- IYIPINK (7aa)
- KIYIPINK (8aa)
- GLFPAILNLATNAHISANATCGEK (24aa)
- NNSDISSTR (9aa)
- FECHFFNGTER (11aa)
- FECHFFNGTER (11aa)
- FECHFFNGTER (11aa)
- CGWCTNSTFLQEGMPTSAR (19aa)
- SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
- EIFVANGTQGK (11aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- SGLAPNPTNATTK (13aa)
- WYSAGLASNSSWFR (14aa)
- FVGTPEVNQTTIYQR (15aa)
- DVNCSVMGPQEK (12aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- TGFYGENCSTPEFLTR (16aa)
- LLNATHQIGCQSSISGDTGVIHVVEKEEDLK (31aa)
- GLFPAVLNLASNALITTNATCGEK (24aa)
- ISHENGTILCSK (12aa)
- QVPGLHNGTK (10aa)
- YETTNK (6aa)
- SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
- LRPLFNK (7aa)
- YFYIQAVNSEGQNITR (16aa)
- QGNASDVILR (10aa)
- WKLNK (5aa)
- TDDEVVQREEEAIQIDGINASQIR (24aa)
- TDDEVVQREEEAIQLDGLNASQIR (24aa)
- SNAPIVNVTIYYEAICGGCR (20aa)
- NAPLVNVTLYYEALCGGCR (19aa)
- SAEFFNYTVR (10aa)
- HAPDIPDDSTDNITIFTR (18aa)
- ATTLDDNGTMLFFKGE (16aa)
- EERPINASAIK (11aa)
- FTECCHEERPLNTSALK (17aa)
- CIQANYSIMENGK (13aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- SVVAPATDGGLNLTSTFLRK (20aa)
- TGYSGPNCTIPGIWTWIR (18aa)
- YGENNSISVEGFR (13aa)
- QCFLNQSHR (9aa)
- NSTGAYCGMGENK (13aa)
- AIGFENATQAIGR (13aa)
- NETIWYIK (8aa)
- SNVSVEENVILEKPSHVELK (20aa)
- FAAPHTYNYSALLVDPASHTLYVGAR (26aa)
- GQTEIQVNCPPAVTENK (17aa)
- GAAAPSAPHWNETAEK (16aa)
- AGPEEAPAAPCNISVQR (17aa)
- NQNGTFK (7aa)
- TVVAPSTEGGLNLTSTFLR (19aa)
- NATSYPPMCTQDPK (14aa)
- DNATEEEILVYLEK (14aa)
- DNATQEEILHYLEK (14aa)
- TVVTEAGNLLKDNATQEEILHYLEK (25aa)
- NYSDTPPTSK (10aa)
- EQYTIINR (8aa)
- WLATQTMNFTGQLGAGIR (18aa)
- ENTSDPSIVIAFGR (14aa)
- EASNHSSGAGLVQINK (16aa)
- TVITPATNHMGNVTFTIPANR (21aa)
- KEDALNETR (9aa)
- SNTSQIAFIIYNDQPPQPSK (20aa)
- AHLNNLSFPIR (11aa)
- NCSAAPQPEPAAGLASYPELR (21aa)
- NVTADK (6aa)
- LPADCIDCTTNFSCTYGK (18aa)
- TDCDSSTTSICSFPVANVSITK (22aa)
- IAPASNVSHTVVIR (14aa)
- IAPASNVSH (9aa)
- IAPASNVSHTVVIRPIK (17aa)
- YEFCPFHNVTQHEQTFR (17aa)
- IAPASNVSHTVVLRPLK (17aa)
- TLGVLADEDNTLQQNSSSR (19aa)
- QDQCIYNTTYINVQR (15aa)
- VVWNGSR (7aa)
- IVGGPVAGGDPNQTIR (16aa)
- TAIWVATDHNMDNTSTVIR (19aa)
- TENLDVIVNISDTESWGQHVQK (22aa)
- NSSDIVQIAPQSLILK (16aa)
- YPTPGEAPGVVGNFNK (16aa)
- IHGQELPFEAVVLNK (15aa)
- SQTNLTDCPFHDQPHLMR (18aa)
- TCNASQGFK (9aa)
- TCDWIPKPNMSASCK (15aa)
- GHTITINFTR (10aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- SNYTPITNVPPEVTVITNSPVEIR (24aa)
- VQNMSQSIEVLDR (13aa)
- SLWNMSAANNNIK (13aa)
- ATTLGVSSDSPGTTTLAQQVSGPVNTTVAR (30aa)
- EGDLLNQTK (9aa)
- TFYWDFYTNR (10aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- NYTADYDK (8aa)
- NYTADYDK (8aa)
- NYTADYDKTLIFNK (14aa)
- IEVVNFLVPNAVYDIVKNYTADYDK (25aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- GYYNQSEAGSHTI (13aa)
- IVYNHSSGR (9aa)
- DIVEYYNDSNGSHVIQGR (18aa)
- AVIVNNITTGER (12aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEDGSHTIQR (15aa)
- GYYNQSEAGSHTVQR (15aa)
- GYYNQSEAGSHTVQR (15aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- YYNQSEAGSHTIQR (14aa)
- GYYNQSEAGSHIIQR (15aa)
- GYYNQSEAGSHIIQR (15aa)
- GYYNQSEAGSHIIQR (15aa)
- TNQDIPAPANFSQR (14aa)
- NFSAHFVHPATRPPHMLASHLR (22aa)
- TNMSIGIIITR (11aa)
- ANATIEVK (8aa)
- ANATIEVK (8aa)
- SDGFISNLTIQR (12aa)
- DMSDGFISNITIQR (14aa)
- NVETNNSTVLIEGK (14aa)
- QEILQHVDVIKNFSLTK (17aa)
- WNCSTVDNTSVFGR (14aa)
- VCSNDNKTFDSSCHFFATK (19aa)
- SANASFNIK (9aa)
- LVNVSR (6aa)
- SISNSTAR (8aa)
- QGNGTFVQTDKPLYTPGQQVYFR (23aa)
- ATISTIAVAVNR (12aa)
- HINFTR (6aa)
- NQSVGDPNVDLIR (13aa)
- AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
- KPQDQGLNHTCN (12aa)
- GVYEITHNNK (10aa)
- LHINHNNLTESVGPLPK (17aa)
- NVTWK (5aa)
- DAGVVCTNETR (11aa)
- INDTYVNVGIYSTK (14aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- VLHHYNR (7aa)
- KLHINHNNLTESVGPLPK (18aa)
- SIAHNMTTPNK (11aa)
- ESHNTSKGPEATWNLNK (17aa)
- FGCEIENNR (9aa)
- ENPVEFDSLFNESK (14aa)
- HPDGGLYNKGPSYSSYSGYIMMPNMNNDPYMSNGSLSPPIPR (42aa)
- LKFNSTIK (8aa)
- TVIELKNR (8aa)
- MATPIIMQAIPMGAIPQGPMQNATK (25aa)
- SWEAFSNLSYYTR (13aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- TFAVYINSTGYR (12aa)
- FNVSSVEK (8aa)
- LLFFDNYEHNTSVVKK (16aa)
- YGNMTEDHVMHIIQNADPIK (20aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- YPQDYQFYIQNF (12aa)
- GTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQR (40aa)
- YPQDYQFYIQNFTALPLN (18aa)
- QDYQFYIQNFTALPLNTVVPPQR (23aa)
- IQNFTALPLNTVVPPQR (17aa)
- DDLDPERNESEPGSQR (16aa)
- YPQDYQFYIQNFTALPLNTVVPPQR (25aa)
- SVAHNMTMPNK (11aa)
- SVAHNMTMPNK (11aa)
- IEVANINGTSR (11aa)
- IGIYADVGNK (10aa)
- GTFTDCALANMTEQIR (16aa)
- RGTFTDCAIANMTEQIR (17aa)
- FCWQLPETDYECTNSTSCMTVSCPR (25aa)
- VGNDTHCQPTK (11aa)
- DTGLNYTHLHVETPR (15aa)
- CAEIIVAHLGYLNYTQYR (18aa)
- FTPPVVNVTWIR (12aa)
- GSNYSEILDK (10aa)
- TNQSAELIQPVATNGK (16aa)
- TVTTSGTTNNTVTPTSQPVRK (21aa)
- TVTTSGTTNNTVTPTSQPVR (20aa)
- SWVQGNITACGR (12aa)
- SWVQGNITACGR (12aa)
- ISVHVTDNSQNSTAHVSGR (19aa)
- SLEVLNLSSNKLWTVPTNMPSK (22aa)
- SLEVLNLSSNK (11aa)
- RACQFNR (7aa)
- VLNYSR (6aa)
- SAEGTFFINK (10aa)
- SAEGTFFINK (10aa)
- FVNDTK (6aa)
- FGEFGNYSLLVQHASSGANK (20aa)
- IEWIGNCSGINDETYGYK (18aa)
- GNVSACAR (8aa)
- LNFGVGNNSEAVISQFYHSPADNKR (25aa)
- AGPNGTIFVADAYK (14aa)
- IGSFEGIVNITFIHIQHNR (19aa)
- VNETEMDIAK (10aa)
- GWNWTSGFNK (10aa)
- YDIPASINFIINK (13aa)
- LFNLTATFSR (10aa)
- SVAHNMTTPNK (11aa)
- EHYLSSVNK (9aa)
- NQSVPISCCR (10aa)
- IGDCISEDSYPDGNITWYR (19aa)
- YEQIQNETR (9aa)
- YEQLQNETR (9aa)
- NQSVPLSCCR (10aa)
- ILPGGNTSFDVVFLAR (16aa)
- HNLTIFFDVK (10aa)