Hex:9 HexNAc:2

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Acremonium sp. HI-25
• Androctonus australis (Sahara scorpion)
• Actinidia chinensis (Kiwi fruit)
• Apium graveolens var. oulce (Celery)
• Artemisia vulgaris (Mugwort)
• Daucus carota (Carrot)
• Lycopersicon esculentum (Tomato)
• Nicotiana alata (Persian tobacco)
• Solanum tuberosum (Potato)
• Asterias rubens (European starfish)
• Columba livia (Domestic pigeon)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Unio elongatulus
• Physomitrella patens
• Fagopyrum esculentum (Common buckwheat)
• Torpedo californica (Pacific electric ray)
• Caenorhabditis elegans
• Trichinella spiralis
• Aspergillus niger
• Agaricus bisporus (Common mushroom)
• Aedes aegypti (Yellow fever mosquito)
• Antheraea pernyi (Chinese oak silkmoth)
• Apis mellifera (Honeybee)
• Bombyx mori (Domestic silkworm)
• Drosophila melanogaster (Fruit fly)
• Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
• Drosophila melanogaster (fdl mutant) (Fruit fly)
• Mamestra brassicae
• Spodoptera frugiperda (Fall armyworm)
• Leptomonas Samueli
• Trypanosoma brucei brucei
• Trypansoma brucei
• Persea americana (Avocado)
• Naja kaouthia (Monocled cobra)
• Allium cepa (Onion)
• Asparagus officinalis (Garden asparagus)
• Musa acuminata (Banana)
• Oryza sativa (Rice)
• Cherax quadricarinatus (Australian red claw crayfish)
• Pontastacus leptodactylus (Narrow-clawed crayfish)
• Friend mink cell focus-forming virus
• Friend spleen focus-forming virus
• Friend spleen focus-forming virus (anemia inducing strain)
• Friend spleen focus-forming virus (gm1 mutant)
• Friend spleen focus-forming virus (gm1.2 mutant)
• Friend spleen focus-forming virus (gm1.2.3 mutant)
• Friend spleen focus-forming virus (gm3 mutant)
• Friend spleen focus-forming virus (gm3.4 mutant)
• Human immunodeficiency virus (Hiv)
• Human immunodeficiency virus type 1 (bh8 isolate) (Hiv-1 (bh8 isolate))
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Arabidopsis thaliana (Thale cress)
• Brassica oleracea var. botrytis (Cauliflower)
• Canavalia ensiformis (Jack bean)
• Carica papaya (Papaya)
• Citrus sinensis (Orange)
• Corylus avellana (Hazelnut)
• Fragaria x ananassa (Strawberry)
• Glycine max (Soybean)
• Juglans regia (English walnut)
• Malus domestica var. golden delicious (Cultivated apple - golden delicious)
• Phaseolus lunatus (Lima bean)
• Phaseolus vulgaris (Kidney bean)
• Pistacia vera (Pistachio)
• Pisum sativum (Pea)
• Prunus dulcis var. sativa (Sweet almond)
• Pyrus communis var. williams (Pear)
• Ricinus communis (Castor bean)
• Vigna radiata var. radiata (Mung bean)
• Saccharomyces cerevisiae (Baker's yeast)
• Influenza a virus (strain a/fowl plague virus/rostock/34)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• Schistosoma mansoni
• Riftia pachyptila (Giant tubeworm)

Protein

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens    Q16880
• 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens    P04035
• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Acid ceramidase / Homo sapiens    Q13510
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Agrin / Homo sapiens    O00468
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-acid glycoprotein 2 / Homo sapiens    P19652
• Alpha-2-macroglobulin-like protein 1 / Homo sapiens    A8K2U0
• Alpha-galactosidase A / Homo sapiens    P06280
• Alpha-L-iduronidase / Homo sapiens    P35475
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Amphoterin-induced protein 2 / Homo sapiens    Q86SJ2
• Angiotensin-converting enzyme / Homo sapiens    P12821
• Anoctamin-6 / Homo sapiens    Q4KMQ2
• Antithrombin-III / Homo sapiens    P01008
• Apolipoprotein b-100 / Homo sapiens    P04114
• Apolipoprotein d / Homo sapiens    P05090
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens    Q12797
• ATP-binding cassette sub-family A member 1 / Homo sapiens    O95477
• ATP-binding cassette sub-family A member 2 / Homo sapiens    Q9BZC7
• ATP-binding cassette sub-family A member 7 / Homo sapiens    Q8IZY2
• Attractin / Homo sapiens    O75882
• Basigin / Homo sapiens    P35613
• Beta-glucuronidase / Homo sapiens    P08236
• Beta-hexosaminidase subunit alpha / Homo sapiens    P06865
• Beta-secretase / Homo sapiens    P56817
• Biglycan / Homo sapiens    P21810
• C-type mannose receptor 2 / Homo sapiens    Q9UBG0
• Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens    Q9NYQ6
• Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens    Q9HCU4
• Cadherin-5 / Homo sapiens    P33151
• Calcium-activated chloride channel regulator 2 / Homo sapiens    Q9UQC9
• Calponin-3 / Homo sapiens    Q15417
• Calreticulin / Homo sapiens    P27797
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• Cartilage oligomeric matrix protein / Homo sapiens    P49747
• Cartilage-associated protein / Homo sapiens    O75718
• Cathepsin D / Homo sapiens    P07339
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD109 antigen / Homo sapiens    Q6YHK3
• CD166 antigen / Homo sapiens    Q13740
• CD82 antigen / Homo sapiens    P27701
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens    O75503
• Choline transporter-like protein 4 / Homo sapiens    Q53GD3
• Chondroitin sulfate glucuronyltransferase / Homo sapiens    Q9P2E5
• Cleft lip and palate transmembrane protein 1 / Homo sapiens    O96005
• Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens    Q96KA5
• Clusterin / Homo sapiens    P10909
• Coagulation factor VIII / Homo sapiens    P00451
• Coiled-coil domain-containing protein 80 / Homo sapiens    Q76M96
• Collagen alpha-1(I) chain / Homo sapiens    P02452
• Collagen alpha-1(III) chain / Homo sapiens    P02461
• Collagen alpha-1(V) chain / Homo sapiens    P20908
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(I) chain / Homo sapiens    P08123
• Collagen alpha-2(V) chain / Homo sapiens    P05997
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-6(VI) chain / Homo sapiens    A6NMZ7
• Complement C2 / Homo sapiens    P06681
• Complement c3 / Homo sapiens    P01024
• Complement c4-a / Homo sapiens    P0C0L4
• Complement C4-B / Homo sapiens    P0C0L5
• CUB domain-containing protein 1 / Homo sapiens    Q9H5V8
• Cytokine receptor-like factor 1 / Homo sapiens    O75462
• Deoxyribonuclease-2-alpha / Homo sapiens    O00115
• Desmocollin-2 / Homo sapiens    Q02487
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens    O14672
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens    Q13444
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens    P04843
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens    P46977
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens    Q8TCJ2
• Dystroglycan / Homo sapiens    Q14118
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens    Q14264
• Endoplasmin / Homo sapiens    P14625
• Ephrin-A3 / Homo sapiens    P52797
• Epidermal growth factor receptor / Homo sapiens    P00533
• ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens    Q9BZQ6
• ER membrane protein complex subunit 1 / Homo sapiens    Q8N766
• ER membrane protein complex subunit 10 / Homo sapiens    Q5UCC4
• Erlin-1 / Homo sapiens    O75477
• Erlin-2 / Homo sapiens    O94905
• ERO1-like protein alpha / Homo sapiens    Q96HE7
• Extracellular sulfatase Sulf-1 / Homo sapiens    Q8IWU6
• Extracellular sulfatase Sulf-2 / Homo sapiens    Q8IWU5
• Fibrillin-1 / Homo sapiens    P35555
• Fibroblast growth factor receptor 1 / Homo sapiens    P11362
• Fibronectin / Homo sapiens    P02751
• Folate receptor alpha / Homo sapiens    P15328
• Follistatin-related protein 1 / Homo sapiens    Q12841
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Glucosidase 2 subunit beta / Homo sapiens    P14314
• Glucoside xylosyltransferase 1 / Homo sapiens    Q4G148
• Glucosylceramidase / Homo sapiens    P04062
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• GPI ethanolamine phosphate transferase 1 / Homo sapiens    O95427
• Heat shock 70 kDa protein 13 / Homo sapiens    P48723
• Hemopexin / Homo sapiens    P02790
• Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens    Q68CP4
• HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens    P01892
• HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens    P30450
• HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens    P30512
• HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens    P04439
• HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens    P16188
• HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens    P16189
• HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens    P16190
• HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens    P30453
• HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens    P30456
• HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens    P30457
• HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens    P01891
• HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens    P10316
• HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens    P30459
• HLA class I histocompatibility antigen, alpha chain E / Homo sapiens    P13747
• HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens    P30462
• HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens    P30464
• HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens    P30466
• HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens    P30685
• HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens    P18463
• HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens    Q95365
• HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens    P30475
• HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens    Q04826
• HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens    P30480
• HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens    P30484
• HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens    P30485
• HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens    P30486
• HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens    Q29836
• HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens    P01889
• HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens    P30460
• HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens    Q31610
• HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens    Q29718
• HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens    P30499
• HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens    P30508
• HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens    P30510
• HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens    Q07000
• HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens    Q29960
• HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens    Q95604
• HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens    Q29865
• HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens    P30501
• HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens    P04222
• HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens    P30504
• HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens    Q9TNN7
• HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens    P10321
• HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens    P30505
• HLA class II histocompatibility antigen gamma chain / Homo sapiens    P04233
• HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens    P01903
• HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens    P04229
• HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens    Q30167
• HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens    Q9TQE0
• Hyaluronidase-4 / Homo sapiens    Q2M3T9
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin superfamily member 8 / Homo sapiens    Q969P0
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens    P35858
• Integrin alpha-1 / Homo sapiens    P56199
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-6 / Homo sapiens    P23229
• Integrin alpha-M / Homo sapiens    P11215
• Integrin alpha-V / Homo sapiens    P06756
• Integrin alpha-X / Homo sapiens    P20702
• Integrin beta-1 / Homo sapiens    P05556
• Integrin beta-3 / Homo sapiens    P05106
• Integrin beta-5 / Homo sapiens    P18084
• Integrin beta-6 / Homo sapiens    P18564
• Interferon-gamma receptor alpha chain / Homo sapiens    P15260
• Interleukin-6 receptor subunit beta / Homo sapiens    P40189
• KDEL motif-containing protein 2 / Homo sapiens    Q7Z4H8
• Lactadherin / Homo sapiens    Q08431
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-2 / Homo sapiens    P24043
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit beta-2 / Homo sapiens    P55268
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Lipase member J / Homo sapiens    Q5W064
• Lipase member K / Homo sapiens    Q5VXJ0
• Liver carboxylesterase 1 / Homo sapiens    P23141
• Low-density lipoprotein receptor-related protein 1B / Homo sapiens    Q9NZR2
• Low-density lipoprotein receptor-related protein 5 / Homo sapiens    O75197
• Lumican / Homo sapiens    P51884
• Lymphoid enhancer-binding factor 1 / Homo sapiens    Q9UJU2
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens    P38571
• Lysosomal acid phosphatase / Homo sapiens    P11117
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Lysosomal Pro-X carboxypeptidase / Homo sapiens    P42785
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Macrosialin / Homo sapiens    P34810
• Mammaglobin-A / Homo sapiens    Q13296
• Mammaglobin-B / Homo sapiens    O75556
• Mannosyl-oligosaccharide glucosidase / Homo sapiens    Q13724
• Melanoma inhibitory activity protein 3 / Homo sapiens    Q5JRA6
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Monoacylglycerol lipase ABHD12 / Homo sapiens    Q8N2K0
• Monocyte differentiation antigen cd14 / Homo sapiens    P08571
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• Myelin protein zero-like protein 2 / Homo sapiens    O60487
• N-acetylgalactosamine-6-sulfatase / Homo sapiens    P34059
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens    Q9NY97
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Neurofascin / Homo sapiens    O94856
• Neuroplastin / Homo sapiens    Q9Y639
• Neutral amino acid transporter B(0) / Homo sapiens    Q15758
• Nicalin / Homo sapiens    Q969V3
• Nicastrin / Homo sapiens    Q92542
• Nodal modulator 1 / Homo sapiens    Q15155
• Nodal modulator 2 / Homo sapiens    Q5JPE7
• Nodal modulator 3 / Homo sapiens    P69849
• Nuclear envelope integral membrane protein 1 / Homo sapiens    O14524
• Nuclear pore membrane glycoprotein 210 / Homo sapiens    Q8TEM1
• Nucleolar protein 56 / Homo sapiens    O00567
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Osteopetrosis-associated transmembrane protein 1 / Homo sapiens    Q86WC4
• P2X purinoceptor 7 / Homo sapiens    Q99572
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens    O95302
• Peroxidasin homolog / Homo sapiens    Q92626
• Phospholipase B-like 1 / Homo sapiens    Q6P4A8
• Phospholipase D3 / Homo sapiens    Q8IV08
• PI-PLC X domain-containing protein 3 / Homo sapiens    Q63HM9
• Plasma protease c1 inhibitor / Homo sapiens    P05155
• Plasminogen / Homo sapiens    P00747
• Platelet glycoprotein 4 / Homo sapiens    P16671
• Platelet-derived growth factor subunit b / Homo sapiens    P01127
• Plexin-B2 / Homo sapiens    O15031
• Plexin-c1 / Homo sapiens    O60486
• Plexin-D1 / Homo sapiens    Q9Y4D7
• Podocalyxin / Homo sapiens    O00592
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Probable C-mannosyltransferase DPY19L4 / Homo sapiens    Q7Z388
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Procollagen galactosyltransferase 1 / Homo sapiens    Q8NBJ5
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens    O00469
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens    O60568
• Progranulin / Homo sapiens    P28799
• Prolactin-inducible protein / Homo sapiens    P12273
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prolyl 3-hydroxylase 1 / Homo sapiens    Q32P28
• Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens    P13674
• Prosalusin / Homo sapiens    Q8N2E6
• Prosaposin / Homo sapiens    P07602
• Prostaglandin G/H synthase 1 / Homo sapiens    P23219
• Prostaglandin G/H synthase 2 / Homo sapiens    P35354
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein CREG1 / Homo sapiens    O75629
• Protein O-mannosyl-transferase 2 / Homo sapiens    Q9UKY4
• Protein OS-9 / Homo sapiens    Q13438
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Protein turtle homolog A / Homo sapiens    Q9P2J2
• Protein Wnt-5a / Homo sapiens    P41221
• Protocadherin alpha-12 / Homo sapiens    Q9UN75
• Protocadherin beta-10 / Homo sapiens    Q9UN67
• Protocadherin beta-11 / Homo sapiens    Q9Y5F2
• Protocadherin beta-14 / Homo sapiens    Q9Y5E9
• Protocadherin beta-15 / Homo sapiens    Q9Y5E8
• Protocadherin beta-16 / Homo sapiens    Q9NRJ7
• Protocadherin beta-2 / Homo sapiens    Q9Y5E7
• Protocadherin beta-3 / Homo sapiens    Q9Y5E6
• Protocadherin beta-5 / Homo sapiens    Q9Y5E4
• Protocadherin beta-8 / Homo sapiens    Q9UN66
• Protocadherin beta-9 / Homo sapiens    Q9Y5E1
• Receptor tyrosine-protein kinase erbB-2 / Homo sapiens    P04626
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Rho-related BTB domain-containing protein 3 / Homo sapiens    O94955
• Seipin / Homo sapiens    Q96G97
• Semaphorin-4D / Homo sapiens    Q92854
• Serine--tRNA ligase, cytoplasmic / Homo sapiens    P49591
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens    Q5H9R7
• Serotransferrin / Homo sapiens    P02787
• Serpin h1 / Homo sapiens    P50454
• Serum paraoxonase/arylesterase 2 / Homo sapiens    Q15165
• Sialate O-acetylesterase / Homo sapiens    Q9HAT2
• Sialomucin core protein 24 / Homo sapiens    Q04900
• Signal transducer CD24 / Homo sapiens    P25063
• Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens    O43166
• Sodium channel protein type 4 subunit alpha / Homo sapiens    P35499
• Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens    Q9UN76
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens    P05026
• Solute carrier family 12 member 7 / Homo sapiens    Q9Y666
• Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens    P11166
• Sortilin / Homo sapiens    Q99523
• Sortilin-related receptor / Homo sapiens    Q92673
• Sparc / Homo sapiens    P09486
• Stromal interaction molecule 1 / Homo sapiens    Q13586
• SUN domain-containing ossification factor / Homo sapiens    Q9UBS9
• Superoxide dismutase [Cu-Zn] / Homo sapiens    P00441
• Suppressor of tumorigenicity 14 protein / Homo sapiens    Q9Y5Y6
• Synaptonemal complex protein SC65 / Homo sapiens    Q92791
• Synaptophysin-like protein 1 / Homo sapiens    Q16563
• Tapasin / Homo sapiens    O15533
• Tetraspanin-3 / Homo sapiens    O60637
• Tetratricopeptide repeat protein 17 / Homo sapiens    Q96AE7
• Thioredoxin domain-containing protein 15 / Homo sapiens    Q96J42
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thrombospondin-3 / Homo sapiens    P49746
• Thyroglobulin / Homo sapiens    P01266
• TM2 domain-containing protein 1 / Homo sapiens    Q9BX74
• TM2 domain-containing protein 3 / Homo sapiens    Q9BRN9
• Toll-like receptor 2 / Homo sapiens    O60603
• Torsin-1A / Homo sapiens    O14656
• Torsin-1B / Homo sapiens    O14657
• Torsin-2A / Homo sapiens    Q5JU69
• Transcobalamin-1 / Homo sapiens    P20061
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Transforming growth factor beta-3 / Homo sapiens    P10600
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Transmembrane protein 131 / Homo sapiens    Q92545
• Transmembrane protein 2 / Homo sapiens    Q9UHN6
• Transmembrane protein 231 / Homo sapiens    Q9H6L2
• Transmembrane protein 8A / Homo sapiens    Q9HCN3
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens    P29965
• Twisted gastrulation protein homolog 1 / Homo sapiens    Q9GZX9
• UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens    Q9NYU2
• Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens    Q6NSJ0
• Uncharacterized protein from Blood Serum / Homo sapiens    
• UPF0577 protein KIAA1324 / Homo sapiens    Q6UXG2
• Uromodulin / Homo sapiens    P07911
• Uroplakin-3b-like protein / Homo sapiens    B0FP48
• V-type proton ATPase subunit e 1 / Homo sapiens    O15342
• V-type proton ATPase subunit S1 / Homo sapiens    Q15904
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens    P54289
• Von willebrand factor / Homo sapiens    P04275
• Zinc transporter ZIP6 / Homo sapiens    Q13433
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Zymogen granule protein 16 homolog B / Homo sapiens    Q96DA0
• Beta-lactoglobulin / Bos taurus    P02754
• Lactotransferrin / Bos taurus    P24627
• Platelet glycoprotein IV / Bos taurus    P26201
• Ribonuclease pancreatic [b] / Bos taurus    P61823
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus    
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus    Q64676
• Adhesion G protein-coupled receptor F5 / Mus musculus    G5E8Q8
• Alpha-(1,3)-fucosyltransferase 11 / Mus musculus    Q8BHC9
• Alpha-L-iduronidase / Mus musculus    P48441
• ATP-binding cassette sub-family A member 1 / Mus musculus    P41233
• ATP-binding cassette sub-family A member 2 / Mus musculus    P41234
• ATP-binding cassette sub-family A member 7 / Mus musculus    Q91V24
• ATPase family AAA domain-containing protein 1 / Mus musculus    Q9D5T0
• Attractin / Mus musculus    Q9WU60
• Basigin / Mus musculus    P18572
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Beta-hexosaminidase subunit alpha / Mus musculus    P29416
• Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus    Q8BTJ4
• Bone morphogenetic protein receptor type-2 / Mus musculus    O35607
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cadherin-10 / Mus musculus    P70408
• Cadherin-2 / Mus musculus    P15116
• Cadherin-4 / Mus musculus    P39038
• Calsyntenin-2 / Mus musculus    Q9ER65
• Carbohydrate sulfotransferase 8 / Mus musculus    Q8BQ86
• Carbonic anhydrase-related protein 11 / Mus musculus    O70354
• Carboxypeptidase E / Mus musculus    Q00493
• Carboxypeptidase M / Mus musculus    Q80V42
• Cation-dependent mannose-6-phosphate receptor / Mus musculus    P24668
• CD180 antigen / Mus musculus    Q62192
• Cell cycle control protein 50A / Mus musculus    Q8VEK0
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus    Q8VBZ3
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus    Q8BXA5
• Clusterin / Mus musculus    Q06890
• Contactin-1 / Mus musculus    P12960
• Contactin-3 / Mus musculus    Q07409
• Contactin-associated protein 1 / Mus musculus    O54991
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• CUB and sushi domain-containing protein 1 / Mus musculus    Q923L3
• Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus    F6VAN0
• Cystatin-C / Mus musculus    P21460
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus    O35598
• Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus    Q9R1V7
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus    P46978
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus    Q3TDQ1
• Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus    Q4VA61
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus    Q9R1E6
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus    Q9EQG7
• Embigin / Mus musculus    P21995
• Endoplasmin / Mus musculus    P08113
• Ephrin-A1 / Mus musculus    P52793
• ER membrane protein complex subunit 1 / Mus musculus    Q8C7X2
• ER membrane protein complex subunit 10 / Mus musculus    Q3TAS6
• Erlin-1 / Mus musculus    Q91X78
• Erlin-2 / Mus musculus    Q8BFZ9
• ERO1-like protein alpha / Mus musculus    Q8R180
• Excitatory amino acid transporter 2 / Mus musculus    P43006
• Galactose-3-O-sulfotransferase 3 / Mus musculus    P61315
• Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus    Q9CW73
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus    P62812
• Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus    P26048
• Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus    P26049
• Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus    Q8BHJ7
• Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus    P22723
• Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus    Q9WV18
• Gamma-glutamyltransferase 7 / Mus musculus    Q99JP7
• Glia-derived nexin / Mus musculus    Q07235
• Glutamate carboxypeptidase 2 / Mus musculus    O35409
• Glutamate receptor 4 / Mus musculus    Q9Z2W8
• Glutamate receptor ionotropic, kainate 2 / Mus musculus    P39087
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus    P35438
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus    Q01097
• Glycerophosphodiester phosphodiesterase 1 / Mus musculus    Q9JL56
• Glycine receptor subunit beta / Mus musculus    P48168
• GPI inositol-deacylase / Mus musculus    Q3UUQ7
• Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus    Q3UDW8
• Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus    Q9QYK5
• Hepatocyte cell adhesion molecule / Mus musculus    Q640R3
• Hypoxia up-regulated protein 1 / Mus musculus    Q9JKR6
• Immunoglobulin gamma-2a heavy chain / Mus musculus    
• Inactive dipeptidyl peptidase 10 / Mus musculus    Q6NXK7
• Insulin receptor / Mus musculus    P15208
• Integrin alpha-1 / Mus musculus    Q3V3R4
• Integrin alpha-M / Mus musculus    P05555
• Integrin alpha-V / Mus musculus    P43406
• Integrin beta-1 / Mus musculus    P09055
• Integrin beta-2 / Mus musculus    P11835
• Interleukin-1 receptor accessory protein-like 1 / Mus musculus    P59823
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus    Q80TS3-2
• Isoform 2 of Catenin delta-1 / Mus musculus    P30999-2
• Isoform 2 of Integrin alpha-3 / Mus musculus    Q62470-2
• Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus    Q2VLH6-2
• Isoform 2 of Teneurin-4 / Mus musculus    Q3UHK6-2
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Kinesin-like protein / Mus musculus    P33173
• Lactadherin / Mus musculus    P21956
• Laminin subunit alpha-1 / Mus musculus    P19137
• Laminin subunit alpha-2 / Mus musculus    Q60675
• Laminin subunit alpha-5 / Mus musculus    Q61001
• Leucine rich repeat protein 2, neuronal / Mus musculus    Q6PHP6
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus    Q9D1T0
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus    Q3URE9
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus    Q6GQU6
• Leucine-rich repeat-containing protein 24 / Mus musculus    Q8BHA1
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Lysosomal acid phosphatase / Mus musculus    P24638
• Lysosomal protective protein / Mus musculus    P16675
• Lysosome membrane protein 2 / Mus musculus    O35114
• Lysosome-associated membrane glycoprotein 5 / Mus musculus    Q9D387
• MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus    Q0PMG2
• Membralin / Mus musculus    Q8CIV2
• Metal transporter CNNM4 / Mus musculus    Q69ZF7
• Multiple epidermal growth factor-like domains protein 8 / Mus musculus    P60882
• N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus    Q6S5C2
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neural cell adhesion molecule L1-like protein / Mus musculus    P70232
• Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus    Q61477
• Neuroendocrine convertase 2 / Mus musculus    P21661
• Neurofascin / Mus musculus    A0A087WPX3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuronal pentraxin-1 / Mus musculus    Q62443
• Neuroplastin / Mus musculus    P97300
• Nicastrin / Mus musculus    P57716
• Niemann-Pick C1 protein / Mus musculus    O35604
• Nodal modulator 1 / Mus musculus    Q6GQT9
• Noelin / Mus musculus    O88998
• Nuclear pore membrane glycoprotein 210 / Mus musculus    Q9QY81
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Osteopetrosis-associated transmembrane protein 1 / Mus musculus    Q8BGT0
• P2X purinoceptor 4 / Mus musculus    Q9JJX6
• P2X purinoceptor 7 / Mus musculus    Q9Z1M0
• Phosphatidylcholine-sterol acyltransferase / Mus musculus    P16301
• Phospholipase D3 / Mus musculus    O35405
• Platelet glycoprotein 4 / Mus musculus    Q08857
• Plexin-A2 / Mus musculus    P70207
• Plexin-A4 / Mus musculus    Q80UG2
• Plexin-B1 / Mus musculus    Q8CJH3
• Plexin-B2 / Mus musculus    B2RXS4
• Plexin-C1 / Mus musculus    Q9QZC2
• Prenylcysteine oxidase / Mus musculus    Q9CQF9
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus    Q9R0E2
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus    Q9R0E1
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Prostaglandin g/h synthase 2 / Mus musculus    Q05769
• Prostaglandin-H2 D-isomerase / Mus musculus    O09114
• Protein disulfide-isomerase TMX3 / Mus musculus    Q8BXZ1
• Protein FAM234B / Mus musculus    Q8BYI8
• Protein kinase C-binding protein NELL2 / Mus musculus    Q61220
• Protein O-glucosyltransferase 1 / Mus musculus    Q8BYB9
• Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus    Q8BW41
• Protein OS-9 / Mus musculus    Q8K2C7
• Protein sel-1 homolog 1 / Mus musculus    Q9Z2G6
• Protocadherin Fat 1 / Mus musculus    F2Z4A3
• Receptor-type tyrosine-protein phosphatase zeta / Mus musculus    B9EKR1
• Reelin / Mus musculus    Q60841
• Semaphorin-3E / Mus musculus    P70275
• Semaphorin-4D / Mus musculus    O09126
• Semaphorin-4F / Mus musculus    Q9Z123
• Semaphorin-7A / Mus musculus    Q9QUR8
• Serotransferrin / Mus musculus    Q921I1
• Serpin H1 / Mus musculus    P19324
• Serum paraoxonase/arylesterase 2 / Mus musculus    Q62086
• Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus    Q64689
• Sialic acid-binding Ig-like lectin / Mus musculus    B7ZMQ5
• Sodium channel protein type 1 subunit alpha / Mus musculus    A2APX8
• Sodium channel subunit beta-1 / Mus musculus    P97952
• Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus    Q8BJI1
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus    P14094
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Solute carrier family 12 member 5 / Mus musculus    Q91V14
• Sortilin / Mus musculus    Q6PHU5
• Sortilin-related receptor / Mus musculus    O88307
• SPARC / Mus musculus    P07214
• SPARC-like protein 1 / Mus musculus    P70663
• Synaptic vesicle glycoprotein 2A / Mus musculus    Q9JIS5
• T-cell immunomodulatory protein / Mus musculus    Q99KW9
• Teneurin-2 / Mus musculus    Q9WTS5
• Testican-2 / Mus musculus    Q9ER58
• Tetraspanin-3 / Mus musculus    Q9QY33
• Thioredoxin domain-containing protein 15 / Mus musculus    Q6P6J9
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• TM2 domain-containing protein 3 / Mus musculus    Q8BJ83
• Torsin-1B / Mus musculus    Q9ER41
• Translocon-associated protein subunit alpha / Mus musculus    Q9CY50
• Translocon-associated protein subunit beta / Mus musculus    Q9CPW5
• Transmembrane and TPR repeat-containing protein 4 / Mus musculus    Q8BG19
• Transmembrane emp24 domain-containing protein 9 / Mus musculus    Q99KF1
• Transmembrane protein 106B / Mus musculus    Q80X71
• Transmembrane protein 131 / Mus musculus    O70472
• Transmembrane protein 158 / Mus musculus    Q6F5E0
• Transmembrane protein 181a / Mus musculus    Q3U3W2
• Transmembrane protein 8B / Mus musculus    B1AWJ4
• Tripeptidyl-peptidase 1 / Mus musculus    O89023
• Tyrosine-protein kinase Mer / Mus musculus    Q60805
• Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus    Q9D906
• UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus    Q920V1
• Uncharacterized protein / Mus musculus    
• UPF0577 protein KIAA1324-like homolog / Mus musculus    Q3UZV7
• V-type proton ATPase subunit S1 / Mus musculus    Q9R1Q9
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus    Q6PHS9
• VPS10 domain-containing receptor SorCS1 / Mus musculus    Q9JLC4
• Zinc transporter ZIP12 / Mus musculus    Q5FWH7
• Zona pellucida sperm-binding protein matrix / Mus musculus    Q62005    P10761    P20239
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Uncharacterized protein / Rattus norvegicus    
• Coagulation factor VIII / Sus scrofa    P12263
• Ascorbate oxidase / Acremonium sp. HI-25    
• Hemocyanin / Androctonus australis    
• Uncharacterized protein / Actinidia chinensis    
• Uncharacterized protein / Apium graveolens var. oulce    
• Art v II / Artemisia vulgaris    
• Uncharacterized protein / Daucus carota    
• Uncharacterized protein / Lycopersicon esculentum    
• Ribonuclease s-6 / Nicotiana alata    Q40379
• Uncharacterized protein / Solanum tuberosum    
• Uncharacterized protein from Ovary / Asterias rubens    
• Immunoglobulin gamma / Columba livia    
• Immunoglobulin y / Coturnix coturnix japonica    
• Immunoglobulin gamma / Gallus gallus    
• Immunoglobulin y / Gallus gallus    
• Gp273 / Unio elongatulus    
• Uncharacterized protein / Physomitrella patens    
• Uncharacterized protein / Fagopyrum esculentum    
• Acetylcholine receptor protein / Torpedo californica    P02710    P02714    P02712    P02718
• Uncharacterized protein / Caenorhabditis elegans    
• Uncharacterized protein / Caenorhabditis elegans    
• Tsl-1 antigens / Trichinella spiralis    
• Uncharacterized protein / Trichinella spiralis    
• Alpha-galactosidase a / Aspergillus niger    P28351
• Alpha-glucosidase / Aspergillus niger    P56526
• Endopolygalacturonase II / Aspergillus niger    P26214
• Uncharacterized protein / Agaricus bisporus    
• Uncharacterized protein / Aedes aegypti    
• Arylphorin / Antheraea pernyi    Q7Z1F8
• Uncharacterized protein from Hemolymph / Antheraea pernyi    
• Apisin / Apis mellifera    O18330
• Hyaluronoglucosaminidase / Apis mellifera    Q08169
• Uncharacterized protein from Royal Jelly / Apis mellifera    
• Membrane glycoproteins / Bombyx mori    
• Sex-specific storage-protein 2 / Bombyx mori    P20613
• Uncharacterized protein / Drosophila melanogaster    
• Membrane glycoproteins / Mamestra brassicae    
• Membrane glycoproteins / Spodoptera frugiperda    
• Uncharacterized protein / Leptomonas Samueli    
• Uncharacterized protein / Trypanosoma brucei brucei    
• Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei    P26334
• Variant surface glycoprotein mitat 1.4a / Trypansoma brucei    P02896
• Uncharacterized protein / Persea americana    
• Cobra venom factor / Naja kaouthia    Q91132
• Uncharacterized protein / Allium cepa    
• Uncharacterized protein / Asparagus officinalis    
• Uncharacterized protein / Musa acuminata    
• Alpha-amylase / Oryza sativa    P17654
• Vitellogenin / Cherax quadricarinatus    Q9GSG2
• Hemocyanin / Pontastacus leptodactylus    P83180
• Envelope glycoprotein / Friend mink cell focus-forming virus    
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus    P03393
• Gp55 / Friend spleen focus-forming virus (anemia inducing strain)    
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)    P03393
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)    P03393
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)    P03393
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant)    P03393
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)    P03393
• Surface protein gp120 / Human immunodeficiency virus    
• Surface protein gp120 / Human immunodeficiency virus type 1 (bh8 isolate)    P04582
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Uncharacterized protein / Arabidopsis thaliana    
• Uncharacterized protein / Arabidopsis thaliana    
• Uncharacterized protein / Brassica oleracea var. botrytis    
• Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis    Q6YDN9
• Alpha-mannosidase / Canavalia ensiformis    C0HJB3
• Uncharacterized protein / Carica papaya    
• Uncharacterized protein / Carica papaya    
• Uncharacterized protein / Citrus sinensis    
• Uncharacterized protein / Corylus avellana    
• Uncharacterized protein / Fragaria x ananassa    
• Lectin / Glycine max    P05046
• Uncharacterized protein / Glycine max    
• Uncharacterized protein / Juglans regia    
• Uncharacterized protein / Malus domestica var. golden delicious    
• Uncharacterized protein / Phaseolus lunatus    
• Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris    P02873
• Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris    P02873
• Phaseolin, alpha-type / Phaseolus vulgaris    P07219
• Phaseolin, beta-type / Phaseolus vulgaris    P02853
• Uncharacterized protein / Phaseolus vulgaris    
• Uncharacterized protein / Pistacia vera    
• Uncharacterized protein / Pisum sativum    
• Uncharacterized protein / Prunus dulcis var. sativa    
• Uncharacterized protein / Pyrus communis var. williams    
• Uncharacterized protein / Ricinus communis    
• Uncharacterized protein / Vigna radiata var. radiata    
• Invertase / Saccharomyces cerevisiae    
• Invertase 2 / Saccharomyces cerevisiae    P00724
• Invertase [secreted form] / Saccharomyces cerevisiae    
• Uncharacterized protein / Saccharomyces cerevisiae    
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)    P03459
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Uncharacterized protein / Schistosoma mansoni    
• Hemoglobin extracellular / Riftia pachyptila    

Source

• Blood (UBERON_0000178)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Coelomic Fluid (UBERON_0036217)  
• Electric Organ (UBERON_0006869)  
• Embryo (UBERON_0000922)  
• Hemolymph (UBERON_0001011)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   BHK21/13/Py6 (CVCL_LM74)   Plasma Membrane (GO_0005886)  
• Kidney (UBERON_0002113)   HEK293T (CVCL_0063)  
• Kidney (UBERON_0002113)   NRK (CVCL_3758)   Fibroblast (CL_0000057)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Lung (UBERON_0002048)   Mv1Lu (CVCL_0593)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   Lec1 (CVCL_3440)  
• Ovary (UBERON_0000992)   Sf21 (CVCL_0518)  
• Ovary (UBERON_0000992)   Sf9 (CVCL_0549)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Royal Jelly  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• Zona Pellucida (UBERON_0000086)  
• BM-N (CVCL_Z633)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• BW5147 (CVCL_3896)   Leukocyte (CL_0000738)  
• BW5147.PHAR2.7 (CVCL_VT60)   Leukocyte (CL_0000738)  
• CE (CVCL_6D96)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• IZD-MB-0503 (CVCL_C411)   Hemocyte (CL_0000387)  
• LSTM-AA-20A (CVCL_Z354)   Cell Surface (GO_0009986)  
• NIH 3T3 (CVCL_0594)   Fibroblast (CL_0000057)  
• Rat1 (CVCL_0492)  
• SPC-Mb-92-C6 (CVCL_VT62)  
• Sf21 (CVCL_0518)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Delipidated Cell  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Egg Cell   Jelly Coat  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Leukocyte (CL_0000738)  
• Lymphocyte (CL_0000542)  
• Cotyledon (BTO_0000300)  
• Endosperm (BTO_0000390)  
• Floret (BTO_0000468)  
• Fruit (BTO_0000486)  
• Leaf (BTO_0000713)  
• Pollen (BTO_0001097)  
• Root (BTO_0001188)  
• Seed (BTO_0001226)  
• Style (BTO_0001313)  
• Tuber (BTO_0001400)  
• Low-Density Lipoprotein Particle (GO_0034362)  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(?1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
• N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)Man(a1-3)"
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
• N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / High-Mannose / Structure 3677
• N-Linked / High-Mannose / Structure 9447
• N-Linked / High-Mannose / Structure 9833
• N-Linked / High-Mannose / Structure 10029
• N-Linked / Undefined core / Structure 9685
• N-Linked / Undefined core / Structure 9708
• N-Linked / Undefined core / Structure 9798

Composition

• Hex:9 HexNAc:2 (avg mass : 1883.6869 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Erythroleukemia with associated Polycythemia
• Healthy
• Hypercholesterolemia, Familial (DOID:13810)
• Hyperimmune condition
• Leukemia, Acute lymphoblastic (DOID:9952)
• Lymphoma (DOID:0060058)
• Prostate cancer (DOID:10283)
• Waldenstrom Macroglobulinaemia (DOID:0060901)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
• Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
• Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
• Structural characterization of the N-glycan moiety and site of glycosylation in vitellogenin from the decapod crustacean Cherax quadricarinatus. (2004 - Khalaila I, Peter-Katalinic J, Tsang C, Radcliffe CM, Aflalo ED, Harvey DJ, Dwek RA, Rudd PM, Sagi A) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
• N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A. (2003 - Henriksson H, Denman SE, Campuzano ID, Ademark P, Master ER, Teeri TT, Brumer H) / Status : Reviewed
• Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
• N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
• Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
• Tandem mass spectrometry of ribonuclease A and B: N-linked glycosylation site analysis of whole protein ions (2002 - Reid, Stephenson, McLuckey) / Status : Reviewed
• Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
• Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
• Characterization of glycosylated variants of beta-lactoglobulin expressed in Pichia pastoris (2001 - Kalidas, Joshi, Batt) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
• N-linked oligosaccharides of cobra venom factor contain novel alpha(1-3)galactosylated Le(x) structures. (2001 - Gowda DC, Glushka J, van-Halbeek H , Thotakura RN, Bredehorst R, Vogel C-W) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• The nematode Caenorhabditis elegans synthesizes unusual O-linked glycans: identification of glucose-substituted mucin-type O-glycans and short chondroitin-like oligosaccharides (2001 - Guerardel, Balanzino, Maes, Leroy, Coddeville, Oriol, Strecker) / Status : Reviewed
• Structural characterization of the N-glycans of gp273, the ligand for sperm-egg interaction in the mollusc bivalve Unio elongatulus. (2001 - Di Patrizi L, Capone A, Focarelli R, Rosati F, Gallego RG, Gerwig GJ, Vliegenthart JF) / Status : Reviewed
• Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
• Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
• Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
• In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
• Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• The N-glycans of jack bean alpha-mannosidase. Structure, topology and function. (1999 - Kimura Y, Hess D, Sturm A) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Characterization of N-glycans from Arabidopsis. Application to a fucose-deficient mutant. (1999 - Rayon C, Cabanes-Macheteau M, Loutelier-Bourhis C, Salliot-Maire I, Lemoine J, Reiter W, Lerouge P, Faye L) / Status : Reviewed
• Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
• Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
• Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
• Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
• Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
• Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
• Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
• The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
• The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
• N-linked sugar chains of 350-kDa royal jelly glycoprotein. (1995 - Kimura Y, Washino N, Yonekura M) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
• Glycosylation of glycoprotein 55 encoded by the anaemia-inducing strain of Friend spleen focus-forming virus. (1994 - Volker J, Geyer H, Geyer R) / Status : Reviewed
• A detailed structural characterization of ribonuclease B oligosaccharides by 1H NMR spectroscopy and mass spectrometry. (1994 - Fu D, Chen L, O'Neill R) / Status : Reviewed
• Novel structures of N-linked high-mannose type oligosaccharides containing alpha-D-galactofuranosyl linkages in Aspergillus niger alpha-D-glucosidase. (1994 - Takayanagi T, Kimura A, Chiba S, Ajisaka K) / Status : Reviewed
• Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
• The carbohydrate structures of Trypanosoma brucei brucei MITat 1.6 variant surface glycoprotein. A re-investigation of the C-terminal glycan. (1993 - Strang A, Allen A, Holder A, van Halbeek H) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
• Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
• Site-specific N-glycosylation and oligosaccharide structures of recombinant HIV-1 gp120 derived from a baculovirus expression system. (1993 - Yeh J, Seals J, Murphy C, van Halbeek H, Cummings R) / Status : Reviewed
• Isolation of oligomannose-type glycans from bean glycoproteins. (1993 - Lu Y, Ye J, Wold F) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
• Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
• Novel N-linked oligo-mannose type oligosaccharides containing an alpha-D-galactofuranosyl linkage found in alpha-D-galactosidase from Aspergillus niger. (1992 - Takayanagi T, Kushida K, Idonuma K, Ajisaka K) / Status : Reviewed
• Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
• Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
• The conformational effects of N-glycosylation on the tailpiece from serum IgM. (1991 - Wormald M, Wooten E, Bazzo R, Edge C, Feinstein A, Rademacher T, Dwek R) / Status : Reviewed
• Structural analysis of the glycoprotein allergen Art v II from the pollen of mugwort (Artemisia vulgaris L.). (1991 - Nilsen B, Sletten K, Paulsen B, O'Neill M, van Halbeek H) / Status : Reviewed
• Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
• Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
• Structure and biosynthesis of the xylose-containing carbohydrate moiety of rice alpha-amylase. (1990 - Hayashi M, Tsuru A, Mitsui T, Takahashi N, Hanzawa H, Arata Y, Akazawa T) / Status : Reviewed
• Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
• Structures of the asparagine-linked sugar chain of glucose transporter from human erythrocytes. (1990 - Endo T, Kasahara M, Kobata A) / Status : Reviewed
• Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
• Characterisation of the asparagine-linked oligosaccharides from Trypanosoma brucei type-I variant surface glycoproteins. (1990 - Zamze SE, Wooten EW, Ashford DA, Ferguson MA, Dwek RA, Rademacher TW) / Status : Reviewed
• The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Characterization of the high mannose asparagine-linked oligosaccharides synthesized by Schistosoma mansoni adult male worms. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
• Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
• Structure, position, and biosynthesis of the high mannose and the complex oligosaccharide side chains of the bean storage protein phaseolin. (1987 - Sturm A, Van Kuik J, Vliegenthart J, Chrispeels M) / Status : Reviewed
• Characterization of N-linked gluco-oligomannose type of carbohydrate chains of glycoproteins from the ovary of the starfish Asterias rubens (L.). (1987 - De Waard P, Kamerling JP, Van Halbeek H, Vliegenthart JF, Broertjes JJ) / Status : Reviewed
• Primary structure of the oligosaccharide moiety of hemocyanin from the scorpion Androctonus australis. (1986 - Debeire P, Montreuil J, Goyffon M, Van Kuik AJ, Halbeek HV, Vliegenthart JFG) / Status : Reviewed
• Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
• High-mannose structure of apolipoprotein-B from low-density lipoproteins of human plasma. (1985 - Vauhkonen M, Viitala J, Parkkinen J, Rauvala H) / Status : Reviewed
• The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed
• Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
• Primary structure of the carbohydrate chain of soybean agglutinin. A reinvestigation by high resolution 1H NMR spectroscopy (1981 - Dorland L, van Halbeek H, Vliegenthart JFG, Lis H, Sharon N) / Status : Reviewed
• Isolation and characterization of mosquito cell membrane glycoproteins. (1981 - Butters T, Hughes R) / Status : Reviewed
• Soybean agglutinin--a plant glycoprotein. Structure of the carboxydrate unit. (1978 - Lis H, Sharon N) / Status : Reviewed

Reported glycosite

• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
  •        Asn-333
  •        Asn-442
• 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens
  •        Asn-281
• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-424
• Acid ceramidase / Homo sapiens
  •        Asn-286
  •        Asn-342
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
  •        Asn-196
• Agrin / Homo sapiens
  •        Asn-777
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-33
  •        Asn-93
• Alpha-1-acid glycoprotein 2 / Homo sapiens
  •        Asn-33
• Alpha-2-macroglobulin-like protein 1 / Homo sapiens
  •        Asn-120
• Alpha-galactosidase A / Homo sapiens
  •        Asn-139
• Alpha-L-iduronidase / Homo sapiens
  •        Asn-372
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-503
• Amphoterin-induced protein 2 / Homo sapiens
  •        Asn-288
• Angiotensin-converting enzyme / Homo sapiens
  •        Asn-509
• Anoctamin-6 / Homo sapiens
  •        Asn-493
• Antithrombin-III / Homo sapiens
  •        Asn-187
• Apolipoprotein b-100 / Homo sapiens
  •        Undefined site
  •        Asn-185
• Apolipoprotein d / Homo sapiens
  •        Asn-65
• Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
  •        Asn-452
• ATP-binding cassette sub-family A member 1 / Homo sapiens
  •        Asn-1637
• ATP-binding cassette sub-family A member 2 / Homo sapiens
  •        Asn-628
• ATP-binding cassette sub-family A member 7 / Homo sapiens
  •        Asn-1518
• Attractin / Homo sapiens
  •        Asn-300
  •        Asn-383
  •        Asn-416
  •        Asn-1073
  •        Asn-1082
• Basigin / Homo sapiens
  •        Asn-268
• Beta-glucuronidase / Homo sapiens
  •        Asn-173
  •        Asn-272
  •        Asn-631
• Beta-hexosaminidase subunit alpha / Homo sapiens
  •        Asn-157
• Beta-secretase / Homo sapiens
  •        Undefined site
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• C-type mannose receptor 2 / Homo sapiens
  •        Asn-497
• Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
  •        Asn-1623
  •        Asn-1640
  •        Asn-1979
• Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
  •        Asn-1900
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Calcium-activated chloride channel regulator 2 / Homo sapiens
  •        Asn-637
• Calponin-3 / Homo sapiens
  •        Asn-240
• Calreticulin / Homo sapiens
  •        Asn-344
• Cartilage intermediate layer protein 1 / Homo sapiens
  •        Asn-550
• Cartilage oligomeric matrix protein / Homo sapiens
  •        Asn-742
• Cartilage-associated protein / Homo sapiens
  •        Asn-87
• Cathepsin D / Homo sapiens
  •        Asn-263
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-400
  •        Asn-581
  •        Asn-626
  •        Asn-1312
• CD109 antigen / Homo sapiens
  •        Asn-337
• CD166 antigen / Homo sapiens
  •        Asn-167
  •        Asn-265
  •        Asn-306
  •        Asn-480
• CD82 antigen / Homo sapiens
  •        Asn-198
• Ceramide synthase 2 / Homo sapiens
  •        Asn-19
• Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
  •        Asn-203
• Choline transporter-like protein 4 / Homo sapiens
  •        Asn-69
• Chondroitin sulfate glucuronyltransferase / Homo sapiens
  •        Asn-121
• Cleft lip and palate transmembrane protein 1 / Homo sapiens
  •        Asn-295
• Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
  •        Asn-229
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-103
  •        Asn-291
  •        Asn-354
  •        Asn-374
• Coagulation factor VIII / Homo sapiens
  •        Undefined site
• Coiled-coil domain-containing protein 80 / Homo sapiens
  •        Asn-835
• Collagen alpha-1(I) chain / Homo sapiens
  •        Asn-1365
• Collagen alpha-1(III) chain / Homo sapiens
  •        Asn-1367
• Collagen alpha-1(V) chain / Homo sapiens
  •        Asn-176
  •        Asn-1741
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-212
  •        Asn-537
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2206
  •        Asn-2528
  •        Asn-2679
• Collagen alpha-2(I) chain / Homo sapiens
  •        Asn-1267
• Collagen alpha-2(V) chain / Homo sapiens
  •        Asn-1400
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
  •        Asn-785
• Collagen alpha-6(VI) chain / Homo sapiens
  •        Asn-275
• Complement C2 / Homo sapiens
  •        Asn-621
• Complement c3 / Homo sapiens
  •        Asn-85
• Complement c4-a / Homo sapiens
  •        Asn-226
  •        Asn-1328
• Complement C4-B / Homo sapiens
  •        Asn-226
  •        Asn-1328
• CUB domain-containing protein 1 / Homo sapiens
  •        Asn-205
  •        Asn-310
  •        Asn-577
• Cytokine receptor-like factor 1 / Homo sapiens
  •        Asn-292
• Deoxyribonuclease-2-alpha / Homo sapiens
  •        Asn-86
• Desmocollin-2 / Homo sapiens
  •        Asn-392
  •        Asn-629
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
• Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens
  •        Asn-278
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
  •        Asn-389
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-157
  •        Asn-264
  •        Asn-452
  •        Asn-539
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens
  •        Asn-299
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
  •        Asn-537
  •        Asn-544
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
  •        Asn-616
  •        Asn-623
  •        Asn-641
• Dystroglycan / Homo sapiens
  •        Asn-661
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-294
• Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens
  •        Asn-105
• Endoplasmin / Homo sapiens
  •        Asn-62
  •        Asn-217
  •        Asn-502
• Ephrin-A3 / Homo sapiens
  •        Asn-100
• Epidermal growth factor receptor / Homo sapiens
  •        Asn-352
• ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens
  •        Asn-195
• ER membrane protein complex subunit 1 / Homo sapiens
  •        Asn-913
• ER membrane protein complex subunit 10 / Homo sapiens
  •        Asn-182
• Erlin-1 / Homo sapiens
  •        Asn-108
• Erlin-2 / Homo sapiens
  •        Asn-106
• ERO1-like protein alpha / Homo sapiens
  •        Asn-280
• Extracellular sulfatase Sulf-1 / Homo sapiens
  •        Asn-197
• Extracellular sulfatase Sulf-2 / Homo sapiens
  •        Asn-132
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Fibroblast growth factor receptor 1 / Homo sapiens
  •        Asn-317
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
• Folate receptor alpha / Homo sapiens
  •        Asn-161
• Follistatin-related protein 1 / Homo sapiens
  •        Asn-144
• Galectin-3-binding protein / Homo sapiens
  •        Asn-69
  •        Asn-125
  •        Asn-398
  •        Asn-551
  •        Asn-580
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-203
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Glucosidase 2 subunit beta / Homo sapiens
  •        Asn-476
• Glucoside xylosyltransferase 1 / Homo sapiens
  •        Asn-278
• Glucosylceramidase / Homo sapiens
  •        Asn-58
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-210
  •        Asn-786
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• GPI ethanolamine phosphate transferase 1 / Homo sapiens
  •        Asn-128
• Heat shock 70 kDa protein 13 / Homo sapiens
  •        Asn-184
• Hemopexin / Homo sapiens
  •        Asn-64
• Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
  •        Asn-461
• HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, alpha chain E / Homo sapiens
  •        Asn-107
• HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
  •        Asn-110
• HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
  •        Asn-110
• HLA class II histocompatibility antigen gamma chain / Homo sapiens
  •        Asn-130
  •        Asn-136
• HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
  •        Asn-103
  •        Asn-143
• HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
  •        Asn-48
• HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
  •        Asn-48
• Hyaluronidase-4 / Homo sapiens
  •        Asn-368
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-155
  •        Asn-222
  •        Asn-515
  •        Asn-862
  •        Asn-869
  •        Asn-931
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-275
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
  •        Asn-209
  •        Asn-272
  •        Asn-440
• Immunoglobulin superfamily member 8 / Homo sapiens
  •        Asn-327
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
  •        Asn-368
• Integrin alpha-1 / Homo sapiens
  •        Asn-460
• Integrin alpha-2 / Homo sapiens
  •        Asn-112
• Integrin alpha-6 / Homo sapiens
  •        Asn-323
  •        Asn-966
  •        Asn-997
• Integrin alpha-M / Homo sapiens
  •        Asn-391
  •        Asn-734
  •        Asn-801
  •        Asn-1021
• Integrin alpha-V / Homo sapiens
  •        Asn-615
• Integrin alpha-X / Homo sapiens
  •        Asn-735
  •        Asn-939
• Integrin beta-1 / Homo sapiens
  •        Asn-50
  •        Asn-212
  •        Asn-406
  •        Asn-481
  •        Asn-520
  •        Asn-669
• Integrin beta-3 / Homo sapiens
  •        Asn-680
• Integrin beta-5 / Homo sapiens
  •        Asn-347
• Integrin beta-6 / Homo sapiens
  •        Asn-97
  •        Asn-463
• Interferon-gamma receptor alpha chain / Homo sapiens
  •        Asn-179
• Interleukin-6 receptor subunit beta / Homo sapiens
  •        Asn-83
• KDEL motif-containing protein 2 / Homo sapiens
  •        Asn-61
• Lactadherin / Homo sapiens
  •        Asn-238
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Laminin subunit alpha-2 / Homo sapiens
  •        Asn-55
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-742
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-95
  •        Asn-1330
  •        Asn-2209
  •        Asn-2423
  •        Asn-3287
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-677
  •        Asn-1041
  •        Asn-1279
• Laminin subunit beta-2 / Homo sapiens
  •        Asn-1348
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-650
  •        Asn-1107
  •        Asn-1241
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Lipase member J / Homo sapiens
  •        Asn-240
• Lipase member K / Homo sapiens
  •        Asn-271
• Liver carboxylesterase 1 / Homo sapiens
  •        Asn-79
• Low-density lipoprotein receptor-related protein 1B / Homo sapiens
  •        Asn-1983
• Low-density lipoprotein receptor-related protein 5 / Homo sapiens
  •        Asn-138
• Lumican / Homo sapiens
  •        Asn-127
  •        Asn-160
• Lymphoid enhancer-binding factor 1 / Homo sapiens
  •        Asn-128
• Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
  •        Asn-161
  •        Asn-273
• Lysosomal acid phosphatase / Homo sapiens
  •        Asn-167
  •        Asn-267
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-390
• Lysosomal Pro-X carboxypeptidase / Homo sapiens
  •        Asn-415
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-249
  •        Asn-325
  •        Asn-412
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-103
  •        Asn-241
  •        Asn-249
  •        Asn-261
  •        Asn-322
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-58
  •        Asn-123
  •        Asn-242
  •        Asn-275
  •        Asn-356
• Macrosialin / Homo sapiens
  •        Asn-279
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Mammaglobin-B / Homo sapiens
  •        Asn-68
• Mannosyl-oligosaccharide glucosidase / Homo sapiens
  •        Asn-657
• Melanoma inhibitory activity protein 3 / Homo sapiens
  •        Asn-246
  •        Asn-250
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
• Monoacylglycerol lipase ABHD12 / Homo sapiens
  •        Asn-123
• Monocyte differentiation antigen cd14 / Homo sapiens
  •        Asn-282
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-50
• Myelin protein zero-like protein 2 / Homo sapiens
  •        Asn-39
• N-acetylgalactosamine-6-sulfatase / Homo sapiens
  •        Asn-423
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-279
  •        Asn-362
  •        Asn-387
• N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens
  •        Asn-219
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-294
• Neurofascin / Homo sapiens
  •        Asn-973
• Neuroplastin / Homo sapiens
  •        Asn-197
  •        Asn-229
• Neutral amino acid transporter B(0) / Homo sapiens
  •        Asn-212
• Nicalin / Homo sapiens
  •        Asn-428
• Nicastrin / Homo sapiens
  •        Asn-45
  •        Asn-264
  •        Asn-435
  •        Asn-506
  •        Asn-530
• Nodal modulator 1 / Homo sapiens
  •        Asn-218
  •        Asn-369
  •        Asn-618
• Nodal modulator 2 / Homo sapiens
  •        Asn-218
  •        Asn-369
  •        Asn-618
• Nodal modulator 3 / Homo sapiens
  •        Asn-218
  •        Asn-369
  •        Asn-618
• Nuclear envelope integral membrane protein 1 / Homo sapiens
  •        Asn-125
• Nuclear pore membrane glycoprotein 210 / Homo sapiens
  •        Asn-44
  •        Asn-405
  •        Asn-1441
• Nucleolar protein 56 / Homo sapiens
  •        Asn-207
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Osteopetrosis-associated transmembrane protein 1 / Homo sapiens
  •        Asn-263
• P2X purinoceptor 7 / Homo sapiens
  •        Asn-187
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
  •        Asn-212
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
  •        Asn-182
  •        Asn-294
  •        Asn-393
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
  •        Asn-286
• Peroxidasin homolog / Homo sapiens
  •        Asn-731
  •        Asn-1178
  •        Asn-1280
  •        Asn-1425
• Phospholipase B-like 1 / Homo sapiens
  •        Asn-411
• Phospholipase D3 / Homo sapiens
  •        Asn-236
  •        Asn-284
• PI-PLC X domain-containing protein 3 / Homo sapiens
  •        Asn-83
• Plasma protease c1 inhibitor / Homo sapiens
  •        Asn-238
• Plasminogen / Homo sapiens
  •        Undefined site
• Platelet glycoprotein 4 / Homo sapiens
  •        Asn-417
• Platelet-derived growth factor subunit b / Homo sapiens
  •        Asn-63
• Plexin-B2 / Homo sapiens
  •        Asn-528
  •        Asn-1002
  •        Asn-1099
• Plexin-c1 / Homo sapiens
  •        Asn-871
• Plexin-D1 / Homo sapiens
  •        Asn-500
  •        Asn-696
• Podocalyxin / Homo sapiens
  •        Asn-104
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-499
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
  •        Asn-353
• Probable C-mannosyltransferase DPY19L4 / Homo sapiens
  •        Asn-123
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Procollagen galactosyltransferase 1 / Homo sapiens
  •        Asn-96
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-197
  •        Asn-538
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
  •        Asn-209
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
  •        Asn-63
  •        Asn-548
• Progranulin / Homo sapiens
  •        Asn-530
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-729
  •        Asn-1575
  •        Asn-1616
  •        Asn-1995
  •        Asn-3788
  •        Asn-3839
• Prolyl 3-hydroxylase 1 / Homo sapiens
  •        Asn-540
• Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
  •        Asn-113
• Prosalusin / Homo sapiens
  •        Asn-149
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-101
  •        Asn-215
  •        Asn-332
• Prostaglandin G/H synthase 1 / Homo sapiens
  •        Asn-67
• Prostaglandin G/H synthase 2 / Homo sapiens
  •        Asn-53
  •        Asn-130
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Protein CREG1 / Homo sapiens
  •        Asn-160
• Protein O-mannosyl-transferase 2 / Homo sapiens
  •        Asn-583
• Protein OS-9 / Homo sapiens
  •        Asn-177
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-195
  •        Asn-217
  •        Asn-272
  •        Asn-431
  •        Asn-608
• Protein turtle homolog A / Homo sapiens
  •        Asn-188
• Protein Wnt-5a / Homo sapiens
  •        Asn-114
• Protocadherin alpha-12 / Homo sapiens
  •        Asn-257
• Protocadherin beta-10 / Homo sapiens
  •        Asn-567
• Protocadherin beta-11 / Homo sapiens
  •        Asn-567
• Protocadherin beta-14 / Homo sapiens
  •        Asn-567
• Protocadherin beta-15 / Homo sapiens
  •        Asn-567
• Protocadherin beta-16 / Homo sapiens
  •        Asn-567
• Protocadherin beta-2 / Homo sapiens
  •        Asn-569
• Protocadherin beta-3 / Homo sapiens
  •        Asn-567
• Protocadherin beta-5 / Homo sapiens
  •        Asn-566
• Protocadherin beta-8 / Homo sapiens
  •        Asn-568
• Protocadherin beta-9 / Homo sapiens
  •        Asn-567
• Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
  •        Asn-187
  •        Asn-530
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Rho-related BTB domain-containing protein 3 / Homo sapiens
  •        Asn-407
• Seipin / Homo sapiens
  •        Asn-88
• Semaphorin-4D / Homo sapiens
  •        Asn-419
• Serine--tRNA ligase, cytoplasmic / Homo sapiens
  •        Asn-427
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
  •        Asn-682
• Serotransferrin / Homo sapiens
  •        Undefined site
• Serpin h1 / Homo sapiens
  •        Asn-120
  •        Asn-125
• Serum paraoxonase/arylesterase 2 / Homo sapiens
  •        Asn-323
• Sialate O-acetylesterase / Homo sapiens
  •        Asn-267
• Sialomucin core protein 24 / Homo sapiens
  •        Asn-146
• Signal transducer CD24 / Homo sapiens
  •        Asn-52
• Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens
  •        Asn-1411
• Sodium channel protein type 4 subunit alpha / Homo sapiens
  •        Asn-1786
• Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens
  •        Asn-302
• Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
  •        Asn-158
  •        Asn-193
• Solute carrier family 12 member 7 / Homo sapiens
  •        Asn-312
• Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens
  •        Undefined site
• Sortilin / Homo sapiens
  •        Asn-406
• Sortilin-related receptor / Homo sapiens
  •        Asn-1608
  •        Asn-1854
  •        Asn-2010
• Sparc / Homo sapiens
  •        Asn-116
• Stromal interaction molecule 1 / Homo sapiens
  •        Asn-171
• SUN domain-containing ossification factor / Homo sapiens
  •        Asn-202
  •        Asn-928
• Superoxide dismutase [Cu-Zn] / Homo sapiens
  •        Asn-87
• Suppressor of tumorigenicity 14 protein / Homo sapiens
  •        Asn-772
• Synaptonemal complex protein SC65 / Homo sapiens
  •        Asn-361
• Synaptophysin-like protein 1 / Homo sapiens
  •        Asn-71
• Tapasin / Homo sapiens
  •        Asn-253
• Tetraspanin-3 / Homo sapiens
  •        Asn-167
• Tetratricopeptide repeat protein 17 / Homo sapiens
  •        Asn-634
• Thioredoxin domain-containing protein 15 / Homo sapiens
  •        Asn-293
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-1069
• Thrombospondin-3 / Homo sapiens
  •        Asn-407
  •        Asn-937
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• TM2 domain-containing protein 1 / Homo sapiens
  •        Asn-197
• TM2 domain-containing protein 3 / Homo sapiens
  •        Asn-87
  •        Asn-140
• Toll-like receptor 2 / Homo sapiens
  •        Asn-414
• Torsin-1A / Homo sapiens
  •        Asn-158
• Torsin-1B / Homo sapiens
  •        Asn-64
• Torsin-2A / Homo sapiens
  •        Asn-149
• Transcobalamin-1 / Homo sapiens
  •        Asn-216
• Transferrin receptor protein 1 / Homo sapiens
  •        Asn-251
  •        Asn-727
• Transforming growth factor beta-3 / Homo sapiens
  •        Asn-135
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
  •        Asn-191
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-88
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-200
  •        Asn-249
• Transmembrane protein 106B / Homo sapiens
  •        Asn-183
• Transmembrane protein 131 / Homo sapiens
  •        Asn-168
  •        Asn-290
  •        Asn-959
• Transmembrane protein 2 / Homo sapiens
  •        Asn-914
• Transmembrane protein 231 / Homo sapiens
  •        Asn-221
• Transmembrane protein 8A / Homo sapiens
  •        Asn-535
• Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
  •        Undefined site
• Twisted gastrulation protein homolog 1 / Homo sapiens
  •        Asn-81
• UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
  •        Asn-269
• Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
  •        Asn-511
• Uncharacterized protein from Blood Serum / Homo sapiens
  •        Undefined site
• UPF0577 protein KIAA1324 / Homo sapiens
  •        Asn-576
  •        Asn-672
  •        Asn-717
• Uromodulin / Homo sapiens
  •        Asn-513
• Uroplakin-3b-like protein / Homo sapiens
  •        Asn-110
  •        Asn-140
• V-type proton ATPase subunit e 1 / Homo sapiens
  •        Asn-70
• V-type proton ATPase subunit S1 / Homo sapiens
  •        Asn-273
• Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
  •        Asn-324
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc transporter ZIP6 / Homo sapiens
  •        Asn-67
  •        Asn-266
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• Zymogen granule protein 16 homolog B / Homo sapiens
  •        Asn-197
• Beta-lactoglobulin / Bos taurus
  •        Undefined site
• Lactotransferrin / Bos taurus
  •        Asn-252
  •        Asn-387
  •        Asn-564
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Ribonuclease pancreatic [b] / Bos taurus
  •        Undefined site
  •        Asn-60
• Uncharacterized protein (gene name abca4) / Bos taurus
  •        Asn-415
  •        Asn-1527
  •        Asn-1660
• Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
  •        Asn-442
• Adhesion G protein-coupled receptor F5 / Mus musculus
  •        Asn-86
• Alpha-(1,3)-fucosyltransferase 11 / Mus musculus
  •        Asn-162
• Alpha-L-iduronidase / Mus musculus
  •        Asn-362
• ATP-binding cassette sub-family A member 1 / Mus musculus
  •        Asn-98
• ATP-binding cassette sub-family A member 2 / Mus musculus
  •        Asn-432
  •        Asn-627
  •        Asn-1678
  •        Asn-1776
• ATP-binding cassette sub-family A member 7 / Mus musculus
  •        Asn-1532
• ATPase family AAA domain-containing protein 1 / Mus musculus
  •        Asn-316
• Attractin / Mus musculus
  •        Asn-415
  •        Asn-427
• Basigin / Mus musculus
  •        Asn-270
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-121
  •        Asn-205
  •        Asn-241
  •        Asn-254
• Beta-hexosaminidase subunit alpha / Mus musculus
  •        Asn-157
• Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
  •        Asn-389
• Bone morphogenetic protein receptor type-2 / Mus musculus
  •        Asn-55
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-44
  •        Asn-61
  •        Asn-307
• Cadherin-10 / Mus musculus
  •        Asn-438
• Cadherin-2 / Mus musculus
  •        Asn-651
• Cadherin-4 / Mus musculus
  •        Asn-658
• Calsyntenin-2 / Mus musculus
  •        Asn-100
• Carbohydrate sulfotransferase 8 / Mus musculus
  •        Asn-360
• Carbonic anhydrase-related protein 11 / Mus musculus
  •        Asn-260
• Carboxypeptidase E / Mus musculus
  •        Asn-390
• Carboxypeptidase M / Mus musculus
  •        Asn-363
• Cation-dependent mannose-6-phosphate receptor / Mus musculus
  •        Asn-58
  •        Asn-84
• CD180 antigen / Mus musculus
  •        Asn-34
• Cell cycle control protein 50A / Mus musculus
  •        Asn-297
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
  •        Asn-295
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
  •        Asn-230
• Clusterin / Mus musculus
  •        Asn-290
  •        Asn-327
• Contactin-1 / Mus musculus
  •        Asn-593
• Contactin-3 / Mus musculus
  •        Asn-489
• Contactin-associated protein 1 / Mus musculus
  •        Asn-277
  •        Asn-500
  •        Asn-764
  •        Asn-805
  •        Asn-844
  •        Asn-949
  •        Asn-957
  •        Asn-1148
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-1117
• CUB and sushi domain-containing protein 1 / Mus musculus
  •        Asn-2795
• Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus
  •        Asn-570
• Cystatin-C / Mus musculus
  •        Asn-99
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-113
  •        Asn-505
  •        Asn-752
• Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus
  •        Asn-279
• Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus
  •        Asn-72
  •        Asn-92
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus
  •        Asn-548
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus
  •        Asn-624
  •        Asn-638
• Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus
  •        Asn-749
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
  •        Asn-524
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
  •        Asn-292
• Embigin / Mus musculus
  •        Asn-70
• Endoplasmin / Mus musculus
  •        Asn-62
  •        Asn-217
  •        Asn-445
  •        Asn-502
• Ephrin-A1 / Mus musculus
  •        Asn-26
• ER membrane protein complex subunit 1 / Mus musculus
  •        Asn-917
• ER membrane protein complex subunit 10 / Mus musculus
  •        Asn-182
• Erlin-1 / Mus musculus
  •        Asn-108
• Erlin-2 / Mus musculus
  •        Asn-106
• ERO1-like protein alpha / Mus musculus
  •        Asn-276
• Excitatory amino acid transporter 2 / Mus musculus
  •        Asn-205
• Galactose-3-O-sulfotransferase 3 / Mus musculus
  •        Asn-110
• Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus
  •        Asn-140
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
  •        Asn-137
• Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus
  •        Asn-138
• Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
  •        Asn-63
  •        Asn-163
  •        Asn-176
• Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
  •        Asn-145
• Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
  •        Asn-128
• Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
  •        Asn-439
  •        Asn-501
• Gamma-glutamyltransferase 7 / Mus musculus
  •        Asn-198
  •        Asn-523
  •        Asn-586
• Glia-derived nexin / Mus musculus
  •        Asn-323
• Glutamate carboxypeptidase 2 / Mus musculus
  •        Asn-478
• Glutamate receptor 4 / Mus musculus
  •        Asn-371
• Glutamate receptor ionotropic, kainate 2 / Mus musculus
  •        Asn-751
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus
  •        Asn-350
  •        Asn-368
  •        Asn-471
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus
  •        Asn-444
  •        Asn-688
• Glycerophosphodiester phosphodiesterase 1 / Mus musculus
  •        Asn-168
• Glycine receptor subunit beta / Mus musculus
  •        Asn-242
• GPI inositol-deacylase / Mus musculus
  •        Asn-558
• Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus
  •        Asn-157
• Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus
  •        Asn-320
• Hepatocyte cell adhesion molecule / Mus musculus
  •        Asn-189
• Hypoxia up-regulated protein 1 / Mus musculus
  •        Asn-515
  •        Asn-830
  •        Asn-869
• Immunoglobulin gamma-2a heavy chain / Mus musculus
  •        Undefined site
• Inactive dipeptidyl peptidase 10 / Mus musculus
  •        Asn-749
• Insulin receptor / Mus musculus
  •        Asn-445
• Integrin alpha-1 / Mus musculus
  •        Asn-459
  •        Asn-882
  •        Asn-1102
• Integrin alpha-M / Mus musculus
  •        Asn-391
• Integrin alpha-V / Mus musculus
  •        Asn-615
  •        Asn-869
  •        Asn-941
• Integrin beta-1 / Mus musculus
  •        Asn-481
  •        Asn-669
• Integrin beta-2 / Mus musculus
  •        Asn-626
• Interleukin-1 receptor accessory protein-like 1 / Mus musculus
  •        Asn-213
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-517
• Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
  •        Asn-911
• Isoform 2 of Catenin delta-1 / Mus musculus
  •        Asn-434
• Isoform 2 of Integrin alpha-3 / Mus musculus
  •        Asn-574
• Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus
  •        Asn-834
• Isoform 2 of Teneurin-4 / Mus musculus
  •        Asn-1761
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-136
  •        Asn-324
  •        Asn-580
  •        Asn-764
• Kinesin-like protein / Mus musculus
  •        Asn-272
• Lactadherin / Mus musculus
  •        Asn-266
• Laminin subunit alpha-1 / Mus musculus
  •        Asn-45
• Laminin subunit alpha-2 / Mus musculus
  •        Asn-359
• Laminin subunit alpha-5 / Mus musculus
  •        Asn-1335
• Leucine rich repeat protein 2, neuronal / Mus musculus
  •        Asn-381
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus
  •        Asn-196
  •        Asn-287
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus
  •        Asn-327
• Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus
  •        Asn-275
  •        Asn-323
• Leucine-rich repeat-containing protein 24 / Mus musculus
  •        Asn-371
• Leucyl-cystinyl aminopeptidase / Mus musculus
  •        Asn-145
  •        Asn-695
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-61
  •        Asn-129
• Low-density lipoprotein receptor-related protein 1B / Mus musculus
  •        Asn-725
  •        Asn-3164
• Lysosomal acid phosphatase / Mus musculus
  •        Asn-167
• Lysosomal protective protein / Mus musculus
  •        Asn-327
• Lysosome membrane protein 2 / Mus musculus
  •        Asn-122
  •        Asn-412
• Lysosome-associated membrane glycoprotein 5 / Mus musculus
  •        Asn-127
• MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus
  •        Asn-307
  •        Asn-331
• Membralin / Mus musculus
  •        Asn-180
• Metal transporter CNNM4 / Mus musculus
  •        Asn-119
• Multiple epidermal growth factor-like domains protein 8 / Mus musculus
  •        Asn-637
  •        Asn-1115
• N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus
  •        Asn-88
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
  •        Asn-670
• Neural cell adhesion molecule L1-like protein / Mus musculus
  •        Asn-476
• Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus
  •        Asn-38
• Neuroendocrine convertase 2 / Mus musculus
  •        Asn-374
  •        Asn-523
• Neurofascin / Mus musculus
  •        Asn-409
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
  •        Asn-427
  •        Asn-501
  •        Asn-852
• Neuronal pentraxin-1 / Mus musculus
  •        Asn-193
• Neuroplastin / Mus musculus
  •        Asn-228
  •        Asn-283
• Nicastrin / Mus musculus
  •        Asn-44
  •        Asn-54
  •        Asn-434
  •        Asn-529
• Niemann-Pick C1 protein / Mus musculus
  •        Asn-1063
• Nodal modulator 1 / Mus musculus
  •        Asn-210
• Noelin / Mus musculus
  •        Asn-103
  •        Asn-473
• Nuclear pore membrane glycoprotein 210 / Mus musculus
  •        Asn-405
  •        Asn-1135
• Oligodendrocyte-myelin glycoprotein / Mus musculus
  •        Asn-103
  •        Asn-152
• Osteopetrosis-associated transmembrane protein 1 / Mus musculus
  •        Asn-267
• P2X purinoceptor 4 / Mus musculus
  •        Asn-208
• P2X purinoceptor 7 / Mus musculus
  •        Asn-202
• Phosphatidylcholine-sterol acyltransferase / Mus musculus
  •        Asn-44
  •        Asn-108
• Phospholipase D3 / Mus musculus
  •        Asn-385
• Platelet glycoprotein 4 / Mus musculus
  •        Asn-220
• Plexin-A2 / Mus musculus
  •        Asn-163
• Plexin-A4 / Mus musculus
  •        Asn-441
• Plexin-B1 / Mus musculus
  •        Asn-31
  •        Asn-1251
• Plexin-B2 / Mus musculus
  •        Asn-393
  •        Asn-735
• Plexin-C1 / Mus musculus
  •        Asn-454
  •        Asn-717
  •        Asn-877
• Prenylcysteine oxidase / Mus musculus
  •        Asn-323
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus
  •        Asn-198
  •        Asn-539
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus
  •        Asn-551
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-1512
  •        Asn-1576
  •        Asn-1764
  •        Asn-1826
  •        Asn-2128
  •        Asn-3090
  •        Asn-3789
  •        Asn-4076
  •        Asn-4126
• Prosaposin / Mus musculus
  •        Asn-80
  •        Asn-214
  •        Asn-334
  •        Asn-459
• Prostaglandin g/h synthase 2 / Mus musculus
  •        Asn_53
  •        Asn-130
• Prostaglandin-H2 D-isomerase / Mus musculus
  •        Asn-51
  •        Asn-78
• Protein disulfide-isomerase TMX3 / Mus musculus
  •        Asn-261
• Protein FAM234B / Mus musculus
  •        Asn-239
• Protein kinase C-binding protein NELL2 / Mus musculus
  •        Asn-56
• Protein O-glucosyltransferase 1 / Mus musculus
  •        Asn-204
• Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
  •        Asn-337
• Protein OS-9 / Mus musculus
  •        Asn-177
• Protein sel-1 homolog 1 / Mus musculus
  •        Asn-191
  •        Asn-427
• Protocadherin Fat 1 / Mus musculus
  •        Asn-1904
  •        Asn-2327
• Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
  •        Asn-1607
• Reelin / Mus musculus
  •        Asn-3016
• Semaphorin-3E / Mus musculus
  •        Asn-126
• Semaphorin-4D / Mus musculus
  •        Asn-419
• Semaphorin-4F / Mus musculus
  •        Asn-70
• Semaphorin-7A / Mus musculus
  •        Asn-256
• Serotransferrin / Mus musculus
  •        Asn-513
• Serpin H1 / Mus musculus
  •        Asn-124
• Serum paraoxonase/arylesterase 2 / Mus musculus
  •        Asn-254
• Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus
  •        Asn-113
• Sialic acid-binding Ig-like lectin / Mus musculus
  •        Asn-150
• Sodium channel protein type 1 subunit alpha / Mus musculus
  •        Asn-1403
• Sodium channel subunit beta-1 / Mus musculus
  •        Asn-93
  •        Asn-135
• Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus
  •        Asn-393
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
  •        Asn-193
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-96
  •        Asn-153
  •        Asn-238
• Solute carrier family 12 member 5 / Mus musculus
  •        Asn-314
  •        Asn-362
• Sortilin / Mus musculus
  •        Asn-404
• Sortilin-related receptor / Mus musculus
  •        Asn-158
  •        Asn-1068
  •        Asn-1895
  •        Asn-1987
  •        Asn-2011
• SPARC / Mus musculus
  •        Asn-115
• SPARC-like protein 1 / Mus musculus
  •        Asn-168
  •        Asn-462
• Synaptic vesicle glycoprotein 2A / Mus musculus
  •        Asn-573
• T-cell immunomodulatory protein / Mus musculus
  •        Asn-480
• Teneurin-2 / Mus musculus
  •        Asn-1702
• Testican-2 / Mus musculus
  •        Asn-225
• Tetraspanin-3 / Mus musculus
  •        Asn-167
• Thioredoxin domain-containing protein 15 / Mus musculus
  •        Asn-277
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• TM2 domain-containing protein 3 / Mus musculus
  •        Asn-183
• Torsin-1B / Mus musculus
  •        Asn-64
• Translocon-associated protein subunit alpha / Mus musculus
  •        Asn-136
• Translocon-associated protein subunit beta / Mus musculus
  •        Asn-88
• Transmembrane and TPR repeat-containing protein 4 / Mus musculus
  •        Asn-497
• Transmembrane emp24 domain-containing protein 9 / Mus musculus
  •        Asn-125
• Transmembrane protein 106B / Mus musculus
  •        Asn-184
• Transmembrane protein 131 / Mus musculus
  •        Asn-288
  •        Asn-945
• Transmembrane protein 158 / Mus musculus
  •        Asn-73
• Transmembrane protein 181a / Mus musculus
  •        Asn-140
• Transmembrane protein 8B / Mus musculus
  •        Asn-348
• Tripeptidyl-peptidase 1 / Mus musculus
  •        Asn-209
• Tyrosine-protein kinase Mer / Mus musculus
  •        Asn-202
• Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus
  •        Asn-314
• UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus
  •        Asn-198
• Uncharacterized protein / Mus musculus
  •        Undefined site
• UPF0577 protein KIAA1324-like homolog / Mus musculus
  •        Asn-715
• V-type proton ATPase subunit S1 / Mus musculus
  •        Asn-255
• Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
  •        Asn-789
• VPS10 domain-containing receptor SorCS1 / Mus musculus
  •        Asn-775
• Zinc transporter ZIP12 / Mus musculus
  •        Asn-322
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Coagulation factor VIII / Sus scrofa
  •        Undefined site
• Ascorbate oxidase / Acremonium sp. HI-25
  •        Undefined site
• Hemocyanin / Androctonus australis
  •        Undefined site
• Uncharacterized protein / Actinidia chinensis
  •        Undefined site
• Uncharacterized protein / Apium graveolens var. oulce
  •        Undefined site
• Art v II / Artemisia vulgaris
  •        Undefined site
• Uncharacterized protein / Daucus carota
  •        Undefined site
• Uncharacterized protein / Lycopersicon esculentum
  •        Undefined site
• Ribonuclease s-6 / Nicotiana alata
  •        Undefined site
• Uncharacterized protein / Solanum tuberosum
  •        Undefined site
• Uncharacterized protein from Ovary / Asterias rubens
  •        Undefined site
• Immunoglobulin gamma / Columba livia
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Gp273 / Unio elongatulus
  •        Undefined site
• Uncharacterized protein / Physomitrella patens
  •        Undefined site
• Uncharacterized protein / Fagopyrum esculentum
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Uncharacterized protein / Caenorhabditis elegans
  •        Undefined site
• Uncharacterized protein / Caenorhabditis elegans
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein / Trichinella spiralis
  •        Undefined site
• Alpha-galactosidase a / Aspergillus niger
  •        Undefined site
• Alpha-glucosidase / Aspergillus niger
  •        Undefined site
• Endopolygalacturonase II / Aspergillus niger
  •        Undefined site
• Uncharacterized protein / Agaricus bisporus
  •        Undefined site
• Uncharacterized protein / Aedes aegypti
  •        Undefined site
• Arylphorin / Antheraea pernyi
  •        Undefined site
• Uncharacterized protein from Hemolymph / Antheraea pernyi
  •        Undefined site
• Apisin / Apis mellifera
  •        Undefined site
• Hyaluronoglucosaminidase / Apis mellifera
  •        Undefined site
• Uncharacterized protein from Royal Jelly / Apis mellifera
  •        Undefined site
• Membrane glycoproteins / Bombyx mori
  •        Undefined site
• Sex-specific storage-protein 2 / Bombyx mori
  •        Undefined site
• Uncharacterized protein / Drosophila melanogaster
  •        Undefined site
• Membrane glycoproteins / Mamestra brassicae
  •        Undefined site
• Membrane glycoproteins / Spodoptera frugiperda
  •        Undefined site
• Uncharacterized protein / Leptomonas Samueli
  •        Undefined site
• Uncharacterized protein / Trypanosoma brucei brucei
  •        Undefined site
• Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei
  •        Asn-456
• Variant surface glycoprotein mitat 1.4a / Trypansoma brucei
  •        Undefined site
• Uncharacterized protein / Persea americana
  •        Undefined site
• Cobra venom factor / Naja kaouthia
  •        Undefined site
• Uncharacterized protein / Allium cepa
  •        Undefined site
• Uncharacterized protein / Asparagus officinalis
  •        Undefined site
• Uncharacterized protein / Musa acuminata
  •        Undefined site
• Alpha-amylase / Oryza sativa
  •        Undefined site
• Vitellogenin / Cherax quadricarinatus
  •        Undefined site
• Hemocyanin / Pontastacus leptodactylus
  •        Undefined site
• Envelope glycoprotein / Friend mink cell focus-forming virus
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
  •        Undefined site
• Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant)
  •        Undefined site
• Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
  •        Undefined site
• Surface protein gp120 / Human immunodeficiency virus
  •        Undefined site
• Surface protein gp120 / Human immunodeficiency virus type 1 (bh8 isolate)
  •        Undefined site
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Uncharacterized protein / Arabidopsis thaliana
  •        Undefined site
• Uncharacterized protein / Arabidopsis thaliana
  •        Undefined site
• Uncharacterized protein / Brassica oleracea var. botrytis
  •        Undefined site
• Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
  •        Undefined site
• Alpha-mannosidase / Canavalia ensiformis
  •        Undefined site
• Uncharacterized protein / Carica papaya
  •        Undefined site
• Uncharacterized protein / Carica papaya
  •        Undefined site
• Uncharacterized protein / Citrus sinensis
  •        Undefined site
• Uncharacterized protein / Corylus avellana
  •        Undefined site
• Uncharacterized protein / Fragaria x ananassa
  •        Undefined site
• Lectin / Glycine max
  •        Undefined site
• Uncharacterized protein / Glycine max
  •        Undefined site
• Uncharacterized protein / Juglans regia
  •        Undefined site
• Uncharacterized protein / Malus domestica var. golden delicious
  •        Undefined site
• Uncharacterized protein / Phaseolus lunatus
  •        Undefined site
• Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris
  •        Undefined site
• Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
  •        Undefined site
• Phaseolin, alpha-type / Phaseolus vulgaris
  •        Asn-347
• Phaseolin, beta-type / Phaseolus vulgaris
  •        Asn-341
• Uncharacterized protein / Phaseolus vulgaris
  •        Undefined site
• Uncharacterized protein / Pistacia vera
  •        Undefined site
• Uncharacterized protein / Pisum sativum
  •        Undefined site
• Uncharacterized protein / Prunus dulcis var. sativa
  •        Undefined site
• Uncharacterized protein / Pyrus communis var. williams
  •        Undefined site
• Uncharacterized protein / Ricinus communis
  •        Undefined site
• Uncharacterized protein / Vigna radiata var. radiata
  •        Undefined site
• Invertase / Saccharomyces cerevisiae
  •        Undefined site
• Invertase 2 / Saccharomyces cerevisiae
  •        Undefined site
• Invertase [secreted form] / Saccharomyces cerevisiae
  •        Undefined site
• Uncharacterized protein / Saccharomyces cerevisiae
  •        Undefined site
• Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
  •        Undefined site
  •        Asn-424
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-343
  •        Asn-615
  •        Asn-709
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-234
  •        Asn-717
  •        Asn-1074
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-234
  •        Asn-343
• Uncharacterized protein / Schistosoma mansoni
  •        Undefined site
• Hemoglobin extracellular / Riftia pachyptila
  •        Undefined site

Mass spectrometry observed peptide

• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19     Ceramide synthase 2 / Homo sapiens
• HIVFWNSSNPK (11aa)
  •    P52793    Asn-26     Ephrin-A1 / Mus musculus
• SPLPAAFTANGTHLQHLAR (19aa)
  •    Q8CJH3    Asn-31     Plexin-B1 / Mus musculus
• LVPVPITNATLDR (13aa)
  •    P19652    Asn-33     Alpha-1-acid glycoprotein 2 / Homo sapiens
• LVPVPITNATLDQITGK (17aa)
  •    P02763    Asn-33     Alpha-1-acid glycoprotein 1 / Homo sapiens
• CIEKEVNK (8aa)
  •    Q62192    Asn-34     CD180 antigen / Mus musculus
• NITQIVGHSGCEAK (14aa)
  •    Q61477    Asn-38     Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus
• VIEAVNGTDAR (11aa)
  •    O60487    Asn-39     Myelin protein zero-like protein 2 / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• ADVGGEAAGTAINHSHMLLQR (21aa)
  •    Q9DB72    Asn-44     BTB/POZ domain-containing protein 17 / Mus musculus
• AELSNHTRPVILVPGCLGNR (20aa)
  •    P16301    Asn-44     Phosphatidylcholine-sterol acyltransferase / Mus musculus
• VNFTIEASEGCYR (13aa)
  •    Q8TEM1    Asn-44     Nuclear pore membrane glycoprotein 210 / Homo sapiens
• IYIPLNK (7aa)
  •    P57716    Asn-44     Nicastrin / Mus musculus
• KIYIPLNK (8aa)
  •    P57716    Asn-44     Nicastrin / Mus musculus
• KIYIPINK (8aa)
  •    Q92542    Asn-45     Nicastrin / Homo sapiens
• GLFPAILNLATNAHISANATCGEK (24aa)
  •    P19137    Asn-45     Laminin subunit alpha-1 / Mus musculus
• IYIPINK (7aa)
  •    Q92542    Asn-45     Nicastrin / Homo sapiens
• NNSDISSTR (9aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• FECHFFNGTER (11aa)
  •    Q9TQE0    Asn-48     HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
  •    P04229    Asn-48     HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
  •    Q30167    Asn-48     HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
• CGWCTNSTFLQEGMPTSAR (19aa)
  •    P05556    Asn-50     Integrin beta-1 / Homo sapiens
• SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
  •    P05556    Asn-50     Integrin beta-1 / Homo sapiens
• EIFVANGTQGK (11aa)
  •    O95297    Asn-50     Myelin protein zero-like protein 1 / Homo sapiens
• WYSAGLASNSSWFR (14aa)
  •    O09114    Asn-51     Prostaglandin-H2 D-isomerase / Mus musculus
• SGLAPNPTNATTK (13aa)
  •    P25063    Asn-52     Signal transducer CD24 / Homo sapiens
• SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
  •    P25063    Asn-52     Signal transducer CD24 / Homo sapiens
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53     Dipeptidyl peptidase 1 / Homo sapiens
• TGFYGENCSTPEFLTR (16aa)
  •    P35354    Asn-53     Prostaglandin G/H synthase 2 / Homo sapiens
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• FVGTPEVNQTTIYQR (15aa)
  •    P01033    Asn-53     Metalloproteinase inhibitor 1 / Homo sapiens
• LLNATHQIGCQSSISGDTGVIHVVEKEEDLK (31aa)
  •    P57716    Asn-54     Nicastrin / Mus musculus
• ISHENGTILCSK (12aa)
  •    O35607    Asn-55     Bone morphogenetic protein receptor type-2 / Mus musculus
• GLFPAVLNLASNALITTNATCGEK (24aa)
  •    P24043    Asn-55     Laminin subunit alpha-2 / Homo sapiens
• QVPGLHNGTK (10aa)
  •    Q61220    Asn-56     Protein kinase C-binding protein NELL2 / Mus musculus
• SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
  •    P04062    Asn-58     Glucosylceramidase / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• LRPLFNK (7aa)
  •    P24668    Asn-58     Cation-dependent mannose-6-phosphate receptor / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YFYIQAVNSEGQNITR (16aa)
  •    Q7Z4H8    Asn-61     KDEL motif-containing protein 2 / Homo sapiens
• WKLNK (5aa)
  •    Q61735    Asn-61     Leukocyte surface antigen CD47 / Mus musculus
• QGNASDVILR (10aa)
  •    Q9DB72    Asn-61     BTB/POZ domain-containing protein 17 / Mus musculus
• FSNVTW (6aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SNVTWF (6aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TDDEVVQREEEAIQLDGLNASQIR (24aa)
  •    P08113    Asn-62     Endoplasmin / Mus musculus
• TDDEVVQREEEAIQIDGINASQIR (24aa)
  •    P14625    Asn-62     Endoplasmin / Homo sapiens
• NAPLVNVTLYYEALCGGCR (19aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• HAPDIPDDSTDNITIFTR (18aa)
  •    P26049    Asn-63     Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
• SAEFFNYTVR (10aa)
  •    O60568    Asn-63     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
• SNAPIVNVTIYYEAICGGCR (20aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• EERPINASAIK (11aa)
  •    O14657    Asn-64     Torsin-1B / Homo sapiens
• ATTLDDNGTMLFFKGE (16aa)
  •    P02790    Asn-64     Hemopexin / Homo sapiens
• FTECCHEERPLNTSALK (17aa)
  •    Q9ER41    Asn-64     Torsin-1B / Mus musculus
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein d / Homo sapiens
• TGYSGPNCTIPGIWTWIR (18aa)
  •    P23219    Asn-67     Prostaglandin G/H synthase 1 / Homo sapiens
• YGENNSISVEGFR (13aa)
  •    Q13433    Asn-67     Zinc transporter ZIP6 / Homo sapiens
• QCFLNQSHR (9aa)
  •    O75556    Asn-68     Mammaglobin-B / Homo sapiens
• AIGFENATQAIGR (13aa)
  •    Q08380    Asn-69     Galectin-3-binding protein / Homo sapiens
• NSTGAYCGMGENK (13aa)
  •    Q53GD3    Asn-69     Choline transporter-like protein 4 / Homo sapiens
• NETIWYIK (8aa)
  •    O15342    Asn-70     V-type proton ATPase subunit e 1 / Homo sapiens
• SNVSVEENVILEKPSHVELK (20aa)
  •    P21995    Asn-70     Embigin / Mus musculus
• FAAPHTYNYSALLVDPASHTLYVGAR (26aa)
  •    Q9Z123    Asn-70     Semaphorin-4F / Mus musculus
• GQTEIQVNCPPAVTENK (17aa)
  •    Q16563    Asn-71     Synaptophysin-like protein 1 / Homo sapiens
• GAAAPSAPHWNETAEK (16aa)
  •    Q9R1V7    Asn-72     Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus
• AGPEEAPAAPCNISVQR (17aa)
  •    Q6F5E0    Asn-73     Transmembrane protein 158 / Mus musculus
• FHAIHVSGTNGTK (13aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKR (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HAIHVSGTNGTKR (13aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)</