taxonomy (84)
protein (672)
source (82)
structure (39)
composition (1)
disease (19)
reference (134)
site (951)
peptide (834)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Acremonium sp. HI-25
- Androctonus australis (Sahara scorpion)
- Actinidia chinensis (Kiwi fruit)
- Apium graveolens var. oulce (Celery)
- Artemisia vulgaris (Mugwort)
- Daucus carota (Carrot)
- Lycopersicon esculentum (Tomato)
- Nicotiana alata (Persian tobacco)
- Solanum tuberosum (Potato)
- Asterias rubens (European starfish)
- Columba livia (Domestic pigeon)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Unio elongatulus
- Physomitrella patens
- Fagopyrum esculentum (Common buckwheat)
- Torpedo californica (Pacific electric ray)
- Caenorhabditis elegans
- Trichinella spiralis
- Aspergillus niger
- Agaricus bisporus (Common mushroom)
- Aedes aegypti (Yellow fever mosquito)
- Antheraea pernyi (Chinese oak silkmoth)
- Apis mellifera (Honeybee)
- Bombyx mori (Domestic silkworm)
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Mamestra brassicae
- Spodoptera frugiperda (Fall armyworm)
- Leptomonas Samueli
- Trypanosoma brucei brucei
- Trypansoma brucei
- Persea americana (Avocado)
- Naja kaouthia (Monocled cobra)
- Allium cepa (Onion)
- Asparagus officinalis (Garden asparagus)
- Musa acuminata (Banana)
- Oryza sativa (Rice)
- Cherax quadricarinatus (Australian red claw crayfish)
- Pontastacus leptodactylus (Narrow-clawed crayfish)
- Friend mink cell focus-forming virus
- Friend spleen focus-forming virus
- Friend spleen focus-forming virus (anemia inducing strain)
- Friend spleen focus-forming virus (gm1 mutant)
- Friend spleen focus-forming virus (gm1.2 mutant)
- Friend spleen focus-forming virus (gm1.2.3 mutant)
- Friend spleen focus-forming virus (gm3 mutant)
- Friend spleen focus-forming virus (gm3.4 mutant)
- Human immunodeficiency virus (Hiv)
- Human immunodeficiency virus type 1 (HIV-1)
- Human immunodeficiency virus type 1 (bh8 isolate) (Hiv-1 (bh8 isolate))
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Arabidopsis thaliana (Thale cress)
- Brassica oleracea var. botrytis (Cauliflower)
- Canavalia ensiformis (Jack bean)
- Carica papaya (Papaya)
- Citrus sinensis (Orange)
- Corylus avellana (Hazelnut)
- Fragaria x ananassa (Strawberry)
- Glycine max (Soybean)
- Juglans regia (English walnut)
- Malus domestica var. golden delicious (Cultivated apple - golden delicious)
- Phaseolus lunatus (Lima bean)
- Phaseolus vulgaris (Kidney bean)
- Pistacia vera (Pistachio)
- Pisum sativum (Pea)
- Prunus dulcis var. sativa (Sweet almond)
- Pyrus communis var. williams (Pear)
- Ricinus communis (Castor bean)
- Vigna radiata var. radiata (Mung bean)
- Saccharomyces cerevisiae (Baker's yeast)
- Influenza a virus (strain a/fowl plague virus/rostock/34)
- Human betacoronavirus 2c EMC/2012
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
- Riftia pachyptila (Giant tubeworm)
Taxonomy
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens Q16880
- 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens P04035
- 4F2 cell-surface antigen heavy chain / Homo sapiens P08195
- Acid ceramidase / Homo sapiens Q13510
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Agrin / Homo sapiens O00468
- Alpha-1-acid glycoprotein 1 / Homo sapiens P02763
- Alpha-1-acid glycoprotein 2 / Homo sapiens P19652
- Alpha-2-macroglobulin-like protein 1 / Homo sapiens A8K2U0
- Alpha-galactosidase A / Homo sapiens P06280
- Alpha-L-iduronidase / Homo sapiens P35475
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Amphoterin-induced protein 2 / Homo sapiens Q86SJ2
- Angiotensin-converting enzyme / Homo sapiens P12821
- Anoctamin-6 / Homo sapiens Q4KMQ2
- Antithrombin-III / Homo sapiens P01008
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens Q12797
- ATP-binding cassette sub-family A member 1 / Homo sapiens O95477
- ATP-binding cassette sub-family A member 2 / Homo sapiens Q9BZC7
- ATP-binding cassette sub-family A member 7 / Homo sapiens Q8IZY2
- Attractin / Homo sapiens O75882
- Basigin / Homo sapiens P35613
- Beta-glucuronidase / Homo sapiens P08236
- Beta-hexosaminidase subunit alpha / Homo sapiens P06865
- Beta-secretase / Homo sapiens P56817
- Biglycan / Homo sapiens P21810
- C-type mannose receptor 2 / Homo sapiens Q9UBG0
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens Q9NYQ6
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens Q9HCU4
- Cadherin-5 / Homo sapiens P33151
- Calcium-activated chloride channel regulator 2 / Homo sapiens Q9UQC9
- Calponin-3 / Homo sapiens Q15417
- Calreticulin / Homo sapiens P27797
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Cartilage oligomeric matrix protein / Homo sapiens P49747
- Cartilage-associated protein / Homo sapiens O75718
- Cathepsin D / Homo sapiens P07339
- Cation-independent mannose-6-phosphate receptor / Homo sapiens P11717
- CD109 antigen / Homo sapiens Q6YHK3
- CD166 antigen / Homo sapiens Q13740
- CD82 antigen / Homo sapiens P27701
- Ceramide synthase 2 / Homo sapiens Q96G23
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens O75503
- Choline transporter-like protein 4 / Homo sapiens Q53GD3
- Chondroitin sulfate glucuronyltransferase / Homo sapiens Q9P2E5
- Cleft lip and palate transmembrane protein 1 / Homo sapiens O96005
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens Q96KA5
- Clusterin / Homo sapiens P10909
- Coagulation factor VIII / Homo sapiens P00451
- Coiled-coil domain-containing protein 80 / Homo sapiens Q76M96
- Collagen alpha-1(I) chain / Homo sapiens P02452
- Collagen alpha-1(III) chain / Homo sapiens P02461
- Collagen alpha-1(V) chain / Homo sapiens P20908
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(I) chain / Homo sapiens P08123
- Collagen alpha-2(V) chain / Homo sapiens P05997
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Collagen alpha-6(VI) chain / Homo sapiens A6NMZ7
- Complement C2 / Homo sapiens P06681
- Complement c3 / Homo sapiens P01024
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- CUB domain-containing protein 1 / Homo sapiens Q9H5V8
- Cytokine receptor-like factor 1 / Homo sapiens O75462
- Deoxyribonuclease-2-alpha / Homo sapiens O00115
- Desmocollin-2 / Homo sapiens Q02487
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens O14672
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens P78536
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens P04843
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens P46977
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens Q8TCJ2
- Dystroglycan / Homo sapiens Q14118
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens Q14264
- Endoplasmin / Homo sapiens P14625
- Ephrin-A3 / Homo sapiens P52797
- Epidermal growth factor receptor / Homo sapiens P00533
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens Q9BZQ6
- ER membrane protein complex subunit 1 / Homo sapiens Q8N766
- ER membrane protein complex subunit 10 / Homo sapiens Q5UCC4
- Erlin-1 / Homo sapiens O75477
- Erlin-2 / Homo sapiens O94905
- ERO1-like protein alpha / Homo sapiens Q96HE7
- Extracellular sulfatase Sulf-1 / Homo sapiens Q8IWU6
- Extracellular sulfatase Sulf-2 / Homo sapiens Q8IWU5
- Fibrillin-1 / Homo sapiens P35555
- Fibroblast growth factor receptor 1 / Homo sapiens P11362
- Fibronectin / Homo sapiens P02751
- Folate receptor alpha / Homo sapiens P15328
- Follistatin-related protein 1 / Homo sapiens Q12841
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glucosidase 2 subunit beta / Homo sapiens P14314
- Glucoside xylosyltransferase 1 / Homo sapiens Q4G148
- Glucosylceramidase / Homo sapiens P04062
- Golgi apparatus protein 1 / Homo sapiens Q92896
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- GPI ethanolamine phosphate transferase 1 / Homo sapiens O95427
- Heat shock 70 kDa protein 13 / Homo sapiens P48723
- Hemopexin / Homo sapiens P02790
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens Q68CP4
- HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens P01892
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens P30450
- HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens P30512
- HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens P04439
- HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens P16188
- HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens P16189
- HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens P16190
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens P30453
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens P30456
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens P30457
- HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens P01891
- HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens P10316
- HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens P30459
- HLA class I histocompatibility antigen, alpha chain E / Homo sapiens P13747
- HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens P30462
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens P30464
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens P30466
- HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens P30685
- HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens P18463
- HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens Q95365
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens P30475
- HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens Q04826
- HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens P30480
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens P30484
- HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens P30485
- HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens P30486
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens Q29836
- HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens P01889
- HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens P30460
- HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens Q31610
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens Q29718
- HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens P30499
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens P30508
- HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens P30510
- HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens Q07000
- HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens Q29960
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens Q95604
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens Q29865
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens P30501
- HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens P04222
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens P30504
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens Q9TNN7
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens P10321
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens P30505
- HLA class II histocompatibility antigen gamma chain / Homo sapiens P04233
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens P01903
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Hyaluronidase-4 / Homo sapiens Q2M3T9
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L115N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin superfamily member 8 / Homo sapiens Q969P0
- Inactive tyrosine-protein kinase 7 / Homo sapiens Q13308
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens P35858
- Integrin alpha-1 / Homo sapiens P56199
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-6 / Homo sapiens P23229
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Integrin alpha-X / Homo sapiens P20702
- Integrin beta-1 / Homo sapiens P05556
- Integrin beta-3 / Homo sapiens P05106
- Integrin beta-5 / Homo sapiens P18084
- Integrin beta-6 / Homo sapiens P18564
- Interferon-gamma receptor alpha chain / Homo sapiens P15260
- Interleukin-6 receptor subunit beta / Homo sapiens P40189
- KDEL motif-containing protein 2 / Homo sapiens Q7Z4H8
- Lactadherin / Homo sapiens Q08431
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-2 / Homo sapiens P24043
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Laminin subunit alpha-5 / Homo sapiens O15230
- Laminin subunit beta-1 / Homo sapiens P07942
- Laminin subunit beta-2 / Homo sapiens P55268
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens Q14767
- Lipase member J / Homo sapiens Q5W064
- Lipase member K / Homo sapiens Q5VXJ0
- Liver carboxylesterase 1 / Homo sapiens P23141
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens Q9NZR2
- Low-density lipoprotein receptor-related protein 5 / Homo sapiens O75197
- Lumican / Homo sapiens P51884
- Lymphoid enhancer-binding factor 1 / Homo sapiens Q9UJU2
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens P38571
- Lysosomal acid phosphatase / Homo sapiens P11117
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosomal Pro-X carboxypeptidase / Homo sapiens P42785
- Lysosome membrane protein 2 / Homo sapiens Q14108
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Macrosialin / Homo sapiens P34810
- Mammaglobin-A / Homo sapiens Q13296
- Mammaglobin-B / Homo sapiens O75556
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Melanoma inhibitory activity protein 3 / Homo sapiens Q5JRA6
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Monoacylglycerol lipase ABHD12 / Homo sapiens Q8N2K0
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- Myelin protein zero-like protein 2 / Homo sapiens O60487
- N-acetylgalactosamine-6-sulfatase / Homo sapiens P34059
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens Q9NY97
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Neurofascin / Homo sapiens O94856
- Neuroplastin / Homo sapiens Q9Y639
- Neutral amino acid transporter B(0) / Homo sapiens Q15758
- Nicalin / Homo sapiens Q969V3
- Nicastrin / Homo sapiens Q92542
- Nodal modulator 1 / Homo sapiens Q15155
- Nodal modulator 2 / Homo sapiens Q5JPE7
- Nodal modulator 3 / Homo sapiens P69849
- Nuclear envelope integral membrane protein 1 / Homo sapiens O14524
- Nuclear pore membrane glycoprotein 210 / Homo sapiens Q8TEM1
- Nucleolar protein 56 / Homo sapiens O00567
- Olfactomedin-like protein 3 / Homo sapiens Q9NRN5
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens Q86WC4
- P2X purinoceptor 7 / Homo sapiens Q99572
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens O95302
- Peroxidasin homolog / Homo sapiens Q92626
- Phospholipase B-like 1 / Homo sapiens Q6P4A8
- Phospholipase D3 / Homo sapiens Q8IV08
- PI-PLC X domain-containing protein 3 / Homo sapiens Q63HM9
- Plasma protease c1 inhibitor / Homo sapiens P05155
- Plasminogen / Homo sapiens P00747
- Platelet glycoprotein 4 / Homo sapiens P16671
- Platelet-derived growth factor subunit b / Homo sapiens P01127
- Plexin-B2 / Homo sapiens O15031
- Plexin-c1 / Homo sapiens O60486
- Plexin-D1 / Homo sapiens Q9Y4D7
- Podocalyxin / Homo sapiens O00592
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prenylcysteine oxidase 1 / Homo sapiens Q9UHG3
- Probable C-mannosyltransferase DPY19L4 / Homo sapiens Q7Z388
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Procollagen galactosyltransferase 1 / Homo sapiens Q8NBJ5
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens O00469
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens O60568
- Progranulin / Homo sapiens P28799
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prolyl 3-hydroxylase 1 / Homo sapiens Q32P28
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Prosalusin / Homo sapiens Q8N2E6
- Prosaposin / Homo sapiens P07602
- Prostaglandin G/H synthase 1 / Homo sapiens P23219
- Prostaglandin G/H synthase 2 / Homo sapiens P35354
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Protein CREG1 / Homo sapiens O75629
- Protein O-mannosyl-transferase 2 / Homo sapiens Q9UKY4
- Protein OS-9 / Homo sapiens Q13438
- Protein sel-1 homolog 1 / Homo sapiens Q9UBV2
- Protein turtle homolog A / Homo sapiens Q9P2J2
- Protein Wnt-5a / Homo sapiens P41221
- Protocadherin alpha-12 / Homo sapiens Q9UN75
- Protocadherin beta-10 / Homo sapiens Q9UN67
- Protocadherin beta-11 / Homo sapiens Q9Y5F2
- Protocadherin beta-14 / Homo sapiens Q9Y5E9
- Protocadherin beta-15 / Homo sapiens Q9Y5E8
- Protocadherin beta-16 / Homo sapiens Q9NRJ7
- Protocadherin beta-2 / Homo sapiens Q9Y5E7
- Protocadherin beta-3 / Homo sapiens Q9Y5E6
- Protocadherin beta-5 / Homo sapiens Q9Y5E4
- Protocadherin beta-8 / Homo sapiens Q9UN66
- Protocadherin beta-9 / Homo sapiens Q9Y5E1
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens P04626
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Rho-related BTB domain-containing protein 3 / Homo sapiens O94955
- Seipin / Homo sapiens Q96G97
- Semaphorin-4D / Homo sapiens Q92854
- Serine--tRNA ligase, cytoplasmic / Homo sapiens P49591
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Serum paraoxonase/arylesterase 2 / Homo sapiens Q15165
- Sialate O-acetylesterase / Homo sapiens Q9HAT2
- Sialomucin core protein 24 / Homo sapiens Q04900
- Signal transducer CD24 / Homo sapiens P25063
- Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens O43166
- Sodium channel protein type 4 subunit alpha / Homo sapiens P35499
- Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens Q9UN76
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens P05026
- Solute carrier family 12 member 7 / Homo sapiens Q9Y666
- Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens P11166
- Sortilin / Homo sapiens Q99523
- Sortilin-related receptor / Homo sapiens Q92673
- Sparc / Homo sapiens P09486
- Stromal interaction molecule 1 / Homo sapiens Q13586
- SUN domain-containing ossification factor / Homo sapiens Q9UBS9
- Superoxide dismutase [Cu-Zn] / Homo sapiens P00441
- Suppressor of tumorigenicity 14 protein / Homo sapiens Q9Y5Y6
- Synaptonemal complex protein SC65 / Homo sapiens Q92791
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- Tapasin / Homo sapiens O15533
- Tetraspanin-3 / Homo sapiens O60637
- Tetratricopeptide repeat protein 17 / Homo sapiens Q96AE7
- Thioredoxin domain-containing protein 15 / Homo sapiens Q96J42
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Thrombospondin-3 / Homo sapiens P49746
- Thyroglobulin / Homo sapiens P01266
- TM2 domain-containing protein 1 / Homo sapiens Q9BX74
- TM2 domain-containing protein 3 / Homo sapiens Q9BRN9
- Toll-like receptor 2 / Homo sapiens O60603
- Torsin-1A / Homo sapiens O14656
- Torsin-1B / Homo sapiens O14657
- Torsin-2A / Homo sapiens Q5JU69
- Transcobalamin-1 / Homo sapiens P20061
- Transferrin receptor protein 1 / Homo sapiens P02786
- Transforming growth factor beta-3 / Homo sapiens P10600
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane 9 superfamily member 3 / Homo sapiens Q9HD45
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Transmembrane protein 131 / Homo sapiens Q92545
- Transmembrane protein 2 / Homo sapiens Q9UHN6
- Transmembrane protein 231 / Homo sapiens Q9H6L2
- Transmembrane protein 8A / Homo sapiens Q9HCN3
- Tumor necrosis factor ligand superfamily member 5 / Homo sapiens P29965
- Tumor necrosis factor receptor superfamily member 17 / Homo sapiens Q02223
- Twisted gastrulation protein homolog 1 / Homo sapiens Q9GZX9
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens Q9NYU2
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens Q6NSJ0
- Uncharacterized protein from Blood Serum / Homo sapiens
- UPF0577 protein KIAA1324 / Homo sapiens Q6UXG2
- Uromodulin / Homo sapiens P07911
- Uroplakin-3b-like protein / Homo sapiens B0FP48
- V-type proton ATPase subunit e 1 / Homo sapiens O15342
- V-type proton ATPase subunit S1 / Homo sapiens Q15904
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens P54289
- Von willebrand factor / Homo sapiens P04275
- Zinc transporter ZIP6 / Homo sapiens Q13433
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- Beta-lactoglobulin / Bos taurus P02754
- Lactotransferrin / Bos taurus P24627
- Platelet glycoprotein IV / Bos taurus P26201
- Ribonuclease pancreatic [b] / Bos taurus P61823
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus Q64676
- Adhesion G protein-coupled receptor F5 / Mus musculus G5E8Q8
- Alpha-(1,3)-fucosyltransferase 11 / Mus musculus Q8BHC9
- Alpha-L-iduronidase / Mus musculus P48441
- ATP-binding cassette sub-family A member 1 / Mus musculus P41233
- ATP-binding cassette sub-family A member 2 / Mus musculus P41234
- ATP-binding cassette sub-family A member 7 / Mus musculus Q91V24
- ATPase family AAA domain-containing protein 1 / Mus musculus Q9D5T0
- Attractin / Mus musculus Q9WU60
- Basigin / Mus musculus P18572
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Beta-hexosaminidase subunit alpha / Mus musculus P29416
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus Q8BTJ4
- Bone morphogenetic protein receptor type-2 / Mus musculus O35607
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-10 / Mus musculus P70408
- Cadherin-2 / Mus musculus P15116
- Cadherin-4 / Mus musculus P39038
- Calsyntenin-2 / Mus musculus Q9ER65
- Carbohydrate sulfotransferase 8 / Mus musculus Q8BQ86
- Carbonic anhydrase-related protein 11 / Mus musculus O70354
- Carboxypeptidase E / Mus musculus Q00493
- Carboxypeptidase M / Mus musculus Q80V42
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- CD180 antigen / Mus musculus Q62192
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus Q8VBZ3
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus Q8BXA5
- Clusterin / Mus musculus Q06890
- Contactin-1 / Mus musculus P12960
- Contactin-3 / Mus musculus Q07409
- Contactin-associated protein 1 / Mus musculus O54991
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- CUB and sushi domain-containing protein 1 / Mus musculus Q923L3
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus F6VAN0
- Cystatin-C / Mus musculus P21460
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus O35598
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus Q9R1V7
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus P46978
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus Q3TDQ1
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus Q4VA61
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus Q9R1E6
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus Q9EQG7
- Embigin / Mus musculus P21995
- Endoplasmin / Mus musculus P08113
- Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus Q3UZV7
- Ephrin-A1 / Mus musculus P52793
- ER membrane protein complex subunit 1 / Mus musculus Q8C7X2
- ER membrane protein complex subunit 10 / Mus musculus Q3TAS6
- Erlin-1 / Mus musculus Q91X78
- Erlin-2 / Mus musculus Q8BFZ9
- ERO1-like protein alpha / Mus musculus Q8R180
- Excitatory amino acid transporter 2 / Mus musculus P43006
- Galactose-3-O-sulfotransferase 3 / Mus musculus P61315
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus Q9CW73
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus P26048
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus P26049
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus Q8BHJ7
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus P22723
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Glia-derived nexin / Mus musculus Q07235
- Glutamate carboxypeptidase 2 / Mus musculus O35409
- Glutamate receptor 4 / Mus musculus Q9Z2W8
- Glutamate receptor ionotropic, kainate 2 / Mus musculus P39087
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus P35438
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus Q9JL56
- Glycine receptor subunit beta / Mus musculus P48168
- GPI inositol-deacylase / Mus musculus Q3UUQ7
- Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus Q3UDW8
- Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus Q9QYK5
- Hepatocyte cell adhesion molecule / Mus musculus Q640R3
- Hypoxia up-regulated protein 1 / Mus musculus Q9JKR6
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Inactive dipeptidyl peptidase 10 / Mus musculus Q6NXK7
- Insulin receptor / Mus musculus P15208
- Integrin alpha-1 / Mus musculus Q3V3R4
- Integrin alpha-M / Mus musculus P05555
- Integrin alpha-V / Mus musculus P43406
- Integrin beta-1 / Mus musculus P09055
- Integrin beta-2 / Mus musculus P11835
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus P59823
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus Q9R1V6-16
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus Q80TS3-2
- Isoform 2 of Catenin delta-1 / Mus musculus P30999-2
- Isoform 2 of Integrin alpha-3 / Mus musculus Q62470-2
- Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus Q2VLH6-2
- Isoform 2 of Teneurin-4 / Mus musculus Q3UHK6-2
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Kinesin-like protein / Mus musculus P33173
- Lactadherin / Mus musculus P21956
- Laminin subunit alpha-1 / Mus musculus P19137
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit alpha-5 / Mus musculus Q61001
- Leucine rich repeat protein 2, neuronal / Mus musculus Q6PHP6
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus Q9D1T0
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus Q3URE9
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus Q6GQU6
- Leucine-rich repeat-containing protein 24 / Mus musculus Q8BHA1
- Leucyl-cystinyl aminopeptidase / Mus musculus Q8C129
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Low-density lipoprotein receptor-related protein 1B / Mus musculus Q9JI18
- Lysosomal acid phosphatase / Mus musculus P24638
- Lysosomal protective protein / Mus musculus P16675
- Lysosome membrane protein 2 / Mus musculus O35114
- Lysosome-associated membrane glycoprotein 5 / Mus musculus Q9D387
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus Q0PMG2
- Membralin / Mus musculus Q8CIV2
- Metal transporter CNNM4 / Mus musculus Q69ZF7
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus P60882
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus Q6S5C2
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neural cell adhesion molecule L1-like protein / Mus musculus P70232
- Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus Q61477
- Neuroendocrine convertase 2 / Mus musculus P21661
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuronal pentraxin-1 / Mus musculus Q62443
- Neuroplastin / Mus musculus P97300
- Nicastrin / Mus musculus P57716
- Niemann-Pick C1 protein / Mus musculus O35604
- Nodal modulator 1 / Mus musculus Q6GQT9
- Noelin / Mus musculus O88998
- Nuclear pore membrane glycoprotein 210 / Mus musculus Q9QY81
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus Q8BGT0
- P2X purinoceptor 4 / Mus musculus Q9JJX6
- P2X purinoceptor 7 / Mus musculus Q9Z1M0
- Phosphatidylcholine-sterol acyltransferase / Mus musculus P16301
- Phospholipase D3 / Mus musculus O35405
- Platelet glycoprotein 4 / Mus musculus Q08857
- Plexin-A2 / Mus musculus P70207
- Plexin-A4 / Mus musculus Q80UG2
- Plexin-B1 / Mus musculus Q8CJH3
- Plexin-B2 / Mus musculus B2RXS4
- Plexin-C1 / Mus musculus Q9QZC2
- Prenylcysteine oxidase / Mus musculus Q9CQF9
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus Q9R0E2
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus Q9R0E1
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus Q91ZX7
- Prosaposin / Mus musculus Q61207
- Prostaglandin g/h synthase 2 / Mus musculus Q05769
- Prostaglandin-H2 D-isomerase / Mus musculus O09114
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Protein FAM234B / Mus musculus Q8BYI8
- Protein kinase C-binding protein NELL2 / Mus musculus Q61220
- Protein O-glucosyltransferase 1 / Mus musculus Q8BYB9
- Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus Q8BW41
- Protein OS-9 / Mus musculus Q8K2C7
- Protein sel-1 homolog 1 / Mus musculus Q9Z2G6
- Protocadherin Fat 1 / Mus musculus F2Z4A3
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus B9EKR1
- Reelin / Mus musculus Q60841
- Semaphorin-3E / Mus musculus P70275
- Semaphorin-4D / Mus musculus O09126
- Semaphorin-4F / Mus musculus Q9Z123
- Semaphorin-7A / Mus musculus Q9QUR8
- Serotransferrin / Mus musculus Q921I1
- Serpin H1 / Mus musculus P19324
- Serum paraoxonase/arylesterase 2 / Mus musculus Q62086
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus Q64689
- Sialic acid-binding Ig-like lectin / Mus musculus B7ZMQ5
- Sodium channel protein type 1 subunit alpha / Mus musculus A2APX8
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus Q8BJI1
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Solute carrier family 12 member 5 / Mus musculus Q91V14
- Sortilin / Mus musculus Q6PHU5
- Sortilin-related receptor / Mus musculus O88307
- SPARC / Mus musculus P07214
- SPARC-like protein 1 / Mus musculus P70663
- Synaptic vesicle glycoprotein 2A / Mus musculus Q9JIS5
- T-cell immunomodulatory protein / Mus musculus Q99KW9
- Teneurin-2 / Mus musculus Q9WTS5
- Testican-2 / Mus musculus Q9ER58
- Tetraspanin-3 / Mus musculus Q9QY33
- Thioredoxin domain-containing protein 15 / Mus musculus Q6P6J9
- Thy-1 membrane glycoprotein / Mus musculus P01831
- TM2 domain-containing protein 3 / Mus musculus Q8BJ83
- Torsin-1B / Mus musculus Q9ER41
- Translocon-associated protein subunit alpha / Mus musculus Q9CY50
- Translocon-associated protein subunit beta / Mus musculus Q9CPW5
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus Q8BG19
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Transmembrane protein 106B / Mus musculus Q80X71
- Transmembrane protein 131 / Mus musculus O70472
- Transmembrane protein 158 / Mus musculus Q6F5E0
- Transmembrane protein 181a / Mus musculus Q3U3W2
- Transmembrane protein 8B / Mus musculus B1AWJ4
- Tripeptidyl-peptidase 1 / Mus musculus O89023
- Tyrosine-protein kinase Mer / Mus musculus Q60805
- Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus Q9D906
- UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus Q920V1
- Uncharacterized protein / Mus musculus
- V-type proton ATPase subunit S1 / Mus musculus Q9R1Q9
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus Q6PHS9
- VPS10 domain-containing receptor SorCS1 / Mus musculus Q9JLC4
- Zinc transporter ZIP12 / Mus musculus Q5FWH7
- Zona pellucida sperm-binding protein matrix / Mus musculus Q62005 P10761 P20239
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Uncharacterized protein / Rattus norvegicus
- Coagulation factor VIII / Sus scrofa P12263
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012 K0BRG7
- Ascorbate oxidase / Acremonium sp. HI-25
- Hemocyanin / Androctonus australis
- Uncharacterized protein / Actinidia chinensis
- Uncharacterized protein / Apium graveolens var. oulce
- Art v II / Artemisia vulgaris
- Uncharacterized protein / Daucus carota
- Uncharacterized protein / Lycopersicon esculentum
- Ribonuclease s-6 / Nicotiana alata Q40379
- Uncharacterized protein / Solanum tuberosum
- Uncharacterized protein from Ovary / Asterias rubens
- Immunoglobulin gamma / Columba livia
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin gamma / Gallus gallus
- Immunoglobulin y / Gallus gallus
- Gp273 / Unio elongatulus
- Uncharacterized protein / Physomitrella patens
- Uncharacterized protein / Fagopyrum esculentum
- Acetylcholine receptor protein / Torpedo californica P02718 P02712 P02710 P02714
- Uncharacterized protein / Caenorhabditis elegans
- Uncharacterized protein / Caenorhabditis elegans
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Alpha-galactosidase a / Aspergillus niger P28351
- Alpha-glucosidase / Aspergillus niger P56526
- Endopolygalacturonase II / Aspergillus niger P26214
- Uncharacterized protein / Agaricus bisporus
- Uncharacterized protein / Aedes aegypti
- Arylphorin / Antheraea pernyi Q7Z1F8
- Uncharacterized protein from Hemolymph / Antheraea pernyi
- Apisin / Apis mellifera O18330
- Hyaluronoglucosaminidase / Apis mellifera Q08169
- Uncharacterized protein from Royal Jelly / Apis mellifera
- Membrane glycoproteins / Bombyx mori
- Sex-specific storage-protein 2 / Bombyx mori P20613
- Uncharacterized protein / Drosophila melanogaster
- Membrane glycoproteins / Mamestra brassicae
- Membrane glycoproteins / Spodoptera frugiperda
- Uncharacterized protein / Leptomonas Samueli
- Uncharacterized protein / Trypanosoma brucei brucei
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei P26334
- Variant surface glycoprotein mitat 1.4a / Trypansoma brucei P02896
- Uncharacterized protein / Persea americana
- Cobra venom factor / Naja kaouthia Q91132
- Uncharacterized protein / Allium cepa
- Uncharacterized protein / Asparagus officinalis
- Uncharacterized protein / Musa acuminata
- Alpha-amylase / Oryza sativa P17654
- Vitellogenin / Cherax quadricarinatus Q9GSG2
- Hemocyanin / Pontastacus leptodactylus P83180
- Envelope glycoprotein / Friend mink cell focus-forming virus
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus P03393
- Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant) P03393
- Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant) P03393
- Surface protein gp120 / Human immunodeficiency virus
- Surface protein gp120 / Human immunodeficiency virus type 1 (bh8 isolate) P04582
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Uncharacterized protein / Arabidopsis thaliana
- Uncharacterized protein / Arabidopsis thaliana
- Uncharacterized protein / Brassica oleracea var. botrytis
- Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis Q6YDN9
- Alpha-mannosidase / Canavalia ensiformis C0HJB3
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Carica papaya
- Uncharacterized protein / Citrus sinensis
- Uncharacterized protein / Corylus avellana
- Uncharacterized protein / Fragaria x ananassa
- Lectin / Glycine max P05046
- Uncharacterized protein / Glycine max
- Uncharacterized protein / Juglans regia
- Uncharacterized protein / Malus domestica var. golden delicious
- Uncharacterized protein / Phaseolus lunatus
- Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris P02873
- Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris P02873
- Phaseolin, alpha-type / Phaseolus vulgaris P07219
- Phaseolin, beta-type / Phaseolus vulgaris P02853
- Uncharacterized protein / Phaseolus vulgaris
- Uncharacterized protein / Pistacia vera
- Uncharacterized protein / Pisum sativum
- Uncharacterized protein / Prunus dulcis var. sativa
- Uncharacterized protein / Pyrus communis var. williams
- Uncharacterized protein / Ricinus communis
- Uncharacterized protein / Vigna radiata var. radiata
- Invertase / Saccharomyces cerevisiae
- Invertase 2 / Saccharomyces cerevisiae P00724
- Invertase [secreted form] / Saccharomyces cerevisiae
- Uncharacterized protein / Saccharomyces cerevisiae
- Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34) P03459
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Uncharacterized protein / Schistosoma mansoni
- Hemoglobin extracellular / Riftia pachyptila
Protein
- Ascitic fluid (UBERON_0007795)
- Blood (UBERON_0000178)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Coelomic Fluid (UBERON_0036217)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Hemolymph (UBERON_0001011)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) BHK-21 (CVCL_1914) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) BHK21/13/Py6 (CVCL_LM74) Plasma Membrane (GO_0005886)
- Kidney (UBERON_0002113) NRK (CVCL_3758) Fibroblast (CL_0000057)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048) Mv1Lu (CVCL_0593)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) Lec1 (CVCL_3440)
- Ovary (UBERON_0000992) Sf21 (CVCL_0518)
- Ovary (UBERON_0000992) Sf9 (CVCL_0549)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Prefrontal Cortex (UBERON:0000451)
- Retina (UBERON_0000966)
- Royal Jelly
- Striatum (UBERON_0002345)
- Umbilical Vein (UBERON_0002066) HUVEC-C (CVCL_2959) Endothelial Cell of Umbilical Vein (CL_0002618)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- BM-N (CVCL_Z633)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- BW5147 (CVCL_3896) Leukocyte (CL_0000738)
- BW5147.PHAR2.7 (CVCL_VT60) Leukocyte (CL_0000738)
- CE (CVCL_6D96)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- HEK293SF-3F6 (CVCL_4V95)
- HEK293T (CVCL_0063)
- IZD-MB-0503 (CVCL_C411) Hemocyte (CL_0000387)
- LS174T (CVCL_1384)
- LSTM-AA-20A (CVCL_Z354) Cell Surface (GO_0009986)
- NCI-H929 (CVCL_1600)
- NIH 3T3 (CVCL_0594) Fibroblast (CL_0000057)
- Rat1 (CVCL_0492)
- SPC-Mb-92-C6 (CVCL_VT62)
- Sf21 (CVCL_0518)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Delipidated Cell
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell Jelly Coat
- Egg Cell Yolk (GO_0060417)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Lymphocyte (CL_0000542)
- Cotyledon (BTO_0000300)
- Endosperm (BTO_0000390)
- Floret (BTO_0000468)
- Fruit (BTO_0000486)
- Leaf (BTO_0000713)
- Pollen (BTO_0001097)
- Root (BTO_0001188)
- Seed (BTO_0001226)
- Style (BTO_0001313)
- Tuber (BTO_0001400)
- Low-Density Lipoprotein Particle (GO_0034362)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / High-Mannose / Gal(?1-?)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Galf(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(?1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-?)[Man(a1-?)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Glc(a1-3)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Man(a1-3)Man(a1-3)"
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-2)Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-2)Man(a1-6)[Man(a1-2)Man(a1-3)]Man(a1-3)[Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-2)Man(a1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-2)Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Gal(?1-?)Man(a1-2)Man(a1-6)]Man(a1-6)[Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-2)Man(a1-6)]Man(a1-6)[Gal(?1-?)Man(a1-2)Man(a1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 4 x Man(a1-2)"
- N-Linked / High-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 6 x Man"
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-3)Man(a1-2)Man(a1-6)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-3)Man(a1-2)Man(a1-2)[Man(a1-6)]Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Man(a1-?)Man(a1-?)[Man(a1-?)Man(a1-?)]Man(a1-?)[Man(a1-?)Man(a1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / High-Mannose / Structure 3677
- N-Linked / High-Mannose / Structure 9447
- N-Linked / High-Mannose / Structure 9833
- N-Linked / High-Mannose / Structure 10029
- N-Linked / High-Mannose / Structure 10261
- N-Linked / High-Mannose / Structure 10277
- N-Linked / High-Mannose / Structure 10663
- N-Linked / High-Mannose / Structure 10904
- N-Linked / High-Mannose / Structure 11921
- N-Linked / Undefined core / Structure 9685
- N-Linked / Undefined core / Structure 9708
Reported structure
- Hex:9 HexNAc:2 (avg mass : 1883.6869 )
Composition
- Atopic dermatitis (DOID:3310)
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Erythroleukemia with associated Polycythemia
- Gastritis (DOID:4029)
- Hyper IgE syndrome (DOID:0080545)
- Hypercholesterolemia, Familial (DOID:13810)
- Hyperimmune condition
- Leukemia, Acute lymphoblastic (DOID:9952)
- Lymphoma (DOID:0060058)
- Middle East respiratory syndrome (DOID:0080642)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Waldenstrom Macroglobulinaemia (DOID:0060901)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-GarcÃa J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- N-Glycosylation in isolated rat nerve terminals (2021 - Matthies I, Abrahams JL, Jensen P, Oliveira T, Kolarich D, Larsen MR) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- A Microarray-Matrix-assisted Laser Desorption/Ionization-Mass Spectrometry Approach for Site-specific Protein N-glycosylation Analysis, as Demonstrated for Human Serum Immunoglobulin M (IgM) (2015 - Martin Pabst, Simon Karl Küster, Fabian Wahl, Jasmin Krismer, Petra S.Dittrich, Renato Zenobi) / Status : Reviewed
- A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- B-cell maturation antigen is modified by a single N-glycan chain that modulates ligand binding and surface retention. (2013 - Huang HW, Chen CH, Lin CH, Wong CH, Lin KI) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- Structural characterization of the N-glycan moiety and site of glycosylation in vitellogenin from the decapod crustacean Cherax quadricarinatus. (2004 - Khalaila I, Peter-Katalinic J, Tsang C, Radcliffe CM, Aflalo ED, Harvey DJ, Dwek RA, Rudd PM, Sagi A) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A. (2003 - Henriksson H, Denman SE, Campuzano ID, Ademark P, Master ER, Teeri TT, Brumer H) / Status : Reviewed
- Structural determination of the N-glycans of a lepidopteran arylphorin reveals the presence of a monoglucosylated oligosaccharide in the storage protein. (2003 - Kim S, Hwang SK, Dwek RA, Rudd PM, Ahn YH, Kim EH, Cheong C, Kim SI, Park NS, Lee SM) / Status : Reviewed
- N-glycan structures of pigeon IgG: a major serum glycoprotein containing Galalpha1-4 Gal termini.. (2003 - Suzuki N, Khoo KH, Chen CM, Chen HC, Lee YC) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Tandem mass spectrometry of ribonuclease A and B: N-linked glycosylation site analysis of whole protein ions (2002 - Reid, Stephenson, McLuckey) / Status : Reviewed
- Analysis of Asn-linked glycans from vegetable foodstuffs: widespread occurrence of Lewis a, core alpha1,3-linked fucose and xylose substitutions. (2001 - Wilson IB, Zeleny R, Kolarich D, Staudacher E, Stroop CJ, Kamerling JP, Altmann F) / Status : Reviewed
- Determination of carbohydrate structures N-linked to soluble CD154 and characterization of the interactions of CD40 with CD154 expressed in Pichia pastoris and Chinese hamster ovary cells (2001 - Khandekar, Silverman, Wells-Marani, Bacon, Birrell, Brigham-Burke, DeMarini, Jonak, Camilleri, Fishman-Lobell) / Status : Reviewed
- Characterization of glycosylated variants of beta-lactoglobulin expressed in Pichia pastoris (2001 - Kalidas, Joshi, Batt) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Characterization of the glycosylation sites in cyclooxygenase-2 using mass spectrometry. (2001 - Nemeth J, Hochgesang G, Marnett L, Caprioli R, Hochensang G) / Status : Reviewed
- N-linked oligosaccharides of cobra venom factor contain novel alpha(1-3)galactosylated Le(x) structures. (2001 - Gowda DC, Glushka J, van-Halbeek H , Thotakura RN, Bredehorst R, Vogel C-W) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- The nematode Caenorhabditis elegans synthesizes unusual O-linked glycans: identification of glucose-substituted mucin-type O-glycans and short chondroitin-like oligosaccharides (2001 - Guerardel, Balanzino, Maes, Leroy, Coddeville, Oriol, Strecker) / Status : Reviewed
- Structural characterization of the N-glycans of gp273, the ligand for sperm-egg interaction in the mollusc bivalve Unio elongatulus. (2001 - Di Patrizi L, Capone A, Focarelli R, Rosati F, Gallego RG, Gerwig GJ, Vliegenthart JF) / Status : Reviewed
- Characterization of the glycosylation profiles of Alzheimer's beta -secretase protein Asp-2 expressed in a variety of cell lines. (2001 - Charlwood J, Dingwall C, Matico R, Hussain I, Johanson K, Moore S, Powell DJ, Skehel JM, Ratcliffe S, Clarke B, Trill J, Sweitzer S, Camilleri P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structural features of N-glycans linked to royal jelly glycoproteins: structures of high-mannose type, hybrid type, and biantennary type glycans. (2000 - Kimura Y, Miyagi C, Kimura M, Nitoda T, Kawai N, Sugimoto H) / Status : Reviewed
- Processing pathway deduced from the structures of N-glycans in Carica papaya. (2000 - Makino Y, Shimazaki A, Omichi K, Odani S, Hase S) / Status : Reviewed
- Control of bisecting GlcNAc addition to N-linked sugar chains. (2000 - Fukuta K, Abe R, Yokomatsu T, Omae F, Asanagi M, Makino T) / Status : Reviewed
- In vivo trafficking and catabolism of IgG1 antibodies with Fc associated carbohydrates of differing structure. (2000 - Wright A, Sato Y, Okada T, Chang K, Endo T, Morrison S) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Structural analysis of the asparagine-linked glycans from the procyclic Trypanosoma brucei and its glycosylation mutants resistant to Concanavalin A killing. (2000 - Hwa K, Khoo K) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- The N-glycans of jack bean alpha-mannosidase. Structure, topology and function. (1999 - Kimura Y, Hess D, Sturm A) / Status : Reviewed
- Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
- Characterization of N-glycans from Arabidopsis. Application to a fucose-deficient mutant. (1999 - Rayon C, Cabanes-Macheteau M, Loutelier-Bourhis C, Salliot-Maire I, Lemoine J, Reiter W, Lerouge P, Faye L) / Status : Reviewed
- Partially glucose-capped oligosaccharides are found on the hemoglobins of the deep-sea tube worm Riftia pachyptila. (1998 - Zal F, Kuster B, Green BN, Harvey DJ, Lallier FH) / Status : Reviewed
- Structural characterization of the N-linked oligosaccharides derived from HIVgp120 expressed in lepidopteran cells. (1998 - Butters T, Yudkin B, Jacob G, Jones I) / Status : Reviewed
- Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Identification of the glycosylation site and glycan structures of recombinant endopolygalacturonase II by mass spectrometry (1997 - Yang, Bergmann, Benen, Orlando) / Status : Reviewed
- Elucidation of N-linked oligosaccharide structures of recombinant human factor VIII using fluorophore-assisted carbohydrate electrophoresis. (1996 - Kumar H, Hague C, Haley T, Starr C, Besman M, Lundblad R, Baker D) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Novel beta-D-galactofuranose-containing high-mannose type oligosaccharides in ascorbate oxidase from Acremonium sp. HI-25. (1996 - Ohta M, Emi S, Iwamoto H, Hirose J, Hiromi K, Itoh H, Shin T, Murao S, Matsuura F) / Status : Reviewed
- The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide. (1995 - Hayes G, Williams A, Costello C, Enns C, Lucas J) / Status : Reviewed
- The asparagine-linked carbohydrate of honeybee venom hyaluronidase. (1995 - Kubelka V, Altmann F, Mrz L) / Status : Reviewed
- N-linked sugar chains of 350-kDa royal jelly glycoprotein. (1995 - Kimura Y, Washino N, Yonekura M) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Characterization of N-linked carbohydrate chains of the crayfish, Astacus leptodactylus hemocyanin. (1995 - Tseneklidou-Stoeter D, Gerwig GJ, Kamerling JP, Spindler KD) / Status : Reviewed
- Glycosylation of glycoprotein 55 encoded by the anaemia-inducing strain of Friend spleen focus-forming virus. (1994 - Volker J, Geyer H, Geyer R) / Status : Reviewed
- A detailed structural characterization of ribonuclease B oligosaccharides by 1H NMR spectroscopy and mass spectrometry. (1994 - Fu D, Chen L, O'Neill R) / Status : Reviewed
- Novel structures of N-linked high-mannose type oligosaccharides containing alpha-D-galactofuranosyl linkages in Aspergillus niger alpha-D-glucosidase. (1994 - Takayanagi T, Kimura A, Chiba S, Ajisaka K) / Status : Reviewed
- Structures of the N-linked oligosaccharides of the membrane glycoproteins from three lepidopteran cell lines (Sf-21, IZD-Mb-0503, Bm-N). (1994 - Kubelka V, Altmann F, Kornfeld G, Mrz L) / Status : Reviewed
- The carbohydrate structures of Trypanosoma brucei brucei MITat 1.6 variant surface glycoprotein. A re-investigation of the C-terminal glycan. (1993 - Strang A, Allen A, Holder A, van Halbeek H) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Glycoprotein biosynthesis in the alg3 Saccharomyces cerevisiae mutant. II. Structure of novel Man6-10GlcNAc2 processing intermediates on secreted invertase. (1993 - Verostek M, Atkinson P, Trimble R) / Status : Reviewed
- Glycosylation pattern and processing of envelope gene products encoded by glycosylation mutants of Friend spleen focus-forming virus. (1993 - Freis A, Rau S, Friedrich R, Geyer R) / Status : Reviewed
- Site-specific N-glycosylation and oligosaccharide structures of recombinant HIV-1 gp120 derived from a baculovirus expression system. (1993 - Yeh J, Seals J, Murphy C, van Halbeek H, Cummings R) / Status : Reviewed
- Isolation of oligomannose-type glycans from bean glycoproteins. (1993 - Lu Y, Ye J, Wold F) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of porcine factor VIII--tissue- and species-specific glycosylation of factor VIII. (1993 - Hironaka T, Furukawa K, Esmon P, Yokota T, Brown J, Sawada S, Fournel M, Kato M, Minaga T, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Structures of N-linked oligosaccharides of microsomal glycoproteins from developing castor bean endosperms. (1992 - Kimura Y, Nakagawa Y, Tokuda T, Yamai M, Nakajima S, Higashide E, Takagi S) / Status : Reviewed
- Structural heterogeneity in the Man8-13GlcNAc oligosaccharides from log-phase Saccharomyces yeast: a one- and two-dimensional 1H NMR spectroscopic study. (1992 - Trimble R, Atkinson P) / Status : Reviewed
- Novel N-linked oligo-mannose type oligosaccharides containing an alpha-D-galactofuranosyl linkage found in alpha-D-galactosidase from Aspergillus niger. (1992 - Takayanagi T, Kushida K, Idonuma K, Ajisaka K) / Status : Reviewed
- Structures of sugar chains of the subunits of an alpha-amylase inhibitor from Phaseolus vulgaris white kidney beans. (1992 - Yamaguchi H, Funaoka H, Iwamoto H) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Structure of oligosaccharides on Saccharomyces SUC2 invertase secreted by the methylotrophic yeast Pichia pastoris. (1991 - Trimble R, Atkinson P, Tschopp J, Townsend R, Maley F) / Status : Reviewed
- Structures of the asparagine-289-linked oligosaccharides assembled on recombinant human plasminogen expressed in a Mamestra brassicae cell line (IZD-MBO503). (1991 - Davidson D, Castellino F) / Status : Reviewed
- The conformational effects of N-glycosylation on the tailpiece from serum IgM. (1991 - Wormald M, Wooten E, Bazzo R, Edge C, Feinstein A, Rademacher T, Dwek R) / Status : Reviewed
- Structural analysis of the glycoprotein allergen Art v II from the pollen of mugwort (Artemisia vulgaris L.). (1991 - Nilsen B, Sletten K, Paulsen B, O'Neill M, van Halbeek H) / Status : Reviewed
- Asparagine-linked oligosaccharide processing in lepidopteran insect cells. Temporal dependence of the nature of the oligosaccharides assembled on asparagine-289 of recombinant human plasminogen produced in baculovirus vector infected Spodoptera frugiperda (IPLB-SF-21AE) cells. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Oligosaccharide structures present on asparagine-289 of recombinant human plasminogen expressed in a Chinese hamster ovary cell line. (1991 - Davidson D, Castellino F) / Status : Reviewed
- Localization of alpha 1----3-linked mannoses in the N-linked oligosaccharides of Saccharomyces cerevisiae mnn mutants. (1990 - Alvarado E, Ballou L, Hernandez L, Ballou C) / Status : Reviewed
- Structure and biosynthesis of the xylose-containing carbohydrate moiety of rice alpha-amylase. (1990 - Hayashi M, Tsuru A, Mitsui T, Takahashi N, Hanzawa H, Arata Y, Akazawa T) / Status : Reviewed
- Glycosylation of the envelope glycoprotein from a polytropic murine retrovirus in two different host cells. (1990 - Geyer H, Kempf R, Schott H, Geyer R) / Status : Reviewed
- Structures of the asparagine-linked sugar chain of glucose transporter from human erythrocytes. (1990 - Endo T, Kasahara M, Kobata A) / Status : Reviewed
- Oligosaccharide processing in the expression of human plasminogen cDNA by lepidopteran insect (Spodoptera frugiperda) cells. (1990 - Davidson D, Fraser M, Castellino F) / Status : Reviewed
- Characterisation of the asparagine-linked oligosaccharides from Trypanosoma brucei type-I variant surface glycoproteins. (1990 - Zamze SE, Wooten EW, Ashford DA, Ferguson MA, Dwek RA, Rademacher TW) / Status : Reviewed
- The oligosaccharides of influenza virus hemagglutinin expressed in insect cells by a baculovirus vector. (1990 - Kuroda K, Geyer H, Geyer R, Doerfler W, Klenk H) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Characterization of the high mannose asparagine-linked oligosaccharides synthesized by Schistosoma mansoni adult male worms. (1988 - Nyame K, Cummings R, Damian R) / Status : Reviewed
- Structural characterization of several galactofuranose-containing, high-mannose-type oligosaccharides present in glycoproteins of the trypanosomatid Leptomonas samueli. (1988 - Moraes CT, Bosch M, Parodi AJ) / Status : Reviewed
- Structure, position, and biosynthesis of the high mannose and the complex oligosaccharide side chains of the bean storage protein phaseolin. (1987 - Sturm A, Van Kuik J, Vliegenthart J, Chrispeels M) / Status : Reviewed
- Characterization of N-linked gluco-oligomannose type of carbohydrate chains of glycoproteins from the ovary of the starfish Asterias rubens (L.). (1987 - De Waard P, Kamerling JP, Van Halbeek H, Vliegenthart JF, Broertjes JJ) / Status : Reviewed
- Primary structure of the oligosaccharide moiety of hemocyanin from the scorpion Androctonus australis. (1986 - Debeire P, Montreuil J, Goyffon M, Van Kuik AJ, Halbeek HV, Vliegenthart JFG) / Status : Reviewed
- Carbohydrates of influenza virus. Structural elucidation of the individual glycans of the FPV hemagglutinin by two-dimensional 1H n.m.r. and methylation analysis. (1985 - Keil W, Geyer R, Dabrowski J, Dabrowski U, Niemann H, Stirm S, Klenk H) / Status : Reviewed
- High-mannose structure of apolipoprotein-B from low-density lipoproteins of human plasma. (1985 - Vauhkonen M, Viitala J, Parkkinen J, Rauvala H) / Status : Reviewed
- The effect of castanospermine on the oligosaccharide structures of glycoproteins from lymphoma cell lines. (1985 - Palamarczyk G, Elbein AD) / Status : Reviewed
- Comparative study of the oligosaccharides released from baby hamster kidney cells and their polyoma transformant by hydrazinolysis. (1984 - Yamashita K, Ohkura T, Tachibana Y, Takasaki S, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed
- Primary structure of the carbohydrate chain of soybean agglutinin. A reinvestigation by high resolution 1H NMR spectroscopy (1981 - Dorland L, van Halbeek H, Vliegenthart JFG, Lis H, Sharon N) / Status : Reviewed
- Isolation and characterization of mosquito cell membrane glycoproteins. (1981 - Butters T, Hughes R) / Status : Reviewed
- Soybean agglutinin--a plant glycoprotein. Structure of the carboxydrate unit. (1978 - Lis H, Sharon N) / Status : Reviewed
Reference
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Homo sapiens
- 3-hydroxy-3-methylglutaryl-coenzyme A reductase / Homo sapiens
- 4F2 cell-surface antigen heavy chain / Homo sapiens
- Acid ceramidase / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Agrin / Homo sapiens
- Alpha-1-acid glycoprotein 1 / Homo sapiens
- Alpha-1-acid glycoprotein 2 / Homo sapiens
- Alpha-2-macroglobulin-like protein 1 / Homo sapiens
- Alpha-galactosidase A / Homo sapiens
- Alpha-L-iduronidase / Homo sapiens
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Amphoterin-induced protein 2 / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
- Anoctamin-6 / Homo sapiens
- Antithrombin-III / Homo sapiens
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
- Asn-185
- Apolipoprotein D / Homo sapiens
- Aspartyl/asparaginyl beta-hydroxylase / Homo sapiens
- ATP-binding cassette sub-family A member 1 / Homo sapiens
- ATP-binding cassette sub-family A member 2 / Homo sapiens
- ATP-binding cassette sub-family A member 7 / Homo sapiens
- Attractin / Homo sapiens
- Basigin / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Beta-hexosaminidase subunit alpha / Homo sapiens
-
Beta-secretase / Homo sapiens
- Undefined site
- Biglycan / Homo sapiens
- C-type mannose receptor 2 / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
-
Cadherin-5 / Homo sapiens
- Undefined site
- Calcium-activated chloride channel regulator 2 / Homo sapiens
- Calponin-3 / Homo sapiens
- Calreticulin / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cartilage oligomeric matrix protein / Homo sapiens
- Cartilage-associated protein / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-independent mannose-6-phosphate receptor / Homo sapiens
- CD109 antigen / Homo sapiens
- CD166 antigen / Homo sapiens
- CD82 antigen / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Ceroid-lipofuscinosis neuronal protein 5 / Homo sapiens
- Choline transporter-like protein 4 / Homo sapiens
- Chondroitin sulfate glucuronyltransferase / Homo sapiens
- Cleft lip and palate transmembrane protein 1 / Homo sapiens
- Cleft lip and palate transmembrane protein 1-like protein / Homo sapiens
- Clusterin / Homo sapiens
-
Coagulation factor VIII / Homo sapiens
- Undefined site
- Coiled-coil domain-containing protein 80 / Homo sapiens
- Collagen alpha-1(I) chain / Homo sapiens
- Collagen alpha-1(III) chain / Homo sapiens
- Collagen alpha-1(V) chain / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(I) chain / Homo sapiens
- Collagen alpha-2(V) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Collagen alpha-6(VI) chain / Homo sapiens
- Complement C2 / Homo sapiens
- Complement c3 / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- CUB domain-containing protein 1 / Homo sapiens
- Cytokine receptor-like factor 1 / Homo sapiens
- Deoxyribonuclease-2-alpha / Homo sapiens
- Desmocollin-2 / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 10 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
- Dystroglycan / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Endogenous retrovirus group 3 member 1 Env polyprotein / Homo sapiens
- Endoplasmin / Homo sapiens
- Ephrin-A3 / Homo sapiens
- Epidermal growth factor receptor / Homo sapiens
- ER degradation-enhancing alpha-mannosidase-like protein 3 / Homo sapiens
- ER membrane protein complex subunit 1 / Homo sapiens
- ER membrane protein complex subunit 10 / Homo sapiens
- Erlin-1 / Homo sapiens
- Erlin-2 / Homo sapiens
- ERO1-like protein alpha / Homo sapiens
- Extracellular sulfatase Sulf-1 / Homo sapiens
- Extracellular sulfatase Sulf-2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroblast growth factor receptor 1 / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Follistatin-related protein 1 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Glucosidase 2 subunit beta / Homo sapiens
- Glucoside xylosyltransferase 1 / Homo sapiens
- Glucosylceramidase / Homo sapiens
- Golgi apparatus protein 1 / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- GPI ethanolamine phosphate transferase 1 / Homo sapiens
- Heat shock 70 kDa protein 13 / Homo sapiens
- Hemopexin / Homo sapiens
- Heparan-alpha-glucosaminide N-acetyltransferase / Homo sapiens
- HLA class I histocompatibility antigen, A-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-29 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-3 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-30 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-31 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-33 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-68 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-69 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-74 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, alpha chain E / Homo sapiens
- HLA class I histocompatibility antigen, B-14 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-35 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-37 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-38 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-39 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-40 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-42 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-46 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-47 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-48 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-67 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-7 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-8 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-81 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, B-82 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-1 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-12 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-14 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-15 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-16 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-17 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-2 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-3 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-5 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-8 alpha chain / Homo sapiens
- HLA class II histocompatibility antigen gamma chain / Homo sapiens
- HLA class II histocompatibility antigen, DR alpha chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Hyaluronidase-4 / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
- Asn-275
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-225
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L115N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin superfamily member 8 / Homo sapiens
- Inactive tyrosine-protein kinase 7 / Homo sapiens
- Insulin-like growth factor-binding protein complex acid labile subunit / Homo sapiens
- Integrin alpha-1 / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-6 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin alpha-X / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Integrin beta-3 / Homo sapiens
- Integrin beta-5 / Homo sapiens
- Integrin beta-6 / Homo sapiens
- Interferon-gamma receptor alpha chain / Homo sapiens
- Interleukin-6 receptor subunit beta / Homo sapiens
- KDEL motif-containing protein 2 / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-2 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Laminin subunit beta-1 / Homo sapiens
- Laminin subunit beta-2 / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Lipase member J / Homo sapiens
- Lipase member K / Homo sapiens
- Liver carboxylesterase 1 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Low-density lipoprotein receptor-related protein 1B / Homo sapiens
- Low-density lipoprotein receptor-related protein 5 / Homo sapiens
- Lumican / Homo sapiens
- Lymphoid enhancer-binding factor 1 / Homo sapiens
- Lysosomal acid lipase/cholesteryl ester hydrolase / Homo sapiens
- Lysosomal acid phosphatase / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosomal Pro-X carboxypeptidase / Homo sapiens
- Lysosome membrane protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Macrosialin / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Mammaglobin-B / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Melanoma inhibitory activity protein 3 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Monoacylglycerol lipase ABHD12 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- Myelin protein zero-like protein 2 / Homo sapiens
- N-acetylgalactosamine-6-sulfatase / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Neurofascin / Homo sapiens
- Neuroplastin / Homo sapiens
- Neutral amino acid transporter B(0) / Homo sapiens
- Nicalin / Homo sapiens
- Nicastrin / Homo sapiens
- Nodal modulator 1 / Homo sapiens
- Nodal modulator 2 / Homo sapiens
- Nodal modulator 3 / Homo sapiens
- Nuclear envelope integral membrane protein 1 / Homo sapiens
- Nuclear pore membrane glycoprotein 210 / Homo sapiens
- Nucleolar protein 56 / Homo sapiens
- Olfactomedin-like protein 3 / Homo sapiens
- Osteopetrosis-associated transmembrane protein 1 / Homo sapiens
- P2X purinoceptor 7 / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP9 / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Phospholipase B-like 1 / Homo sapiens
- Phospholipase D3 / Homo sapiens
- PI-PLC X domain-containing protein 3 / Homo sapiens
- Plasma protease c1 inhibitor / Homo sapiens
-
Plasminogen / Homo sapiens
- Undefined site
- Platelet glycoprotein 4 / Homo sapiens
- Platelet-derived growth factor subunit b / Homo sapiens
- Plexin-B2 / Homo sapiens
- Plexin-c1 / Homo sapiens
- Plexin-D1 / Homo sapiens
- Podocalyxin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prenylcysteine oxidase 1 / Homo sapiens
- Probable C-mannosyltransferase DPY19L4 / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Procollagen galactosyltransferase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
- Progranulin / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prolyl 3-hydroxylase 1 / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Prosalusin / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin G/H synthase 1 / Homo sapiens
- Prostaglandin G/H synthase 2 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Protein CREG1 / Homo sapiens
- Protein O-mannosyl-transferase 2 / Homo sapiens
- Protein OS-9 / Homo sapiens
- Protein sel-1 homolog 1 / Homo sapiens
- Protein turtle homolog A / Homo sapiens
- Protein Wnt-5a / Homo sapiens
- Protocadherin alpha-12 / Homo sapiens
- Protocadherin beta-10 / Homo sapiens
- Protocadherin beta-11 / Homo sapiens
- Protocadherin beta-14 / Homo sapiens
- Protocadherin beta-15 / Homo sapiens
- Protocadherin beta-16 / Homo sapiens
- Protocadherin beta-2 / Homo sapiens
- Protocadherin beta-3 / Homo sapiens
- Protocadherin beta-5 / Homo sapiens
- Protocadherin beta-8 / Homo sapiens
- Protocadherin beta-9 / Homo sapiens
- Receptor tyrosine-protein kinase erbB-2 / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Rho-related BTB domain-containing protein 3 / Homo sapiens
- Seipin / Homo sapiens
- Semaphorin-4D / Homo sapiens
- Serine--tRNA ligase, cytoplasmic / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Serum paraoxonase/arylesterase 2 / Homo sapiens
- Sialate O-acetylesterase / Homo sapiens
- Sialomucin core protein 24 / Homo sapiens
- Signal transducer CD24 / Homo sapiens
- Signal-induced proliferation-associated 1-like protein 1 / Homo sapiens
- Sodium channel protein type 4 subunit alpha / Homo sapiens
- Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) / Homo sapiens
- Sodium/potassium-transporting ATPase subunit beta-1 / Homo sapiens
- Solute carrier family 12 member 7 / Homo sapiens
-
Solute carrier family 2, facilitated glucose transporter, member 1 / Homo sapiens
- Undefined site
- Sortilin / Homo sapiens
- Sortilin-related receptor / Homo sapiens
- Sparc / Homo sapiens
- Stromal interaction molecule 1 / Homo sapiens
- SUN domain-containing ossification factor / Homo sapiens
- Superoxide dismutase [Cu-Zn] / Homo sapiens
- Suppressor of tumorigenicity 14 protein / Homo sapiens
- Synaptonemal complex protein SC65 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tapasin / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Tetratricopeptide repeat protein 17 / Homo sapiens
- Thioredoxin domain-containing protein 15 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Thrombospondin-3 / Homo sapiens
- Thyroglobulin / Homo sapiens
- TM2 domain-containing protein 1 / Homo sapiens
- TM2 domain-containing protein 3 / Homo sapiens
- Toll-like receptor 2 / Homo sapiens
- Torsin-1A / Homo sapiens
- Torsin-1B / Homo sapiens
- Torsin-2A / Homo sapiens
- Transcobalamin-1 / Homo sapiens
- Transferrin receptor protein 1 / Homo sapiens
- Transforming growth factor beta-3 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane 9 superfamily member 3 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Transmembrane protein 131 / Homo sapiens
- Transmembrane protein 2 / Homo sapiens
- Transmembrane protein 231 / Homo sapiens
- Transmembrane protein 8A / Homo sapiens
-
Tumor necrosis factor ligand superfamily member 5 / Homo sapiens
- Undefined site
- Tumor necrosis factor receptor superfamily member 17 / Homo sapiens
- Twisted gastrulation protein homolog 1 / Homo sapiens
- UDP-glucose:glycoprotein glucosyltransferase 1 / Homo sapiens
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- UPF0577 protein KIAA1324 / Homo sapiens
- Uromodulin / Homo sapiens
- Uroplakin-3b-like protein / Homo sapiens
- V-type proton ATPase subunit e 1 / Homo sapiens
- V-type proton ATPase subunit S1 / Homo sapiens
- Voltage-dependent calcium channel subunit alpha-2/delta-1 / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc transporter ZIP6 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
-
Beta-lactoglobulin / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Ribonuclease pancreatic [b] / Bos taurus
- Undefined site
- Asn-60
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Immunoglobulin gamma-1 / Hybrid - homo sapiens/mus musculus
- Undefined site
- 2-hydroxyacylsphingosine 1-beta-galactosyltransferase / Mus musculus
- Adhesion G protein-coupled receptor F5 / Mus musculus
- Alpha-(1,3)-fucosyltransferase 11 / Mus musculus
- Alpha-L-iduronidase / Mus musculus
- ATP-binding cassette sub-family A member 1 / Mus musculus
- ATP-binding cassette sub-family A member 2 / Mus musculus
- ATP-binding cassette sub-family A member 7 / Mus musculus
- ATPase family AAA domain-containing protein 1 / Mus musculus
- Attractin / Mus musculus
- Basigin / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Beta-hexosaminidase subunit alpha / Mus musculus
- Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
- Bone morphogenetic protein receptor type-2 / Mus musculus
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-10 / Mus musculus
- Cadherin-2 / Mus musculus
- Cadherin-4 / Mus musculus
- Calsyntenin-2 / Mus musculus
- Carbohydrate sulfotransferase 8 / Mus musculus
- Carbonic anhydrase-related protein 11 / Mus musculus
- Carboxypeptidase E / Mus musculus
- Carboxypeptidase M / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- CD180 antigen / Mus musculus
- Cell cycle control protein 50A / Mus musculus
- Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
- Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
- Clusterin / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-3 / Mus musculus
- Contactin-associated protein 1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- CUB and sushi domain-containing protein 1 / Mus musculus
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Mus musculus
- Cystatin-C / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 10 / Mus musculus
- Disintegrin and metalloproteinase domain-containing protein 23 / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Mus musculus
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Mus musculus
- Down syndrome cell adhesion molecule-like protein 1 homolog / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
- Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
- Embigin / Mus musculus
- Endoplasmin / Mus musculus
- Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus
- Ephrin-A1 / Mus musculus
- ER membrane protein complex subunit 1 / Mus musculus
- ER membrane protein complex subunit 10 / Mus musculus
- Erlin-1 / Mus musculus
- Erlin-2 / Mus musculus
- ERO1-like protein alpha / Mus musculus
- Excitatory amino acid transporter 2 / Mus musculus
- Galactose-3-O-sulfotransferase 3 / Mus musculus
- Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-2 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-3 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-5 / Mus musculus
- Gamma-aminobutyric acid receptor subunit gamma-2 / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Glia-derived nexin / Mus musculus
- Glutamate carboxypeptidase 2 / Mus musculus
- Glutamate receptor 4 / Mus musculus
- Glutamate receptor ionotropic, kainate 2 / Mus musculus
- Glutamate receptor ionotropic, NMDA 1 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Glycerophosphodiester phosphodiesterase 1 / Mus musculus
- Glycine receptor subunit beta / Mus musculus
- GPI inositol-deacylase / Mus musculus
- Heparan-alpha-glucosaminide N-acetyltransferase / Mus musculus
- Heparan-sulfate 6-O-sulfotransferase 1 / Mus musculus
- Hepatocyte cell adhesion molecule / Mus musculus
- Hypoxia up-regulated protein 1 / Mus musculus
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Inactive dipeptidyl peptidase 10 / Mus musculus
- Insulin receptor / Mus musculus
- Integrin alpha-1 / Mus musculus
- Integrin alpha-M / Mus musculus
- Integrin alpha-V / Mus musculus
- Integrin beta-1 / Mus musculus
- Integrin beta-2 / Mus musculus
- Interleukin-1 receptor accessory protein-like 1 / Mus musculus
- Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
- Isoform 2 of Adhesion G protein-coupled receptor L3 / Mus musculus
- Isoform 2 of Catenin delta-1 / Mus musculus
- Isoform 2 of Integrin alpha-3 / Mus musculus
- Isoform 2 of Scavenger receptor cysteine-rich type 1 protein M130 / Mus musculus
- Isoform 2 of Teneurin-4 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Kinesin-like protein / Mus musculus
- Lactadherin / Mus musculus
- Laminin subunit alpha-1 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit alpha-5 / Mus musculus
- Leucine rich repeat protein 2, neuronal / Mus musculus
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 / Mus musculus
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 / Mus musculus
- Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 / Mus musculus
- Leucine-rich repeat-containing protein 24 / Mus musculus
- Leucyl-cystinyl aminopeptidase / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Low-density lipoprotein receptor-related protein 1B / Mus musculus
- Lysosomal acid phosphatase / Mus musculus
- Lysosomal protective protein / Mus musculus
- Lysosome membrane protein 2 / Mus musculus
- Lysosome-associated membrane glycoprotein 5 / Mus musculus
- MAM domain-containing glycosylphosphatidylinositol anchor protein 1 / Mus musculus
- Membralin / Mus musculus
- Metal transporter CNNM4 / Mus musculus
- Multiple epidermal growth factor-like domains protein 8 / Mus musculus
- N-acetylglucosamine-1-phosphotransferase subunit gamma / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neural cell adhesion molecule L1-like protein / Mus musculus
- Neuroblastoma suppressor of tumorigenicity 1 / Mus musculus
- Neuroendocrine convertase 2 / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Neuroplastin / Mus musculus
- Nicastrin / Mus musculus
- Niemann-Pick C1 protein / Mus musculus
- Nodal modulator 1 / Mus musculus
- Noelin / Mus musculus
- Nuclear pore membrane glycoprotein 210 / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Osteopetrosis-associated transmembrane protein 1 / Mus musculus
- P2X purinoceptor 4 / Mus musculus
- P2X purinoceptor 7 / Mus musculus
- Phosphatidylcholine-sterol acyltransferase / Mus musculus
- Phospholipase D3 / Mus musculus
- Platelet glycoprotein 4 / Mus musculus
- Plexin-A2 / Mus musculus
- Plexin-A4 / Mus musculus
- Plexin-B1 / Mus musculus
- Plexin-B2 / Mus musculus
- Plexin-C1 / Mus musculus
- Prenylcysteine oxidase / Mus musculus
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Mus musculus
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Mus musculus
- Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
- Prosaposin / Mus musculus
- Prostaglandin g/h synthase 2 / Mus musculus
- Prostaglandin-H2 D-isomerase / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Protein FAM234B / Mus musculus
- Protein kinase C-binding protein NELL2 / Mus musculus
- Protein O-glucosyltransferase 1 / Mus musculus
- Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
- Protein OS-9 / Mus musculus
- Protein sel-1 homolog 1 / Mus musculus
- Protocadherin Fat 1 / Mus musculus
- Receptor-type tyrosine-protein phosphatase zeta / Mus musculus
- Reelin / Mus musculus
- Semaphorin-3E / Mus musculus
- Semaphorin-4D / Mus musculus
- Semaphorin-4F / Mus musculus
- Semaphorin-7A / Mus musculus
- Serotransferrin / Mus musculus
- Serpin H1 / Mus musculus
- Serum paraoxonase/arylesterase 2 / Mus musculus
- Sia-alpha-2,3-Gal-beta-1,4-GlcNAc-R:alpha 2,8-sialyltransferase / Mus musculus
- Sialic acid-binding Ig-like lectin / Mus musculus
- Sodium channel protein type 1 subunit alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium-dependent neutral amino acid transporter SLC6A17 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 5 / Mus musculus
- Sortilin / Mus musculus
- Sortilin-related receptor / Mus musculus
- SPARC / Mus musculus
- SPARC-like protein 1 / Mus musculus
- Synaptic vesicle glycoprotein 2A / Mus musculus
- T-cell immunomodulatory protein / Mus musculus
- Teneurin-2 / Mus musculus
- Testican-2 / Mus musculus
- Tetraspanin-3 / Mus musculus
- Thioredoxin domain-containing protein 15 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- TM2 domain-containing protein 3 / Mus musculus
- Torsin-1B / Mus musculus
- Translocon-associated protein subunit alpha / Mus musculus
- Translocon-associated protein subunit beta / Mus musculus
- Transmembrane and TPR repeat-containing protein 4 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Transmembrane protein 106B / Mus musculus
- Transmembrane protein 131 / Mus musculus
- Transmembrane protein 158 / Mus musculus
- Transmembrane protein 181a / Mus musculus
- Transmembrane protein 8B / Mus musculus
- Tripeptidyl-peptidase 1 / Mus musculus
- Tyrosine-protein kinase Mer / Mus musculus
- Ubiquitin-like modifier-activating enzyme ATG7 / Mus musculus
- UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 / Mus musculus
-
Uncharacterized protein / Mus musculus
- Undefined site
- V-type proton ATPase subunit S1 / Mus musculus
- Voltage-dependent calcium channel subunit alpha-2/delta-2 / Mus musculus
- VPS10 domain-containing receptor SorCS1 / Mus musculus
- Zinc transporter ZIP12 / Mus musculus
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Coagulation factor VIII / Sus scrofa
- Undefined site
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
- Undefined site
-
Ascorbate oxidase / Acremonium sp. HI-25
- Undefined site
-
Hemocyanin / Androctonus australis
- Undefined site
-
Uncharacterized protein / Actinidia chinensis
- Undefined site
-
Uncharacterized protein / Apium graveolens var. oulce
- Undefined site
-
Art v II / Artemisia vulgaris
- Undefined site
-
Uncharacterized protein / Daucus carota
- Undefined site
-
Uncharacterized protein / Lycopersicon esculentum
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
-
Uncharacterized protein / Solanum tuberosum
- Undefined site
-
Uncharacterized protein from Ovary / Asterias rubens
- Undefined site
-
Immunoglobulin gamma / Columba livia
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Gp273 / Unio elongatulus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Fagopyrum esculentum
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Alpha-galactosidase a / Aspergillus niger
- Undefined site
-
Alpha-glucosidase / Aspergillus niger
- Undefined site
-
Endopolygalacturonase II / Aspergillus niger
- Undefined site
-
Uncharacterized protein / Agaricus bisporus
- Undefined site
-
Uncharacterized protein / Aedes aegypti
- Undefined site
-
Arylphorin / Antheraea pernyi
- Undefined site
-
Uncharacterized protein from Hemolymph / Antheraea pernyi
- Undefined site
-
Apisin / Apis mellifera
- Undefined site
-
Hyaluronoglucosaminidase / Apis mellifera
- Undefined site
-
Uncharacterized protein from Royal Jelly / Apis mellifera
- Undefined site
-
Membrane glycoproteins / Bombyx mori
- Undefined site
-
Sex-specific storage-protein 2 / Bombyx mori
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Membrane glycoproteins / Mamestra brassicae
- Undefined site
-
Membrane glycoproteins / Spodoptera frugiperda
- Undefined site
-
Uncharacterized protein / Leptomonas Samueli
- Undefined site
-
Uncharacterized protein / Trypanosoma brucei brucei
- Undefined site
- Variant surface glycoprotein mitat 1.6 / Trypanosoma brucei brucei
-
Variant surface glycoprotein mitat 1.4a / Trypansoma brucei
- Undefined site
-
Uncharacterized protein / Persea americana
- Undefined site
-
Cobra venom factor / Naja kaouthia
- Undefined site
-
Uncharacterized protein / Allium cepa
- Undefined site
-
Uncharacterized protein / Asparagus officinalis
- Undefined site
-
Uncharacterized protein / Musa acuminata
- Undefined site
-
Alpha-amylase / Oryza sativa
- Undefined site
-
Vitellogenin / Cherax quadricarinatus
- Undefined site
-
Hemocyanin / Pontastacus leptodactylus
- Undefined site
-
Envelope glycoprotein / Friend mink cell focus-forming virus
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus
- Undefined site
-
Gp55 / Friend spleen focus-forming virus (anemia inducing strain)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm1.2.3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3 mutant)
- Undefined site
-
Env polyprotein (primary product, gp55) / Friend spleen focus-forming virus (gm3.4 mutant)
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (bh8 isolate)
- Undefined site
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Uncharacterized protein / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein / Arabidopsis thaliana
- Undefined site
-
Uncharacterized protein / Brassica oleracea var. botrytis
- Undefined site
-
Xyloglucan endotransglycosylase hydrolase / Brassica oleracea var. botrytis
- Undefined site
-
Alpha-mannosidase / Canavalia ensiformis
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Carica papaya
- Undefined site
-
Uncharacterized protein / Citrus sinensis
- Undefined site
-
Uncharacterized protein / Corylus avellana
- Undefined site
-
Uncharacterized protein / Fragaria x ananassa
- Undefined site
-
Lectin / Glycine max
- Undefined site
-
Uncharacterized protein / Glycine max
- Undefined site
-
Uncharacterized protein / Juglans regia
- Undefined site
-
Uncharacterized protein / Malus domestica var. golden delicious
- Undefined site
-
Uncharacterized protein / Phaseolus lunatus
- Undefined site
-
Alpha-amylase inhibitor, chain 1 / Phaseolus vulgaris
- Undefined site
-
Alpha-amylase inhibitor, chain 2 / Phaseolus vulgaris
- Undefined site
- Phaseolin, alpha-type / Phaseolus vulgaris
- Phaseolin, beta-type / Phaseolus vulgaris
-
Uncharacterized protein / Phaseolus vulgaris
- Undefined site
-
Uncharacterized protein / Pistacia vera
- Undefined site
-
Uncharacterized protein / Pisum sativum
- Undefined site
-
Uncharacterized protein / Prunus dulcis var. sativa
- Undefined site
-
Uncharacterized protein / Pyrus communis var. williams
- Undefined site
-
Uncharacterized protein / Ricinus communis
- Undefined site
-
Uncharacterized protein / Vigna radiata var. radiata
- Undefined site
-
Invertase / Saccharomyces cerevisiae
- Undefined site
-
Invertase 2 / Saccharomyces cerevisiae
- Undefined site
-
Invertase [secreted form] / Saccharomyces cerevisiae
- Undefined site
-
Uncharacterized protein / Saccharomyces cerevisiae
- Undefined site
-
Hemagglutinin / Influenza a virus (strain a/fowl plague virus/rostock/34)
- Undefined site
- Asn-424
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Uncharacterized protein / Schistosoma mansoni
- Undefined site
-
Hemoglobin extracellular / Riftia pachyptila
- Undefined site
Reported glycosite
- IWIPVNITWADIEDRDGR (18aa)
- HIVFWNSSNPK (11aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- LVPVPITNATLDR (13aa)
- LVPVPITNATLDQITGK (17aa)
- CIEKEVNK (8aa)
- NITQIVGHSGCEAK (14aa)
- VIEAVNGTDAR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- YCNASVTNSVK (11aa)
- ADVGGEAAGTAINHSHMLLQR (21aa)
- AELSNHTRPVILVPGCLGNR (20aa)
- VNFTIEASEGCYR (13aa)
- IYIPLNK (7aa)
- KIYIPLNK (8aa)
- KIYIPINK (8aa)
- GLFPAILNLATNAHISANATCGEK (24aa)
- IYIPINK (7aa)
- NNSDISSTR (9aa)
- FECHFFNGTER (11aa)
- P04229 Asn-48     HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- Q9TQE0 Asn-48     HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Q30167 Asn-48     HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- CGWCTNSTFLQEGMPTSAR (19aa)
- SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
- EIFVANGTQGK (11aa)
- WYSAGLASNSSWFR (14aa)
- SGLAPNPTNATTK (13aa)
- SETTTGTSSNSSQSTSNSGLAPNPTNATTK (30aa)
- DVNCSVMGPQEK (12aa)
- TGFYGENCSTPEFLTR (16aa)
- ELLQEFIDDNATTNAIDELK (20aa)