Hex:4 HexNAc:4

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Rana palustris
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)

Protein

• Afamin / Homo sapiens    P43652
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-fetoprotein / Homo sapiens    P02771
• Apolipoprotein b-100 / Homo sapiens    P04114
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Bile-salt-activated lipase / Homo sapiens    P19835
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Decorin / Homo sapiens    P07585
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Erythropoietin / Homo sapiens    P01588
• Fibronectin / Homo sapiens    P02751
• Forkhead box protein O3 / Homo sapiens    O43524
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• IgG-IL2 fusion protein / Homo sapiens    P60568
• Immunoglobulin alpha (secretory) / Homo sapiens    P01876    P01877
• Immunoglobulin gamma / Homo sapiens    P01857    P01860    P01859    P01861
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Insulin-like growth factor II / Homo sapiens    P01344
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interferon gamma / Homo sapiens    P01579
• Interleukin-6 receptor subunit beta / Homo sapiens    P40189
• Leucine-rich alpha-2-glycoprotein / Homo sapiens    P02750
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Mucin / Homo sapiens
• Periostin / Homo sapiens    Q15063
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Retinoid-inducible serine carboxypeptidase / Homo sapiens    Q9HB40
• Sciellin / Homo sapiens    O95171
• Serotransferrin / Homo sapiens    P02787
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens    Q9Y286
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens    Q9NYZ4
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Uncharacterized protein from Fluid / Homo sapiens
• Uncharacterized protein from Meconium / Homo sapiens
• Von willebrand factor / Homo sapiens    P04275
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Immunoglobulin gamma / Bos taurus
• Lactotransferrin / Bos taurus    P24627
• Mucin / Bos taurus
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
• Arylsulfatase B / Mus musculus    P50429
• Immunoglobulin gamma / Mus musculus
• Immunoglobulin gamma-2a heavy chain / Mus musculus
• Laminin subunit gamma-1 / Mus musculus    P02468
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Transmembrane emp24 domain-containing protein 9 / Mus musculus    Q99KF1
• Vesicular integral-membrane protein VIP36 / Mus musculus    Q9DBH5
• Immunoglobulin gamma / Oryctolagus cuniculus
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Mucin / Rana palustris
• Immunoglobulin y / Coturnix coturnix japonica
• Avidin / Gallus gallus    P02701
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus
• Acetylcholine receptor protein / Torpedo californica    P02718    P02712    P02714    P02710

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Electric Organ (UBERON_0006869)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21A (CVCL_RQ70)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Ovary (UBERON_0000992)   CHO-K1 (CVCL_0214)  
• Ovary (UBERON_0000992)   IM4 (CVCL_VT63)  
• Ovary (UBERON_0000992)   IM4/Vm (CVCL_VT66)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Pulmonary Mucosa  
• Spleen (UBERON_0002106)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• J558L (CVCL_3949)  
• P3X63Ag8U.1 (CVCL_3412)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Egg Cell  
• Egg Cell   Egg White  
• Egg Cell   Jelly Coat  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Leukocyte (CL_0000738)  
• Cerebrospinal Fluid Secretion (GO_0033326)  
• Low-Density Lipoprotein Particle (GO_0034362)  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• N-Linked / Complex / Structure 2011
• O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GalNAc
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-6)[GlcNAc(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"

Composition

• Hex:4 HexNAc:4 (avg mass : 1479.3649 )

Disease

• Arthritis (DOID:848)
• Arthritis, Rheumatoid (DOID:7148)
• Bronchiectasis, due to Kartagener's Syndrome
• Cancer, breast (DOID:1612)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Gangliosidosis GM1 (DOID:3322)
• Gaucher Disease (DOID:1926)
• Heavy Chain Disease (DOID:0060125)
• Hypercholesterolemia, Familial (DOID:13810)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Ovarian cyst (DOID:5119)
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)

Reference

• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
• Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
• Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
• The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography. (1996 - McGuire J, Douglas M, Smith K) / Status : Reviewed
• Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
• Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
• Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Interaction of bovine erythrocyte N-glycolylneuraminic acid-containing gangliosides and glycoproteins with a human Hanganutziu-Deicher serum. (1986 - Nowak JA, Jain NK, Stinson MW, Merrick JM) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Compositional and structural heterogeneity of avidin glycopeptides. (1982 - Bruch RC, White HB) / Status : Reviewed
• Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

• Afamin / Homo sapiens
  •        Asn-402
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-70
• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Apolipoprotein b-100 / Homo sapiens
  •        Undefined site
  •        Asn-3411
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Bile-salt-activated lipase / Homo sapiens
  •        Undefined site
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Cartilage intermediate layer protein 1 / Homo sapiens
  •        Asn-631
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
  •        Asn-2679
• Decorin / Homo sapiens
  •        Asn-211
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Erythropoietin / Homo sapiens
  •        Asn-51
• Fibronectin / Homo sapiens
  •        Asn-542
  •        Asn-1236
• Forkhead box protein O3 / Homo sapiens
  •        Asn-431
• Haptoglobin / Homo sapiens
  •        Asn-184
• Hemopexin / Homo sapiens
  •        Asn-64
  •        Asn-453
• IgG-IL2 fusion protein / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha (secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[fa234] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Insulin-like growth factor II / Homo sapiens
  •        Thr-99
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interleukin-6 receptor subunit beta / Homo sapiens
  •        Asn-390
• Leucine-rich alpha-2-glycoprotein / Homo sapiens
  •        Asn-186
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
• Mucin / Homo sapiens
  •        Undefined site
• Periostin / Homo sapiens
  •        Asn-599
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Retinoid-inducible serine carboxypeptidase / Homo sapiens
  •        Asn-126
• Sciellin / Homo sapiens
  •        Asn-562
• Serotransferrin / Homo sapiens
  •        Asn-432
  •        Asn-630
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 7 / Homo sapiens
  •        Undefined site
• Sialic acid-binding Ig-like lectin 8 / Homo sapiens
  •        Undefined site
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-1069
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-104
• Uncharacterized protein from Fluid / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Lactotransferrin / Bos taurus
  •        Asn-495
• Mucin / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• Arylsulfatase B / Mus musculus
  •        Asn-292
• Immunoglobulin gamma / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-2a heavy chain / Mus musculus
  •        Undefined site
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1203
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-153
• Transmembrane emp24 domain-containing protein 9 / Mus musculus
  •        Asn-125
• Vesicular integral-membrane protein VIP36 / Mus musculus
  •        Asn-185
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Mucin / Rana palustris
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Avidin / Gallus gallus
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32
• SERDVSTPPTVLPDNFPR (18aa)
  •    P01344    Thr-99
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104
• SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
  •    P04844    Asn-106
• FTFTSHTPGEHQICLHSNSTK (21aa)
  •    Q99KF1    Asn-125
• SLLFVDNPVGTGFSYVNGSGAYAK (24aa)
  •    Q9HB40    Asn-126
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• NVTYGTYIDDPDPDDGFNYK (20aa)
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• RACQFNR (7aa)
  •    P14231    Asn-153
• ACQFNR (6aa)
  •    P14231    Asn-153
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• VFPYISVMVNNGSLSYDHSK (20aa)
  •    Q9DBH5    Asn-185
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• EEQYNSTFR (9aa)
  •    P01860    Asn-227
• SHGLWNNTVFIFSTDNGGQTR (21aa)
  •    P50429    Asn-292
• GSGLGSPTSSFNSTVFGPSSLNSLR (25aa)
  •    O43524    Asn-431
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• NGSSNTGAK (9aa)
  •    O95171    Asn-562
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• NISTATAAQTDLNFINDEGDTFPLR (25aa)
  •    O75339    Asn-631
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VVNSTTGTGEHIR (13aa)
  •    P35442    Asn-1069
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• TANETSAEAYNLLLR (15aa)
  •    P02468    Asn-1203
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411