taxonomy (13)
protein (106)
source (61)
structure (39)
composition (1)
disease (27)
reference (87)
site (136)
peptide (65)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Rana palustris
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Drosophila melanogaster (Fruit fly)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Afamin / Homo sapiens P43652
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-fetoprotein / Homo sapiens P02771
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein B-100 / Homo sapiens P04114
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Bile-salt-activated lipase / Homo sapiens P19835
- Calumenin / Homo sapiens O43852
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Decorin / Homo sapiens P07585
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Erythropoietin / Homo sapiens P01588
- Fibronectin / Homo sapiens P02751
- Forkhead box protein O3 / Homo sapiens O43524
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- IgG-IL2 fusion protein / Homo sapiens P60568
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01857 P01860
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens P01860
- Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Insulin-like growth factor II / Homo sapiens P01344
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Interferon gamma / Homo sapiens P01579
- Interleukin-6 receptor subunit beta / Homo sapiens P40189
- Lactotransferrin / Homo sapiens P02788
- Leucine-rich alpha-2-glycoprotein / Homo sapiens P02750
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Retinoid-inducible serine carboxypeptidase / Homo sapiens Q9HB40
- Sciellin / Homo sapiens O95171
- Serotransferrin / Homo sapiens P02787
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Sialic acid-binding Ig-like lectin 7 / Homo sapiens Q9Y286
- Sialic acid-binding Ig-like lectin 8 / Homo sapiens Q9NYZ4
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Uncharacterized protein from Meconium / Homo sapiens
- Uncharacterized protein from Ovary / Homo sapiens
- Unspecified mucin / Homo sapiens
- Von willebrand factor / Homo sapiens P04275
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Immunoglobulin gamma / Bos taurus
- Lactotransferrin / Bos taurus P24627
- Mucin / Bos taurus
- Thyrotropin-aplha and beta chains / Bos taurus P01223 P01217
- Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Arylsulfatase B / Mus musculus P50429
- Immunoglobulin gamma / Mus musculus
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Laminin subunit gamma-1 / Mus musculus P02468
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Transmembrane emp24 domain-containing protein 9 / Mus musculus Q99KF1
- Vesicular integral-membrane protein VIP36 / Mus musculus Q9DBH5
- Immunoglobulin gamma / Oryctolagus cuniculus
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Mucin / Rana palustris
- Immunoglobulin y / Coturnix coturnix japonica
- Avidin / Gallus gallus P02701
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Acetylcholine receptor protein / Torpedo californica P02710 P02714 P02718 P02712
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Embryo (UBERON_0000922)
- Frontal Cortex (UBERON_0001870)
- Glomerular Basement Membrane (UBERON_0005777)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) BHK-21A (CVCL_RQ70)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Prefrontal Cortex (UBERON:0000451)
- Pulmonary Mucosa
- Seminal Fluid (UBERON_0006530)
- Spleen (UBERON_0002106)
- Striatum (UBERON_0002345)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- BT-474 (CVCL_0179)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- CHO (CVCL_0213)
- CHO-S (CVCL_7183)
- Detroit 551 (CVCL_2434)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HT-1080 (CVCL_0317)
- J558L (CVCL_3949)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- MCF-7 (CVCL_0031)
- P3X63Ag8U.1 (CVCL_3412)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
- SK-BR-3 (CVCL_0033)
- T84 (CVCL_0555)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Egg Cell
- Egg Cell Egg White
- Egg Cell Jelly Coat
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Leukocyte (CL_0000738)
- Low-Density Lipoprotein Particle (GO_0034362)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-6)[GlcNAc(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9500
- N-Linked / Complex / Structure 9553
- N-Linked / Complex / Structure 9854
- N-Linked / Complex / Structure 10474
- N-Linked / Complex / Structure 10506
- N-Linked / Complex / Structure 10889
- N-Linked / Complex / Structure 10964
- N-Linked / Complex / Structure 11248
- N-Linked / Complex / Structure 11495
- N-Linked / Complex / Structure 11823
- N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9560
- N-Linked / Hybrid / Structure 9634
- N-Linked / Hybrid / Structure 9753
- N-Linked / Hybrid / Structure 10512
- N-Linked / Hybrid / Structure 11692
- N-Linked / Undefined core / Hex(??-?)HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 11093
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GalNAc
Reported structure
- Hex:4 HexNAc:4 (avg mass : 1479.3649 )
Composition
- Alzheimer's disease (DOID:10652)
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Asymptomatic myositis (DOID:633)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Gangliosidosis GM1 (DOID:3322)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Heavy Chain Disease (DOID:0060125)
- Hypercholesterolemia, Familial (DOID:13810)
- Hypersensitivity reaction disease (DOID:0060056)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
- Oral squamous cell carcinoma (DOID:0050866)
- Ovarian cyst (DOID:5119)
- Plasmacytoma (Mouse) (DOID:3721)
- Prostate cancer (DOID:10283)
- Schizophrenia (DOID:5419)
- Sjogren's Syndrome (DOID:12894)
- Systemic lupus erythematosus (DOID:9074)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- Malignant tissues produce divergent antibody glycosylation of relevance for cancer gene therapy effectiveness. (2020 - Brücher D, Franc V, Smith SN, Heck AJR, Plückthun A) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Site-specific glycoprofiling of N-linked glycopeptides using MALDI-TOF MS: strong correlation between signal strength and glycoform quantities. (2009 - Thaysen-Andersen M, Mysling S, Højrup P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography. (1996 - McGuire J, Douglas M, Smith K) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Interaction of bovine erythrocyte N-glycolylneuraminic acid-containing gangliosides and glycoproteins with a human Hanganutziu-Deicher serum. (1986 - Nowak JA, Jain NK, Stinson MW, Merrick JM) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Compositional and structural heterogeneity of avidin glycopeptides. (1982 - Bruch RC, White HB) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
Reference
- Afamin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein B-100 / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
- Calumenin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cartilage intermediate layer protein 1 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Decorin / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Erythropoietin / Homo sapiens
- Fibronectin / Homo sapiens
- Forkhead box protein O3 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
- Asn-131
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Asn-316
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Immunoglobulin J chain / Homo sapiens
- Insulin-like growth factor II / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
Interferon gamma / Homo sapiens
- Undefined site
- Interleukin-6 receptor subunit beta / Homo sapiens
- Lactotransferrin / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
- Retinoid-inducible serine carboxypeptidase / Homo sapiens
- Sciellin / Homo sapiens
- Serotransferrin / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
- Lactotransferrin / Bos taurus
-
Mucin / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- Arylsulfatase B / Mus musculus
-
Immunoglobulin gamma / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Laminin subunit gamma-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Vesicular integral-membrane protein VIP36 / Mus musculus
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Mucin / Rana palustris
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Avidin / Gallus gallus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Asn-293
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- LELNLTDSENATCLYAK (17aa)
- FSNVTWF (7aa)
- NKSVLLGR (8aa)
- NK (2aa)
- RENISDPTSPLRT (13aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SERDVSTPPTVLPDNFPR (18aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- SLLFVDNPVGTGFSYVNGSGAYAK (24aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- PREEQFNSTYR (11aa)
- EEQFNSTYR (9aa)
- TKPREEQFNSTYR (13aa)
- REEQYNSTYRV (11aa)
- EEQYNSTYR (9aa)
- KTKPREEQYNSTYRV (15aa)
- TKPREEQYNSTYR (13aa)
- EEQYNSTY (8aa)
- EEQYNSTYR (10aa)
- VFPYISVMVNNGSLSYDHSK (20aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- KNLFLNHSENATAKD (15aa)
- EEQYNSTFR (9aa)
- EEQFNSTFR (9aa)
- FLLKYNENGTIT (12aa)
- SHGLWNNTVFIFSTDNGGQTR (21aa)
- YNLT (4aa)
- RFPNIT (6aa)
- GSGLGSPTSSFNSTVFGPSSLNSLR (25aa)
- VPGNVTAVIGETIK (14aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- RHEEGHMINCTCFGQGR (17aa)
- NGSSNTGAK (9aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NISTATAAQTDLNFINDEGDTFPLR (25aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGTGEHIR (13aa)
- VPAQEKNF (8aa)
- EGVFVSNGTHWFVTQRNFYEPQIITT (26aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- KYFKNHTS (8aa)
- TANETSAEAYNLLLR (15aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- RFNSSYLQGTNQITGRY (17aa)
- NLQVYNATSNSLTVK (15aa)
- MIEAYNITEK (10aa)
- EAGNITTDGYEIIGK (15aa)
- FVEGSHNSTVSLTTK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Metabolic shifts do not influence the glycosylation patterns of a recombinant fusion protein expressed in BHK cells. (2000 - Cruz H, Peixoto C, Nimtz M, Alves P, Dias E, Moreira J, Carrondo M) / Status : Reviewed
- Erythropoietin / Homo sapiens
-
IgG-IL2 fusion protein / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Glomerular Basement Membrane (UBERON_0005777)
- Liver (UBERON_0002107)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Spleen (UBERON_0002106)
- Urine (UBERON_0001088)
- J558L (CVCL_3949)
- P3X63Ag8U.1 (CVCL_3412)
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- Gangliosidosis GM1 (DOID:3322)
- Gaucher Disease (DOID:1926)
- Heavy Chain Disease (DOID:0060125)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Schizophrenia (DOID:5419)
- Sjogren's Syndrome (DOID:12894)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- The resolution of the neutral N-linked oligosaccharides of IgG by high pH anion-exchange chromatography. (1996 - McGuire J, Douglas M, Smith K) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Structures of the oligosaccharides present at the three asparagine-linked glycosylation sites of human IgD. (1983 - S J Mellis, J U Baenziger) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant delta / Homo sapiens
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Cerebrospinal Fluid (UBERON_0001359)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- HEK293 (CVCL_0045)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Hypersensitivity reaction disease (DOID:0060056)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- Enrichment of glycopeptides for glycan structure and attachment site identification (2009 - Nilsson J, Rüetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G.) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Afamin / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Beta-2-glycoprotein 1 / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Leucine-rich alpha-2-glycoprotein / Homo sapiens
- Serotransferrin / Homo sapiens
- EEQYNSTYR (9aa)
- EEQYNSTYR (10aa)
- EEQFNSTFR (9aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 7 / Homo sapiens
- Undefined site
-
Sialic acid-binding Ig-like lectin 8 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Cerebrospinal Fluid (UBERON_0001359)
- Electric Organ (UBERON_0006869)
- Glomerular Basement Membrane (UBERON_0005777)
- Liver (UBERON_0002107)
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Pancreas (UBERON_0001264)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- HEK293 (CVCL_0045)
- J558L (CVCL_3949)
- P3X63Ag8U.1 (CVCL_3412)
- Yolk (GO_0060417)
- Alzheimer's disease (DOID:10652)
- Arthritis (DOID:848)
- Arthritis, Rheumatoid (DOID:7148)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gangliosidosis GM1 (DOID:3322)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Plasmacytoma (Mouse) (DOID:3721)
- Schizophrenia (DOID:5419)
- Sjogren's Syndrome (DOID:12894)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Multiple interactions of IgG with its core oligosaccharide can modulate recognition by complement and human Fc gamma recpetor I and influence the synthesis of its oligosaccharide chains (1996 - Lund, Takahashi, Pound, Goodall, Jefferis) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Structural changes in the N-linked sugar chains of serum immunoglobulin G of HTLV-I transgenic mice. (1993 - Endo T, Iwakura Y, Kobata A) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Control of IgG/Fc glycosylation: a comparison of oligosaccharides from chimeric human/mouse and mouse subclass immunoglobulin Gs. (1993 - Lund J, Takahashi N, Nakagawa H, Goodall M, Bentley T, Hindley S, Tyler R, Jefferis R) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[ya296] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
-
Prosaposin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Immunoglobulin gamma-1 (c23 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (h2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-1 (v2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p20-2 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2 (p5-1 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-2b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma-3b (anti-nip antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Immunoglobulin gamma / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Ovary (UBERON_0000992) CHO-K1 (CVCL_0214)
- Ovary (UBERON_0000992) IM4 (CVCL_VT63)
- Ovary (UBERON_0000992) IM4/Vm (CVCL_VT66)
- Ovary (UBERON_0000992)
- Microsome (GO_0005792)
- Sialylation of human IgG-Fc carbohydrate by transfected rat alpha2,6-sialyltransferase (2001 - Jassal, Jenkins, Charlwood, Camilleri, Jefferis, Lund) / Status : Reviewed
- Remodeling of sugar chain structures of human interferon-gamma. (2000 - Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
-
Immunoglobulin gamma-3 (anti-nip antibody) / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-3-[fa243] (anti-nip antibody) / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Milk (UBERON_0001913)
- Apolipoprotein B-100 / Homo sapiens
- Haptoglobin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- RENISDPTSPLRT (13aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- REEQYNSTYRV (11aa)
- KTKPREEQYNSTYRV (15aa)
- KNLFLNHSENATAKD (15aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- RFNSSYLQGTNQITGRY (17aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Plasma (UBERON_0001969)
- Control/Healthy
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Seminal Fluid (UBERON_0006530)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- NKSVLLGR (8aa)
- TKPREEQYNSTYR (13aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 1479.3649)
- BT-474 (CVCL_0179)
- CHO (CVCL_0213)
- CHO-S (CVCL_7183)
- Detroit 551 (CVCL_2434)
- HEK293 (CVCL_0045)
- HT-1080 (CVCL_0317)
- MCF-7 (CVCL_0031)
- SK-BR-3 (CVCL_0033)
- PREEQFNSTYR (11aa)
- EEQFNSTYR (9aa)
- TKPREEQFNSTYR (13aa)
-
- N-Linked / Complex
(avg mass : 1479.3649)
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Adipocytes (CL_0000136)
- Egg Cell Egg White
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Compositional and structural heterogeneity of avidin glycopeptides. (1982 - Bruch RC, White HB) / Status : Reviewed
-
Avidin / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Egg Cell
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Prefrontal Cortex (UBERON:0000451)
- LS174T (CVCL_1384)
- Egg Cell Egg White
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Neutral N-glycans in adult rat brain tissue--complete characterisation reveals fucosylated hybrid and complex structures (1998 - Chen YJ, Wing DR, Guile GR, Dwek RA, Harvey DJ, Zamze S) / Status : Reviewed
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1479.3649)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
-
- N-Linked / Undefined core
(avg mass : 1479.3649)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
-
- O-Linked / Core 1
(avg mass : 1479.3649)
- Egg Cell Jelly Coat
-
Mucin / Rana palustris
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1479.3649)
- Zona Pellucida (UBERON_0000086)
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1479.3649)
- Ovarian cyst (DOID:5119)
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1479.3649)
- Milk (UBERON_0001913)
- Pulmonary Mucosa
- Isolation and structural characterization of novel neutral oligosaccharide-alditols from respitatory-mucus glycoproteins of a patient suffering from bronchiectasis. 2. Structure of twelve hepta-to-nonasaccharide, six of which possess the GlcNAc beta(1----3)[Gal beta(1----4)GlcNAc beta(1----6)]Gal be (1991 - van Kuik J, de Waard P, Vliegenthart J, Klein A, Carnoy C, Lamblin G, Roussel P) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1479.3649)
- Leukocyte (CL_0000738)
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1479.3649)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- T84 (CVCL_0555)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Undefined core
(avg mass : 1479.3649)
-
Mucin / Bos taurus
- Undefined site
-
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-6)[GlcNAc(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9500
- N-Linked / Complex / Structure 9553
- N-Linked / Complex / Structure 9854
- N-Linked / Complex / Structure 10474
- N-Linked / Complex / Structure 10506
- N-Linked / Complex / Structure 10889
- N-Linked / Complex / Structure 10964
- N-Linked / Complex / Structure 11248
- N-Linked / Complex / Structure 11495
- N-Linked / Complex / Structure 11823
- N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9560
- N-Linked / Hybrid / Structure 9634
- N-Linked / Hybrid / Structure 9753
- N-Linked / Hybrid / Structure 10512
- N-Linked / Hybrid / Structure 11692
- N-Linked / Undefined core / Hex(??-?)HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- Ovalbumin / Gallus gallus
- YNLT (4aa)
-
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 2011
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-6)[GlcNAc(?1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-4)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[GlcNAc(b1-?)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9500
- N-Linked / Complex / Structure 9553
- N-Linked / Complex / Structure 9854
- N-Linked / Complex / Structure 10474
- N-Linked / Complex / Structure 10506
- N-Linked / Complex / Structure 10889
- N-Linked / Complex / Structure 10964
- N-Linked / Complex / Structure 11248
- N-Linked / Complex / Structure 11495
- N-Linked / Complex / Structure 11823
- N-Linked / Hybrid / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)][Man(a1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / GlcNAc(b1-2)Man(a1-3)[Man(a1-3)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9560
- N-Linked / Hybrid / Structure 9634
- N-Linked / Hybrid / Structure 9753
- N-Linked / Hybrid / Structure 10512
- N-Linked / Hybrid / Structure 11692
- N-Linked / Undefined core / Hex(??-?)HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)]Hex(??-?)HexNAc(??-?)HexNAc
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Apolipoprotein B-100 / Homo sapiens
- Calumenin / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Decorin / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Fibronectin / Homo sapiens
- Forkhead box protein O3 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Interleukin-6 receptor subunit beta / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Retinoid-inducible serine carboxypeptidase / Homo sapiens
- Sciellin / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Lactotransferrin / Bos taurus
- Arylsulfatase B / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Transmembrane emp24 domain-containing protein 9 / Mus musculus
- Vesicular integral-membrane protein VIP36 / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- LELNLTDSENATCLYAK (17aa)
- FSNVTWF (7aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- FTFTSHTPGEHQICLHSNSTK (21aa)
- SLLFVDNPVGTGFSYVNGSGAYAK (24aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- EEQYNSTYR (9aa)
- EEQYNSTY (8aa)
- VFPYISVMVNNGSLSYDHSK (20aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- EEQYNSTFR (9aa)
- EEQFNSTFR (9aa)
- FLLKYNENGTIT (12aa)
- SHGLWNNTVFIFSTDNGGQTR (21aa)
- RFPNIT (6aa)
- GSGLGSPTSSFNSTVFGPSSLNSLR (25aa)
- VPGNVTAVIGETIK (14aa)
- RHEEGHMINCTCFGQGR (17aa)
- NGSSNTGAK (9aa)
- EVNDTLLVNELK (12aa)
- LYQDVNCT (8aa)
- NISTATAAQTDLNFINDEGDTFPLR (25aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- VVNSTTGPGEHIR (13aa)
- VVNSTTGTGEHIR (13aa)
- VPAQEKNF (8aa)
- EGVFVSNGTHWFVTQRNFYEPQIITT (26aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- KYFKNHTS (8aa)
- TANETSAEAYNLLLR (15aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- NLQVYNATSNSLTVK (15aa)
- MIEAYNITEK (10aa)
- EAGNITTDGYEIIGK (15aa)
- FVEGSHNSTVSLTTK (15aa)
-
- Hex:4 HexNAc:4 / O-Linked
(avg mass : 1479.3649)
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 11093
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GalNAc
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Suggested structure
Disease
Reference
- Hex:4 HexNAc:4 / O-Linked
(avg mass : 1479.3649)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
Suggested structure
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 / N-Linked
(avg mass : 1479.3649)
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1479.3649)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1479.3649)
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1479.3649)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1479.3649)
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1479.3649)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1479.3649)