taxonomy (3)
protein (26)
source (10)
structure (4)
composition (1)
disease (4)
reference (11)
site (28)
peptide (23)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-S1-casein / Homo sapiens P47710
- Cathepsin Z / Homo sapiens Q9UBR2
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Fibrinogen beta chain / Homo sapiens P02675
- Fibronectin / Homo sapiens P02751
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- GDNF family receptor alpha-1 / Homo sapiens P56159
- Glycodelin-a / Homo sapiens P09466
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Histone deacetylase complex subunit sap30 / Homo sapiens O75446
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Lutropin beta chain / Homo sapiens P01229
- Melanoma-associated antigen 2 / Homo sapiens P43356
- Periostin / Homo sapiens Q15063
- Prolactin-inducible protein / Homo sapiens P12273
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Ribonuclease T2 / Homo sapiens O00584
- Sodium channel protein type 8 subunit alpha / Homo sapiens Q9UQD0
- SUN domain-containing protein 2 / Homo sapiens Q9UH99
- Immunoglobulin superfamily member 8 / Mus musculus Q8R366
- Myelin-oligodendrocyte glycoprotein / Mus musculus Q61885
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Pituitary Gland (UBERON_0000007)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
Source
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9527
- N-Linked / Complex / Structure 9739
Reported structure
- Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )
Composition
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
Disease
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
- Cathepsin Z / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Glycodelin-a / Homo sapiens
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Histone deacetylase complex subunit sap30 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Lutropin beta chain / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Periostin / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Ribonuclease T2 / Homo sapiens
- Sodium channel protein type 8 subunit alpha / Homo sapiens
- SUN domain-containing protein 2 / Homo sapiens
- Immunoglobulin superfamily member 8 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- ISPGKNATGMEVGWYR (16aa)
- ETNFSIASGIEAK (13aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NK (2aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- NYTLWR (6aa)
- TFYWDFYTNR (10aa)
- AYWPDVIHSFPNR (13aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ALIYQFSPIYTGNISSFQQCYIFD (24aa)
- ALIYQFSPIYTGNISSF (17aa)
- IGPGEPLELLCNVSGALPPPGR (22aa)
- LIDNNK (6aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- GTAGNAIMDGASQIMGENR (19aa)
- DQCIVDDITYNVNDTFHK (18aa)
- KFSIMNQSLLSIP (13aa)
- EVNDTLLVNELK (12aa)
- AISPNSTISSAPK (13aa)
- EAGNITTDGYEIIGK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1608.4804)
- Pituitary Gland (UBERON_0000007)
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Lutropin beta chain / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1608.4804)
- Amniotic Fluid (UBERON_0000173)
- Glycodelin-a / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1608.4804)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
-
- N-Linked / Complex
(avg mass : 1608.4804)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- Hex:3 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1608.4804)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9527
- N-Linked / Complex / Structure 9739
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Cathepsin Z / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- GDNF family receptor alpha-1 / Homo sapiens
- Histone deacetylase complex subunit sap30 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Melanoma-associated antigen 2 / Homo sapiens
- Periostin / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Ribonuclease T2 / Homo sapiens
- Sodium channel protein type 8 subunit alpha / Homo sapiens
- SUN domain-containing protein 2 / Homo sapiens
- Immunoglobulin superfamily member 8 / Mus musculus
- Myelin-oligodendrocyte glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- ISPGKNATGMEVGWYR (16aa)
- ETNFSIASGIEAK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NK (2aa)
- NKSVLLGR (8aa)
- FHAIHVSGTNGTKRF (15aa)
- NYTLWR (6aa)
- TFYWDFYTNR (10aa)
- AYWPDVIHSFPNR (13aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ALIYQFSPIYTGNISSFQQCYIFD (24aa)
- ALIYQFSPIYTGNISSF (17aa)
- IGPGEPLELLCNVSGALPPPGR (22aa)
- LIDNNK (6aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- GTAGNAIMDGASQIMGENR (19aa)
- DQCIVDDITYNVNDTFHK (18aa)
- KFSIMNQSLLSIP (13aa)
- EVNDTLLVNELK (12aa)
- AISPNSTISSAPK (13aa)
- EAGNITTDGYEIIGK (15aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1608.4804)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1608.4804)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1608.4804)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1608.4804)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1608.4804)