Hex:3 HexNAc:4 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-S1-casein / Homo sapiens    P47710
• Cathepsin Z / Homo sapiens    Q9UBR2
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Fibrinogen beta chain / Homo sapiens    P02675
• Fibronectin / Homo sapiens    P02751
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• GDNF family receptor alpha-1 / Homo sapiens    P56159
• Glycodelin-a / Homo sapiens    P09466
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Histone deacetylase complex subunit sap30 / Homo sapiens    O75446
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Lutropin beta chain / Homo sapiens    P01229
• Melanoma-associated antigen 2 / Homo sapiens    P43356
• Periostin / Homo sapiens    Q15063
• Prolactin-inducible protein / Homo sapiens    P12273
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Ribonuclease T2 / Homo sapiens    O00584
• Sodium channel protein type 8 subunit alpha / Homo sapiens    Q9UQD0
• SUN domain-containing protein 2 / Homo sapiens    Q9UH99
• Immunoglobulin superfamily member 8 / Mus musculus    Q8R366
• Myelin-oligodendrocyte glycoprotein / Mus musculus    Q61885
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Pituitary Gland (UBERON_0000007)  
• Seminal Fluid (UBERON_0006530)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• FreeStyle 293-F (CVCL_D603)  

Reported structure

• N-Linked / Complex / Structure 838
• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9527
• N-Linked / Complex / Structure 9739

Composition

• Hex:3 HexNAc:4 NeuAc:1 (avg mass : 1608.4804 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• NMR investigations of the N-linked oligosaccharides at individual glycosylation sites of human lutropin. (1991 - Weisshaar G, Hiyama J, Renwick A, Nimtz M) / Status : Reviewed

Reported glycosite

• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Cathepsin Z / Homo sapiens
  •        Asn-184
• Clusterin / Homo sapiens
  •        Asn-354
  •        Asn-374
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2679
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-276
• Fibrinogen beta chain / Homo sapiens
  •        Asn-394
• Fibronectin / Homo sapiens
  •        Asn-528
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-307
• GDNF family receptor alpha-1 / Homo sapiens
  •        Asn-59
• Glycodelin-a / Homo sapiens
  •        Asn-46
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Asn-76
  •        Asn-102
• Histone deacetylase complex subunit sap30 / Homo sapiens
  •        Asn-34
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Lutropin beta chain / Homo sapiens
  •        Asn-50
• Melanoma-associated antigen 2 / Homo sapiens
  •        Asn-76
• Periostin / Homo sapiens
  •        Asn-599
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prosaposin / Homo sapiens
  •        Asn-332
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Ribonuclease T2 / Homo sapiens
  •        Asn-106
• Sodium channel protein type 8 subunit alpha / Homo sapiens
  •        Asn-544
• SUN domain-containing protein 2 / Homo sapiens
  •        Asn-636
• Immunoglobulin superfamily member 8 / Mus musculus
  •        Asn-325
• Myelin-oligodendrocyte glycoprotein / Mus musculus
  •        Asn-59
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-74

Mass spectrometry observed peptide

• ISPGKNATGMEVGWYR (16aa)
  •    Q61885    Asn-59     Myelin-oligodendrocyte glycoprotein / Mus musculus
• ETNFSIASGIEAK (13aa)
  •    P56159    Asn-59     GDNF family receptor alpha-1 / Homo sapiens
• KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NYTLWR (6aa)
  •    P43356    Asn-76     Melanoma-associated antigen 2 / Homo sapiens
  •    Q9UBR2    Asn-184     Cathepsin Z / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• AYWPDVIHSFPNR (13aa)
  •    O00584    Asn-106     Ribonuclease T2 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• ALIYQFSPIYTGNISSFQQCYIFD (24aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• ALIYQFSPIYTGNISSF (17aa)
  •    Q92820    Asn-307     Gamma-glutamyl hydrolase / Homo sapiens
• IGPGEPLELLCNVSGALPPPGR (22aa)
  •    Q8R366    Asn-325     Immunoglobulin superfamily member 8 / Mus musculus
• LIDNNK (6aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• GTAGNAIMDGASQIMGENR (19aa)
  •    P02675    Asn-394     Fibrinogen beta chain / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• KFSIMNQSLLSIP (13aa)
  •    Q9UQD0    Asn-544     Sodium channel protein type 8 subunit alpha / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• AISPNSTISSAPK (13aa)
  •    Q9UH99    Asn-636     SUN domain-containing protein 2 / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens