taxonomy (8)
protein (57)
source (24)
structure (22)
composition (1)
disease (6)
reference (25)
site (72)
peptide (60)
- Homo sapiens (Human)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Gallus gallus (Chicken)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Alpha-S1-casein / Homo sapiens P47710
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens Q9NYQ6
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens Q9HCU4
- Calumenin / Homo sapiens O43852
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- CD166 antigen / Homo sapiens Q13740
- CD59 glycoprotein / Homo sapiens P13987
- Ceruloplasmin / Homo sapiens P00450
- Chymotrypsin-like elastase family member 3B / Homo sapiens P08861
- Clusterin / Homo sapiens P10909
- Decorin / Homo sapiens P07585
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Ectopic P granules protein 5 homolog / Homo sapiens Q9HCE0
- Epidermal growth factor receptor / Homo sapiens P00533
- Erythropoietin / Homo sapiens P01588
- Fibrillin-1 / Homo sapiens P35555
- Fibroleukin / Homo sapiens Q14314
- Fibromodulin / Homo sapiens Q06828
- Fibronectin / Homo sapiens P02751
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens P98164
- Lumican / Homo sapiens P51884
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Mucin-5B / Homo sapiens Q9HC84
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prickle-like protein 2 / Homo sapiens Q7Z3G6
- Prolactin-inducible protein / Homo sapiens P12273
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens Q5H9R7
- Tigger transposable element-derived protein 6 / Homo sapiens Q17RP2
- Transcription factor 4 / Homo sapiens P15884
- Uromodulin / Homo sapiens P07911
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Major prion protein / Mesocricetus auratus P04273
- Tenascin-r / Mus musculus Q8BYI9
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries Q712V9
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries Q712V9
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Mucin / Sus scrofa
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Liver (UBERON_0002107)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- neocortex (UBERON:0001950)
- Pancreas (UBERON_0001264)
- Prefrontal Cortex (UBERON:0000451)
- Pulmonary Mucosa
- Seminal Fluid (UBERON_0006530)
- Striatum (UBERON_0002345)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- RPMI-1788 (CVCL_2710) B-Lymphocyte (CL_0000236)
Source
- N-Linked / Complex / Structure 270
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ Fuc"
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-2)Gal(b1-4) + Gal(b1-4)"
- N-Linked / Complex / Structure 9540
- N-Linked / Complex / Structure 9933
- N-Linked / Complex / Structure 10107
- N-Linked / Complex / Structure 10535
- N-Linked / Complex / Structure 11108
- N-Linked / Complex / Structure 11119
- N-Linked / Complex / Structure 11556
- N-Linked / Complex / Structure 11660
- N-Linked / Complex / Structure 11696
- N-Linked / Complex / Structure 11789
- O-Linked / Core 2 / Fuc(a1-2)[Gal(a1-3)]Gal(b1-4)GlcNAc(b1-3)[GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)]GalNAc
Reported structure
- Hex:5 HexNAc:5 dHex:2 (avg mass : 2136.9883 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma, Squamous cell (DOID:1749)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Scrapie (DOID:5434)
Disease
- Mammalian brain glycoproteins exhibit diminished glycan complexity compared to other tissues (2022 - Williams SE, Noel M, Lehoux S, Cetinbas M, Xavier RJ, Sadreyev RI, Scolnick EM, Smoller JW, Cummings RD, Mealer RG) / Status : Reviewed
- Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Post-natal developmental changes in the composition of the rat neocortical N-glycome (2021 - Klarić TS, Salopek M, Micek V, Gornik Kljaić O, Lauc G) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
- Structures of the oligosaccharide chains in swine trachea mucin glycoproteins. (1984 - Chandrasekaran EV, Rana SS, Davila M, Mendicino J) / Status : Reviewed
Reference
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Alpha-S1-casein / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
- Calumenin / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- CD166 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Chymotrypsin-like elastase family member 3B / Homo sapiens
- Clusterin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
- Erythropoietin / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Mucin-5B / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prickle-like protein 2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Transcription factor 4 / Homo sapiens
- Uromodulin / Homo sapiens
-
Von willebrand factor / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Mucin / Sus scrofa
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- TAVNCSSDFDACLITK (16aa)
- FVGTPEVNQTTIYQR (15aa)
- YETTNK (6aa)
- FSNVTWF (7aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- INISENYTISISNAR (15aa)
- IAVQFGPGFSWIANFTK (17aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- EHEGAIYPDNTTDFQR (16aa)
- IYIDHNNITR (10aa)
- NNQSLP (6aa)
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
- TPLTANITK (9aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- SGTNHYSTSSCTPPANGTDSIMANR (25aa)
- IIQVVYIHSNNITK (14aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- IHVGNYNGTAGDAIR (15aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GEVFNATR (8aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- LSLLEEPGNGTFTVILNQLTSR (22aa)
- NYTDCTSEGR (10aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- VPGNVTAVIGETIK (14aa)
- KVPGNVTAVLGETLKV (16aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- LALSNATGLSADGGAK (16aa)
- EVNDTLLVNELK (12aa)
- NNSYECDIPI (10aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- NGTHWFVT (8aa)
- CLCPLGFLLANDSK (14aa)
- NYYADNQTCDGELLFNMTK (19aa)
- GFDPDCNK (8aa)
- AFGQFFSPGEVIYNK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Blood Plasma (UBERON_0001969)
- Mammalian Vulva (UBERON_0000997) A-431 (CVCL_0037)
- Pancreas (UBERON_0001264)
- Carcinoma, Squamous cell (DOID:1749)
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
- Carbohydrate structure of human pancreatic elastase 1. (1991 - Wendorf P, Linder D, Sziegoleit A, Geyer R) / Status : Reviewed
- Chymotrypsin-like elastase family member 3B / Homo sapiens
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Carcinoma, Squamous cell (DOID:1749)
- Characterization of the carbohydrate chains of the secreted form of the human epidermal growth factor receptor. (2000 - Stroop C, Weber W, Gerwig G, Nimtz M, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Blood Plasma (UBERON_0001969)
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Blood Plasma (UBERON_0001969)
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Blood Plasma (UBERON_0001969)
-
Von willebrand factor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Brain (UBERON_0000955)
-
Tenascin-r / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Erythropoietin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Seminal Fluid (UBERON_0006530)
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Carcinoma, Squamous cell (DOID:1749)
-
Epidermal growth factor receptor / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KDTRNESTQNCVVAEPEKM (19aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- KVPGNVTAVLGETLKV (16aa)
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
-
- N-Linked / Complex
(avg mass : 2136.9883)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2136.9883)
-
- N-Linked / Complex
(avg mass : 2136.9883)
- neocortex (UBERON:0001950)
-
- N-Linked / Complex
(avg mass : 2136.9883)
- Cerebellum (UBERON_0002037)
- Frontal Cortex (UBERON_0001870)
- Hippocampul formation (UBERON:0002421)
- Striatum (UBERON_0002345)
-
- N-Linked / Complex
(avg mass : 2136.9883)
-
- O-Linked / Core 2
(avg mass : 2136.9883)
- Pulmonary Mucosa
-
Mucin / Sus scrofa
- Undefined site
-
- Hex:5 HexNAc:5 dHex:2 / N-Linked
(avg mass : 2136.9883)
- Ascitic fluid (UBERON_0007795)
- Blood Serum (UBERON_0001977)
- Colon (UBERON_0001155)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- LS174T (CVCL_1384)
- N-Linked / Complex / Structure 270
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Fuc(a1-3)[Gal(b1-4)]GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-3)[Gal(?1-?)GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ Fuc"
- N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[Fuc(a1-3)[GalNAc(b1-4)]GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Fuc(a1-2)Gal(b1-4) + Gal(b1-4)"
- N-Linked / Complex / Structure 9540
- N-Linked / Complex / Structure 9933
- N-Linked / Complex / Structure 10107
- N-Linked / Complex / Structure 10535
- N-Linked / Complex / Structure 11108
- N-Linked / Complex / Structure 11119
- N-Linked / Complex / Structure 11556
- N-Linked / Complex / Structure 11660
- N-Linked / Complex / Structure 11696
- N-Linked / Complex / Structure 11789
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 1 / Homo sapiens
- Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
- Calumenin / Homo sapiens
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- CD166 antigen / Homo sapiens
- CD59 glycoprotein / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Clusterin / Homo sapiens
- Decorin / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Ectopic P granules protein 5 homolog / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibroleukin / Homo sapiens
- Fibromodulin / Homo sapiens
- Fibronectin / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Lactotransferrin / Homo sapiens
- Low-density lipoprotein receptor-related protein 2 / Homo sapiens
- Lumican / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
- Mucin-5B / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prickle-like protein 2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prosaposin / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
- Tigger transposable element-derived protein 6 / Homo sapiens
- Transcription factor 4 / Homo sapiens
- Uromodulin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- TAVNCSSDFDACLITK (16aa)
- FVGTPEVNQTTIYQR (15aa)
- YETTNK (6aa)
- FSNVTWF (7aa)
- AVCGGVLVHPQWVLTAAHCIRNKSVILLGR (30aa)
- NKSVLLGR (8aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- INISENYTISISNAR (15aa)
- IAVQFGPGFSWIANFTK (17aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- LHINHNNLTESVGPLPK (17aa)
- FGCEIENNR (9aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- NFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVR (37aa)
- EHEGAIYPDNTTDFQR (16aa)
- IYIDHNNITR (10aa)
- NNQSLP (6aa)
- TPLTANITK (9aa)
- GLTFQQNASSMCGPDQDTAIR (21aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- YIGNATAIFFIPDEGK (16aa)
- IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
- ITDIENGSIANIPR (14aa)
- SGTNHYSTSSCTPPANGTDSIMANR (25aa)
- IIQVVYIHSNNITK (14aa)
- RFPNIT (6aa)
- IHVGNYNGTAGDAIR (15aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- IANITQGEDQYYIR (14aa)
- LSLLEEPGNGTFTVILNQLTSR (22aa)
- NYTDCTSEGR (10aa)
- STGKPTLYNVSLVMSDTAGTCY (22aa)
- DDLIISQDTDIIQDMVAGENTSEAGSEDEGEVSLPEQPK (39aa)
- VPGNVTAVIGETIK (14aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- LALSNATGLSADGGAK (16aa)
- EVNDTLLVNELK (12aa)
- NNSYECDIPI (10aa)
- MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
- NGTHWFVT (8aa)
- CLCPLGFLLANDSK (14aa)
- NYYADNQTCDGELLFNMTK (19aa)
- GFDPDCNK (8aa)
- AFGQFFSPGEVIYNK (15aa)
-
- Hex:5 HexNAc:5 dHex:2 / Undefined type
(avg mass : 2136.9883)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Undefined site
Source
Suggested structure
Disease
Reported glycosite
- Hex:5 HexNAc:5 dHex:2 / Undefined type
(avg mass : 2136.9883)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:5 dHex:2 / N-Linked
(avg mass : 2136.9883)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 2136.9883)
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2136.9883)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2136.9883)