Hex:4 HexNAc:5 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Canis lupus familiaris (Dog)
• Equus caballus (Domestic horse)
• Felis catus (Cat)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Asporin / Homo sapiens    Q9BXN1
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Biglycan / Homo sapiens    P21810
• Cadherin-5 / Homo sapiens    P33151
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Coagulation factor V / Homo sapiens    P12259
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-1(XIV) chain / Homo sapiens    Q05707
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Decorin / Homo sapiens    P07585
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Fibulin-5 / Homo sapiens    Q9UBX5
• Glandular kallikrein 1 / Homo sapiens    P06870
• High affinity immunoglobulin gamma Fc receptor I / Homo sapiens    P12314-2
• IgG1-NK08-V/F genotype / Homo sapiens    P01857
• IgG1-NK09-V/F genotype / Homo sapiens    P01857
• IgG1-NK11-F/F genotype / Homo sapiens    P01857
• IgG1-NK12-V/F genotype / Homo sapiens    P01857
• IgG1-NK13-V/F genotype / Homo sapiens    P01857
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01877    P01876
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens    P0DOX2
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01860    P01857
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens    P01854
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens    P01854
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Immunoglobulin superfamily member 8 / Homo sapiens    Q969P0
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• L-selectin / Homo sapiens    P14151
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens    O75015
• Lumican / Homo sapiens    P51884
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Nidogen-2 / Homo sapiens    Q14112
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Podocalyxin / Homo sapiens    O00592
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens    Q5H9R7
• Soluble calcium-activated nucleotidase 1 / Homo sapiens    Q8WVQ1
• Thrombospondin type-1 domain-containing protein 4 / Homo sapiens    Q6ZMP0
• Thrombospondin-1 / Homo sapiens    P07996
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Uncharacterized protein from Blood Serum / Homo sapiens    
• Uronyl 2-sulfotransferase / Homo sapiens    Q9Y2C2
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Immunoglobulin gamma / Bos taurus    
• Platelet glycoprotein IV / Bos taurus    P26201
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Uncharacterized protein from Milk / Bos taurus    
• Zona pellucida sperm-binding protein 2 / Bos taurus    Q9BH10
• Immunoglobulin gamma / Canis lupus familiaris    
• Immunoglobulin gamma / Equus caballus    
• Immunoglobulin gamma / Felis catus    
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Tenascin-r / Mus musculus    Q8BYI9
• Zona pellucida sperm-binding protein matrix / Mus musculus    P20239    Q62005    P10761
• Immunoglobulin gamma / Oryctolagus cuniculus    
• Immunoglobulin gamma / Ovis aries    
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries    Q712V9
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries    Q712V9
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein / Rattus norvegicus    
• Uncharacterized protein / Rattus norvegicus    
• 32 kDa enamelin / Sus scrofa    O97939
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa    
• Immunoglobulin y / Coturnix coturnix japonica    
• Immunoglobulin gamma / Gallus gallus    
• Immunoglobulin y / Gallus gallus    
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Colostrum (UBERON_0001914)  
• Enamel Organ (UBERON_0005176)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Milk (UBERON_0001913)   Plasma Membrane (GO_0005886)  
• Neurohypophysis (UBERON_0002198)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Pituitary Gland (UBERON_0000007)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• 3Y1-B clone 1 (CVCL_4563)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293-F (CVCL_6642)  
• HEK293T (CVCL_0063)  
• Jurkat (CVCL_0065)  
• LS174T (CVCL_1384)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Adipocytes (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(?1-4)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / Structure 1253
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
• N-Linked / Complex / Structure 9520
• N-Linked / Complex / Structure 9689
• N-Linked / Complex / Structure 9768
• N-Linked / Complex / Structure 9969
• N-Linked / Complex / Structure 10049
• N-Linked / Complex / Structure 10169
• N-Linked / Complex / Structure 10199
• N-Linked / Complex / Structure 10207
• N-Linked / Complex / Structure 10216
• N-Linked / Complex / Structure 10310
• N-Linked / Complex / Structure 10453
• N-Linked / Complex / Structure 10567
• N-Linked / Complex / Structure 10741
• N-Linked / Complex / Structure 10934
• N-Linked / Complex / Structure 10965
• N-Linked / Complex / Structure 11124
• N-Linked / Complex / Structure 11139
• N-Linked / Complex / Structure 11165
• N-Linked / Complex / Structure 11202
• N-Linked / Complex / Structure 11422

Composition

• Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )

Disease

• Arthritis, Rheumatoid (DOID:7148)
• Asymptomatic myositis (DOID:633)
• Atopic dermatitis (DOID:3310)
• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Gastritis (DOID:4029)
• Hyper IgE syndrome (DOID:0080545)
• Melanoma (DOID:1909)
• Multiple myeloma (DOID:9538)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Myositis (DOID:633)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)
• Sjogren's Syndrome (DOID:12894)
• Systemic lupus erythematosus (DOID:9074)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
• Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
• Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• A Method for Comprehensive Glycosite-Mapping and Direct Quantitation of Serum Glycoproteins (2015 - Qiuting Hong, L. Renee Ruhaak, Carol Stroble, Evan Parker, Jincui Huang, Emanual Maverakis, Carlito B. Lebrilla) / Status : Reviewed
• Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
• Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
• Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
• Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
• GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Carbohydrate moieties of porcine 32 kDa enamelin. (1995 - Yamakoshi Y) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed

Reported glycosite

• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-480
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-3780
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Cadherin-5 / Homo sapiens
  •        Undefined site
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-354
• Coagulation factor V / Homo sapiens
  •        Asn-382
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2679
• Collagen alpha-1(XIV) chain / Homo sapiens
  •        Asn-94
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2677
  •        Asn-3037
• Decorin / Homo sapiens
  •        Asn-262
• Erythropoietin / Homo sapiens
  •        Asn-51
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
• Fibulin-5 / Homo sapiens
  •        Asn-296
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• High affinity immunoglobulin gamma Fc receptor I / Homo sapiens
  •        Undefined site
• IgG1-NK08-V/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK09-V/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK11-F/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK12-V/F genotype / Homo sapiens
  •        Asn-180
• IgG1-NK13-V/F genotype / Homo sapiens
  •        Asn-180
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
  •        Asn-21
  •        Asn-99
  •        Asn-146
  •        Asn-252
  •        Asn-264
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
  •        Asn-227
  •        Asn-180
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant A121N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Undefined site
  •        Asn-227
  •        Asn-176
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
  •        Asn-209
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Immunoglobulin superfamily member 8 / Homo sapiens
  •        Asn-327
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
  •        Asn-207
  •        Asn-517
  •        Asn-577
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• L-selectin / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-315
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
  •        Asn-1395
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
  •        Asn-69
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
  •        Undefined site
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-160
  •        Asn-252
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Nidogen-2 / Homo sapiens
  •        Asn-703
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Periostin / Homo sapiens
  •        Asn-599
• Podocalyxin / Homo sapiens
  •        Asn-360
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-337
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
  •        Asn-682
• Soluble calcium-activated nucleotidase 1 / Homo sapiens
  •        Asn-88
• Thrombospondin type-1 domain-containing protein 4 / Homo sapiens
  •        Asn-709
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Blood Serum / Homo sapiens
  •        Undefined site
• Uronyl 2-sulfotransferase / Homo sapiens
  •        Asn-173
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Milk / Bos taurus
  •        Undefined site
• Zona pellucida sperm-binding protein 2 / Bos taurus
  •        Undefined site
• Immunoglobulin gamma / Canis lupus familiaris
  •        Undefined site
• Immunoglobulin gamma / Equus caballus
  •        Undefined site
• Immunoglobulin gamma / Felis catus
  •        Undefined site
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Tenascin-r / Mus musculus
  •        Undefined site
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Immunoglobulin gamma / Ovis aries
  •        Undefined site
• Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •        Asn-184
• Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
  •        Asn-184
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein / Rattus norvegicus
  •        Undefined site
• 32 kDa enamelin / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-657
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-801
  •        Asn-1074
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-343

Mass spectrometry observed peptide

• NSGALTSGVHTFPAVLQSSGLY (22aa)
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
  •       182:L→N
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
  •       178:Q→N
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L177N / Homo sapiens
  •       177:L→N
• SLSSVVTVPSSSLGTQTY (18aa)
  •    P01857        Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant T198N / Homo sapiens
  •       198:T→N
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• KNNSDISSTRGFPSVLRGGKY (21aa)
  •    P01871    Asn-46     Immunoglobulin heavy constant mu / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• STYNDTEDVSQASPSESEAR (20aa)
  •    Q6GTX8    Asn-69     Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• IIVPLNNRENISDPTSPLR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RIIVPLNNRENISDPTSPLRT (21aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RENISDPTSPLRT (13aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• RIIVPLNNRENISDPTSPLRTRF (23aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• IGQAPANWYNDTYPISPPQR (20aa)
  •    Q8WVQ1    Asn-88     Soluble calcium-activated nucleotidase 1 / Homo sapiens
• AIIQGLMPDQNYTVQIIAYNK (21aa)
  •    Q05707    Asn-94     Collagen alpha-1(XIV) chain / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• LSLHRPALEDLLLGSEANLTCTL (23aa)
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160     Lumican / Homo sapiens
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166     Fibromodulin / Homo sapiens
• HVHFINFSR (9aa)
  •    Q9Y2C2    Asn-173     Uronyl 2-sulfotransferase / Homo sapiens
• TKPREEQFNSTFR (13aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• EEQFNSTF (8aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• EEQFNSTFR (9aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •    P01859    Asn-227     Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •    P01860    Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •    VAR_003892   226:Y→F
• KTKPREEQFNSTFRV (15aa)
  •    P01859    Asn-176     Immunoglobulin heavy constant gamma 2 / Homo sapiens
• EEQFNSTYR (9aa)
  •    P01861    Asn-177     Immunoglobulin heavy constant gamma 4 / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• EEQYNSTYR (9aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •    P01857    Asn-227     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• TKPREEQYNSTYR (13aa)
  •    P01857    Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
  •    P01857    Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
• EEQYNSTY (8aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• KTKPREEQYNSTYRV (15aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• EEQYNSTYR  (10aa)
  •    P01857    Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
• YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
  •    Q712V9    Asn-184     Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
• TPLTANITK (9aa)
  •    P01877    Asn-205     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• RGLTFQQNASSMCVPDQDTAIRV (23aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• EEQYNSTFR (9aa)
  •    P01860    Asn-227     Immunoglobulin heavy constant gamma 3 / Homo sapiens
• SALEPLVDLPIGINITR (17aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHLANR (6aa)
  •    Q9NRN5    Asn-248     Olfactomedin-like protein 3 / Homo sapiens
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252     Lumican / Homo sapiens
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• SCQDINECEHRNHTCNLQQTCYNLQGGFK (29aa)
  •    Q9UBX5    Asn-296     Fibulin-5 / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• HVNEINATIYLLK (13aa)
  •    Q16363    Asn-315     Laminin subunit alpha-4 / Homo sapiens
• IGPGEPIEIICNVSGAIPPAGR (22aa)
  •    Q969P0    Asn-327     Immunoglobulin superfamily member 8 / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NIETFTCDTQNITYR (15aa)
  •    P08575    Asn-337     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• LAGKPTHVNVSVV (13aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LAGKPTHVNVSVVM (14aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354     Extracellular matrix protein 1 / Homo sapiens
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354     Clusterin / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• QIVINITGNTICAGGASDEK (20aa)
  •    O00592    Asn-360     Podocalyxin / Homo sapiens
• DECWCPANSTGK (12aa)
  •    Q14767    Asn-421     Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• DSSIHDDFVTTFFVGFSNDSQTWVMYTNGYEEMTFHGNVDK (41aa)
  •    Q8IUX7    Asn-480     Adipocyte enhancer-binding protein 1 / Homo sapiens
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528     Fibronectin / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
  •    Q5H9R7    Asn-682     Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
• IHQNITYQVCR (11aa)
  •    Q14112    Asn-703     Nidogen-2 / Homo sapiens
• QVYANR (6aa)
  •    Q6ZMP0    Asn-709     Thrombospondin type-1 domain-containing protein 4 / Homo sapiens
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGKAHFPR (18aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NISQDLEK (8aa)
  •    P11047    Asn-1241     Laminin subunit gamma-1 / Homo sapiens
• KIPAINQTITEANEK (15aa)
  •    P11047    Asn-1395     Laminin subunit gamma-1 / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• VAVVQHAPSESVDNASMPPVK (21aa)
  •    P12111    Asn-2677     Collagen alpha-3(VI) chain / Homo sapiens
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679     Collagen alpha-1(XII) chain / Homo sapiens
• QNLTVTDR (8aa)
  •    P12111    Asn-3037     Collagen alpha-3(VI) chain / Homo sapiens
• SLTQGSLIVGDLAPVNGTSQGK (22aa)
  •    P98160    Asn-3780     Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens