Hex:4 HexNAc:5 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adipocyte enhancer-binding protein 1 / Homo sapiens    Q8IUX7
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Asporin / Homo sapiens    Q9BXN1
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens    P98160
• Biglycan / Homo sapiens    P21810
• Cadherin-5 / Homo sapiens    P33151
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-1(XIV) chain / Homo sapiens    Q05707
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Collagen alpha-3(VI) chain / Homo sapiens    P12111
• Decorin / Homo sapiens    P07585
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibromodulin / Homo sapiens    Q06828
• Fibronectin / Homo sapiens    P02751
• Fibulin-5 / Homo sapiens    Q9UBX5
• Glandular kallikrein 1 / Homo sapiens    P06870
• Immunoglobulin gamma / Homo sapiens    P01860    P01859    P01861    P01857
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin j chain / Homo sapiens    P01591
• Immunoglobulin superfamily member 8 / Homo sapiens    Q969P0
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Interstitial collagenase / Homo sapiens    P03956
• L-selectin / Homo sapiens    P14151
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens    Q6GTX8
• Lumican / Homo sapiens    P51884
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Nidogen-2 / Homo sapiens    Q14112
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Periostin / Homo sapiens    Q15063
• Podocalyxin / Homo sapiens    O00592
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens    Q9BYF1
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens    Q5H9R7
• Soluble calcium-activated nucleotidase 1 / Homo sapiens    Q8WVQ1
• Thrombospondin type-1 domain-containing protein 4 / Homo sapiens    Q6ZMP0
• Thrombospondin-1 / Homo sapiens    P07996
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Uncharacterized protein from Serum / Homo sapiens
• Uronyl 2-sulfotransferase / Homo sapiens    Q9Y2C2
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Immunoglobulin gamma / Bos taurus
• Platelet glycoprotein IV / Bos taurus    P26201
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
• Zona pellucida sperm-binding protein 2 / Bos taurus    Q9BH10
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Tenascin-r / Mus musculus    Q8BYI9
• Zona pellucida sperm-binding protein matrix / Mus musculus    P20239    Q62005    P10761
• Immunoglobulin gamma / Oryctolagus cuniculus
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
• 32 kDa enamelin / Sus scrofa    O97939
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Immunoglobulin y / Coturnix coturnix japonica
• Immunoglobulin gamma / Gallus gallus
• Immunoglobulin y / Gallus gallus
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Acetabular Part of Hip Bone (UBERON_0001269)   HT-1080 (CVCL_0317)   Fibroblast (CL_0000057)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Enamel Organ (UBERON_0005176)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   BHK-21 (CVCL_1914)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)   Plasma Membrane (GO_0005886)  
• Neurohypophysis (UBERON_0002198)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Pituitary Gland (UBERON_0000007)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Umbilical Vein (UBERON_0002066)   HUVEC-C (CVCL_2959)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• 3Y1-B clone 1 (CVCL_4563)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Jurkat (CVCL_0065)  
• RPMI-1788 (CVCL_2710)   B-Lymphocyte (CL_0000236)  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Gal(?1-4)GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc"
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / Structure 1253
• N-Linked / Complex / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)][GlcNAc(?1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-?)GlcNAc(?1-?)Man(a1-?)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-?)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / Structure 3262
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"

Composition

• Hex:4 HexNAc:5 dHex:1 (avg mass : 1828.7029 )

Disease

• Arthritis, Rheumatoid (DOID:7148)
• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Fibrosarcoma (DOID:3355)
• Melanoma (DOID:1909)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Prostate cancer (DOID:10283)
• Sjogren's Syndrome (DOID:12894)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Unreviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific analysis of the SARS-CoV-2 glycan shield (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties. (2000 - Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Carbohydrate structures of soluble human L-selectin recombinantly expressed in baby-hamster kidney cells. (2000 - Gohlke M, Mach U, Nuck R, Zimmermann-Kordmann M, Grunow D, Fieger C, Volz B, Tauber R, Petri T, Debus N, Reutter W) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• N-glycan structures of matrix metalloproteinase-1 derived from human fibroblasts and from HT-1080 fibrosarcoma cells. (1999 - Saarinen J, Welgus H, Flizar C, Kalkkinen N, Helin J) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Characterization of human vascular endothelial cadherin glycans. (1999 - Geyer H, Geyer R, Odenthal-Schnittler M, Schnittler H) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• Carbohydrate moieties of porcine 32 kDa enamelin. (1995 - Yamakoshi Y) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
• Structures of the asparagine-linked oligosaccharide chains of human von Willebrand factor. Occurrence of blood group A, B, and H(O) structures. (1992 - Matsui T, Titani K, Mizuochi T) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed

Reported glycosite

• Adipocyte enhancer-binding protein 1 / Homo sapiens
  •        Asn-480
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Asporin / Homo sapiens
  •        Asn-282
• Basement membrane-specific heparan sulfate proteoglycan core protein / Homo sapiens
  •        Asn-3780
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Cadherin-5 / Homo sapiens
  •        Undefined site
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-354
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2679
• Collagen alpha-1(XIV) chain / Homo sapiens
  •        Asn-94
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Collagen alpha-3(VI) chain / Homo sapiens
  •        Asn-2677
  •        Asn-3037
• Decorin / Homo sapiens
  •        Asn-262
• Erythropoietin / Homo sapiens
  •        Asn-51
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-354
• Fibromodulin / Homo sapiens
  •        Asn-166
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
  •        Asn-542
• Fibulin-5 / Homo sapiens
  •        Asn-296
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-144
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Immunoglobulin j chain / Homo sapiens
  •        Asn-71
• Immunoglobulin superfamily member 8 / Homo sapiens
  •        Asn-327
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
  •        Asn-207
  •        Asn-517
  •        Asn-577
• Interstitial collagenase / Homo sapiens
  •        Asn-120
• L-selectin / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-315
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
  •        Asn-1395
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Leukocyte-associated immunoglobulin-like receptor 1 / Homo sapiens
  •        Asn-69
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
  •        Asn-160
  •        Asn-252
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Nidogen-2 / Homo sapiens
  •        Asn-703
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
  •        Asn-248
• Periostin / Homo sapiens
  •        Asn-599
• Podocalyxin / Homo sapiens
  •        Asn-360
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-337
• Recombinant mature angiotensin-converting enzyme 2 - DRAFT DATA / Homo sapiens
  •        Asn-53
  •        Asn-90
  •        Asn-322
  •        Asn-432
  •        Asn-690
• Serine/threonine-protein phosphatase 6 regulatory subunit 3 / Homo sapiens
  •        Asn-682
• Soluble calcium-activated nucleotidase 1 / Homo sapiens
  •        Asn-88
• Thrombospondin type-1 domain-containing protein 4 / Homo sapiens
  •        Asn-709
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Serum / Homo sapiens
  •        Undefined site
• Uronyl 2-sulfotransferase / Homo sapiens
  •        Asn-173
• Von willebrand factor / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Milk Fat Globule Membrane / Bos taurus
  •        Undefined site
• Zona pellucida sperm-binding protein 2 / Bos taurus
  •        Undefined site
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Tenascin-r / Mus musculus
  •        Undefined site
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• Uncharacterized protein from Undefined tissue / Rattus norvegicus
  •        Undefined site
• 32 kDa enamelin / Sus scrofa
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-657
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - DRAFT DATA / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-122
  •        Asn-149
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-657
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1135
  •        Asn-1159
  •        Asn-1174
  •        Asn-1194

Mass spectrometry observed peptide

• PLVSSQCVNLTTR (13aa)
  •    P0DTC2    Asn-17
• FVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDK (40aa)
  •    P0DTC2    Asn-17
• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51
• NTNITEENVQ (10aa)
  •    Q9BYF1    Asn-53
• NYNTNITEENVQNMNNAGDK (20aa)
  •    Q9BYF1    Asn-53
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• STYNDTEDVSQASPSESEAR (20aa)
  •    Q6GTX8    Asn-69
• IIVPINNRENISDPTSPIR (19aa)
  •    P01591    Asn-71
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88
• IGQAPANWYNDTYPISPPQR (20aa)
  •    Q8WVQ1    Asn-88
• PLQEIQNLTV (10aa)
  •    Q9BYF1    Asn-90
• AIIQGLMPDQNYTVQIIAYNK (21aa)
  •    Q05707    Asn-94
• IIRGWIFGTTLDSKTQSLLIVNNATNVVIK (30aa)
  •    P0DTC2    Asn-122
• NIIRGWIFGTTLDSKTQSLLIVNNATNVVIK (31aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• DSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHK (37aa)
  •    P0DTC2    Asn-122
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• LSLHRPALEDLLLGSEANLTCTL (23aa)
  •    P01877    Asn-131
• LSLHRPALEDLLLGSEANLTCTL (23aa)
  •    P01876    Asn-144
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149
• FQFCNDPFLGVYYHKNNK (18aa)
  •    P0DTC2    Asn-149
• VCEFQFCNDPFLGVYYHKNNK (21aa)
  •    P0DTC2    Asn-149
• IGSFEGIVNITFIHIQHNR (19aa)
  •    P51884    Asn-160
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• IYIDHNNITR (10aa)
  •    Q06828    Asn-166
• HVHFINFSR (9aa)
  •    Q9Y2C2    Asn-173
• EEQFNSTF (8aa)
  •    P01859    Asn-176
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• EEQFNSTYR (9aa)
  •    P01861    Asn-177
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• TPLTANITK (9aa)
  •    P01877    Asn-205
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• EEQYNSTFR (9aa)
  •    P01860    Asn-227
• DLPQGFSALEPLVDLPIGINITRFQTLLAL (30aa)
  •    P0DTC2    Asn-234
• PQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPR (57aa)
  •    P0DTC2    Asn-234
• PQGFSALEPLVDLPIGINITR (21aa)
  •    P0DTC2    Asn-234
• SALEPLVDLPIGINITR (17aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITR (23aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWT (45aa)
  •    P0DTC2    Asn-234
• FHLANR (6aa)
  •    Q9NRN5    Asn-248
• ISHNEIADSGIPGNSFNVSSIVEIDISYNK (30aa)
  •    P51884    Asn-252
• GLSFNSISAVDNGSLANTPHLR (22aa)
  •    P07585    Asn-262
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• SCQDINECEHRNHTCNLQQTCYNLQGGFK (29aa)
  •    Q9UBX5    Asn-296
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311
• HVNEINATIYLLK (13aa)
  •    Q16363    Asn-315
• VSVGLPNMTQGFW (13aa)
  •    Q9BYF1    Asn-322
• IGPGEPIEIICNVSGAIPPAGR (22aa)
  •    Q969P0    Asn-327
• FPNITNLCPFGEVFNA (16aa)
  •    P0DTC2    Asn-331
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• FPNITNLCP (9aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGEVFN (15aa)
  •    P0DTC2    Asn-343
• NIETFTCDTQNITYR (15aa)
  •    P08575    Asn-337
• LAGKPTHVNVSVV (13aa)
  •    P01876    Asn-340
• LAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340
• LAGKPTHVNVSVVM (14aa)
  •    P01876    Asn-340
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343
• QGNNHTCTWK (10aa)
  •    Q16610    Asn-354
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• QIVINITGNTICAGGASDEK (20aa)
  •    O00592    Asn-360
• DECWCPANSTGK (12aa)
  •    Q14767    Asn-421
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• GGNSNGAICHFPFIYNNHNYTDCTSEGR (28aa)
  •    P02751    Asn-430
• LSPDFQEDNETEINF (15aa)
  •    Q9BYF1    Asn-432
• SIGLLSPDFQEDNETEINF (19aa)
  •    Q9BYF1    Asn-432
• SPDFQEDNETEINFL (15aa)
  •    Q9BYF1    Asn-432
• DSSIHDDFVTTFFVGFSNDSQTWVMYTNGYEEMTFHGNVDK (41aa)
  •    Q8IUX7    Asn-480
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• MEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTK (44aa)
  •    Q5H9R7    Asn-682
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• IHQNITYQVCR (11aa)
  •    Q14112    Asn-703
• QVYANR (6aa)
  •    Q6ZMP0    Asn-709
• IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYI (51aa)
  •    P0DTC2    Asn-717
• SIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNR (75aa)
  •    P0DTC2    Asn-717
• IPTNF (5aa)
  •    P0DTC2    Asn-717
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGKAHFPR (18aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNT (34aa)
  •    P0DTC2    Asn-1098
• NFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFK (50aa)
  •    P0DTC2    Asn-1135
• YFKNHTSPDVDLGDISGIN (19aa)
  •    P0DTC2    Asn-1159
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159
• GDISGINASVVNIQK (15aa)
  •    P0DTC2    Asn-1174
• NLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLI (34aa)
  •    P0DTC2    Asn-1194
• NLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTI (41aa)
  •    P0DTC2    Asn-1194
• NISQDLEK (8aa)
  •    P11047    Asn-1241
• KIPAINQTITEANEK (15aa)
  •    P11047    Asn-1395
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• VAVVQHAPSESVDNASMPPVK (21aa)
  •    P12111    Asn-2677
• EAGNITTDGYEIIGK (15aa)
  •    Q99715    Asn-2679
• QNLTVTDR (8aa)
  •    P12111    Asn-3037
• SLTQGSLIVGDLAPVNGTSQGK (22aa)
  •    P98160    Asn-3780