Hex:9 HexNAc:5 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Rattus norvegicus (Norway rat)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Uromodulin / Homo sapiens    P07911
• Ribonuclease, brain / Bos taurus    P39873
• Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Brain (UBERON_0000955)  
• Urine (UBERON_0001088)  
• HEK293 (CVCL_0045)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  

Reported structure

• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-3)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc

Composition

• Hex:9 HexNAc:5 dHex:1 (avg mass : 2639.4149 )

Disease

• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• The structure of the asparagine-linked sugar chains of bovine brain ribonuclease. (1990 - Katoh H, Ohgi K, Irie M, Endo T, Kobata A) / Status : Reviewed
• The asparagine-linked sugar chains of the glycoproteins in rat erythrocyte plasma membrane--fractionation of oligosaccharides liberated by hydrazinolysis and structural studies of the neutral oligosaccharides. (1982 - Matsumoto A, Yoshima H, Maeda S, Shiraishi N, Kobata A) / Status : Reviewed

Reported glycosite

• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Uromodulin / Homo sapiens
  •        Asn-513
• Ribonuclease, brain / Bos taurus
  •        Asn-88
• Uncharacterized protein from Erythrocyte Membrane / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-282
  •        Asn-615

Mass spectrometry observed peptide

• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• GWIFGTTLDSKTQSLLIVNNATNVVIK (27aa)
  •    P0DTC2    Asn-122
• NGTITDAVDCALDPLSEK (18aa)
  •    P0DTC2    Asn-282
• FALLMTNCYATPSSNATDPLK (21aa)
  •    P07911    Asn-513
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-615