Hex:3 HexNAc:6 dHex:1 NeuAc:2

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Bothrops atrox moojeni (Barba amarilla)

Protein

• Apolipoprotein D / Homo sapiens    P05090
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Biglycan / Homo sapiens    P21810
• Ceruloplasmin / Homo sapiens    P00450
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens    P12314-2
• Legumain / Homo sapiens    Q99538
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens    P12318-1
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens    P31994-3
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Mucin-2 / Homo sapiens    Q02817
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Periostin / Homo sapiens    Q15063
• Prolactin-inducible protein / Homo sapiens    P12273
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Protein CASC4 / Homo sapiens    Q6P4E1
• Protein-lysine 6-oxidase / Homo sapiens    P28300
• Prothrombin / Homo sapiens    P00734
• Serotransferrin / Homo sapiens    P02787
• Solute carrier family 12 member 2 / Homo sapiens    P55011
• Tissue-type plasminogen activator / Homo sapiens    P00750
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• BMP/retinoic acid-inducible neural-specific protein 1 / Mus musculus    Q920P3
• Hyaluronan and proteoglycan link protein 1 / Mus musculus    Q9QUP5
• Hyaluronan and proteoglycan link protein 4 / Mus musculus    Q80WM4
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Neurocan core protein / Mus musculus    P55066
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Batroxobin / Bothrops atrox moojeni    P04971

Source

• Brain (UBERON_0000955)  
• Colonic Mucosa (UBERON_0000317)  
• Mammary Gland (UBERON_0001911)  
• Prefrontal Cortex (UBERON:0000451)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• HEK293 (CVCL_0045)  

Reported structure

• N-Linked / Complex / NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 10826
• N-Linked / Complex / Structure 11419
• N-Linked / Complex / Structure 11774
• O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GlcNAc(b1-3)[GalNAc(a1-3)[NeuAc(a2-6)]Gal(b1-3)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)[NeuAc(a2-6)]GalNAc

Composition

• Hex:3 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2452.2713 )

Disease

• Cancer, breast (DOID:1612)
• Diverticulosis (DOID:7475)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)

Reference

• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Novel structure of the N-acetylgalactosamine containing N-glycosidic carbohydrate chain of batroxobin, a thrombin-like snake venom enzyme. (1992 - Tanaka N, Nakada H, Itoh N, Mizuno Y, Takanishi M, Kawasaki T, Tate S, Inagaki F, Yamashina I) / Status : Reviewed
• A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed
• Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed

Reported glycosite

• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-914
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Ceruloplasmin / Homo sapiens
  •        Asn-138
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-95
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-210
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-453
• High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
  •        Undefined site
• Legumain / Homo sapiens
  •        Asn-263
• Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
  •        Undefined site
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Undefined site
• Mucin-2 / Homo sapiens
  •        Undefined site
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-422
• Periostin / Homo sapiens
  •        Asn-599
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Protein CASC4 / Homo sapiens
  •        Asn-150
• Protein-lysine 6-oxidase / Homo sapiens
  •        Asn-97
• Prothrombin / Homo sapiens
  •        Asn-143
• Serotransferrin / Homo sapiens
  •        Asn-432
  •        Asn-630
• Solute carrier family 12 member 2 / Homo sapiens
  •        Asn-553
• Tissue-type plasminogen activator / Homo sapiens
  •        Asn-219
  •        Asn-483
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• BMP/retinoic acid-inducible neural-specific protein 1 / Mus musculus
  •        Asn-630
• Hyaluronan and proteoglycan link protein 1 / Mus musculus
  •        Asn-58
• Hyaluronan and proteoglycan link protein 4 / Mus musculus
  •        Asn-133
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-195
• Neurocan core protein / Mus musculus
  •        Asn-1175
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-197
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Batroxobin / Bothrops atrox moojeni
  •        Undefined site

Mass spectrometry observed peptide

• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44     WAP four-disulfide core domain protein 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• GGNVTLPCK (9aa)
  •    Q9QUP5    Asn-58     Hyaluronan and proteoglycan link protein 1 / Mus musculus
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• LVMEILNVTLVPYGNAQEQNVSGR (24aa)
  •    P13284    Asn-95     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAKLEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• AVIVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109     Golgi membrane protein 1 / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• NVTLQDYGR (9aa)
  •    Q80WM4    Asn-133     Hyaluronan and proteoglycan link protein 4 / Mus musculus
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• SRYPHKPEINSTTHPGADLQENFCR (25aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• KNNTYIVK (8aa)
  •    Q6P4E1    Asn-150     Protein CASC4 / Homo sapiens
• NNTYLVK (7aa)
  •    Q6P4E1    Asn-150     Protein CASC4 / Homo sapiens
• REDHRVNFSCLAELDLRPHGLGLFANSSAPR (31aa)
  •    Q60625    Asn-195     Intercellular adhesion molecule 5 / Mus musculus
• VINFYAGANQSMNVTCVGKR (20aa)
  •    P14231    Asn-197     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• GNITEYQCHQYITK (14aa)
  •    Q92896    Asn-210     Golgi apparatus protein 1 / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• SHTNTSHVMQYGNK (14aa)
  •    Q99538    Asn-263     Legumain / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• NVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVR (35aa)
  •    P15586    Asn-422     N-acetylglucosamine-6-sulfatase / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• DATGNVNDTIVTEITNCTSAACK (23aa)
  •    P55011    Asn-553     Solute carrier family 12 member 2 / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• TRLPTLRNETGQGPVDLSDPSKR (23aa)
  •    Q920P3    Asn-630     BMP/retinoic acid-inducible neural-specific protein 1 / Mus musculus
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630     Serotransferrin / Homo sapiens
• AATCINPINGSVCERPANHSAK (22aa)
  •    O75882    Asn-914     Attractin / Homo sapiens
• GTVLCGPPPAVENASLVGVR (20aa)
  •    P55066    Asn-1175     Neurocan core protein / Mus musculus