Hex:3 HexNAc:6 dHex:1 NeuAc:2

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Bothrops atrox moojeni (Barba amarilla)

Protein

• Apolipoprotein d / Homo sapiens    P05090
• Asporin / Homo sapiens    Q9BXN1
• Attractin / Homo sapiens    O75882
• Biglycan / Homo sapiens    P21810
• Ceruloplasmin / Homo sapiens    P00450
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Golgi apparatus protein 1 / Homo sapiens    Q92896
• Golgi membrane protein 1 / Homo sapiens    Q8NBJ4
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Legumain / Homo sapiens    Q99538
• Mucin - species IV / Homo sapiens
• Mucin - species V / Homo sapiens
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Periostin / Homo sapiens    Q15063
• Prolactin-inducible protein / Homo sapiens    P12273
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein CASC4 / Homo sapiens    Q6P4E1
• Protein-lysine 6-oxidase / Homo sapiens    P28300
• Prothrombin / Homo sapiens    P00734
• Serotransferrin / Homo sapiens    P02787
• Solute carrier family 12 member 2 / Homo sapiens    P55011
• Tissue-type plasminogen activator / Homo sapiens    P00750
• WAP four-disulfide core domain protein 2 / Homo sapiens    Q14508
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• BMP/retinoic acid-inducible neural-specific protein 1 / Mus musculus    Q920P3
• Hyaluronan and proteoglycan link protein 1 / Mus musculus    Q9QUP5
• Hyaluronan and proteoglycan link protein 4 / Mus musculus    Q80WM4
• Intercellular adhesion molecule 5 / Mus musculus    Q60625
• Neurocan core protein / Mus musculus    P55066
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Batroxobin / Bothrops atrox moojeni    P04971

Source

• Brain (UBERON_0000955)  
• Colonic Mucosa (UBERON_0000317)  
• Mammary Gland (UBERON_0001911)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  

Reported structure

• O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-3)GlcNAc(b1-3)[GalNAc(a1-3)[NeuAc(a2-6)]Gal(b1-3)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)[NeuAc(a2-6)]GalNAc
• N-Linked / Complex / NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-3)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc
• N-Linked / Complex / NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[NeuAc(a2-6)GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Structure 2358

Composition

• Hex:3 HexNAc:6 dHex:1 NeuAc:2 (avg mass : 2452.2713 )

Disease

• Cancer, breast (DOID:1612)
• Diverticulosis (DOID:7475)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)

Reference

• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Novel structure of the N-acetylgalactosamine containing N-glycosidic carbohydrate chain of batroxobin, a thrombin-like snake venom enzyme. (1992 - Tanaka N, Nakada H, Itoh N, Mizuno Y, Takanishi M, Kawasaki T, Tate S, Inagaki F, Yamashina I) / Status : Reviewed
• A novel sialylated N-acetylgalactosamine-containing oligosaccharide is the major complex-type structure present in Bowes melanoma tissue plasminogen activator. (1991 - Chan A, Morris H, Panico M, Etienne A, Rogers M, Gaffney P, Creighton-Kempsford L, Dell A) / Status : Reviewed
• Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed

Reported glycosite

• Apolipoprotein d / Homo sapiens
  •        Asn-98
• Asporin / Homo sapiens
  •        Asn-282
• Attractin / Homo sapiens
  •        Asn-914
• Biglycan / Homo sapiens
  •        Asn-270
  •        Asn-311
• Ceruloplasmin / Homo sapiens
  •        Asn-138
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-95
• Golgi apparatus protein 1 / Homo sapiens
  •        Asn-210
• Golgi membrane protein 1 / Homo sapiens
  •        Asn-109
• Haptoglobin / Homo sapiens
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-453
• Legumain / Homo sapiens
  •        Asn-263
• Mucin - species IV / Homo sapiens
  •        Undefined site
• Mucin - species V / Homo sapiens
  •        Undefined site
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-422
• Periostin / Homo sapiens
  •        Asn-599
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein CASC4 / Homo sapiens
  •        Asn-150
• Protein-lysine 6-oxidase / Homo sapiens
  •        Asn-97
• Prothrombin / Homo sapiens
  •        Asn-143
• Serotransferrin / Homo sapiens
  •        Asn-432
  •        Asn-630
• Solute carrier family 12 member 2 / Homo sapiens
  •        Asn-553
• Tissue-type plasminogen activator / Homo sapiens
  •        Asn-219
  •        Asn-483
• WAP four-disulfide core domain protein 2 / Homo sapiens
  •        Asn-44
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
  •        Asn-128
• BMP/retinoic acid-inducible neural-specific protein 1 / Mus musculus
  •        Asn-630
• Hyaluronan and proteoglycan link protein 1 / Mus musculus
  •        Asn-58
• Hyaluronan and proteoglycan link protein 4 / Mus musculus
  •        Asn-133
• Intercellular adhesion molecule 5 / Mus musculus
  •        Asn-195
• Neurocan core protein / Mus musculus
  •        Asn-1175
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-197
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Batroxobin / Bothrops atrox moojeni
  •        Undefined site

Mass spectrometry observed peptide

• TGVCPELQADQNCTQECVSDSECADNLK (28aa)
  •    Q14508    Asn-44
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51
• GGNVTLPCK (9aa)
  •    Q9QUP5    Asn-58
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• LVMEILNVTLVPYGNAQEQNVSGR (24aa)
  •    P13284    Asn-95
• ADGTVNQIEGEATPVNLTEPAKLEVK (26aa)
  •    P05090    Asn-98
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109
• AVIVNNITTGER (12aa)
  •    Q8NBJ4    Asn-109
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• NVTLQDYGR (9aa)
  •    Q80WM4    Asn-133
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143
• SRYPHKPEINSTTHPGADLQENFCR (25aa)
  •    P00734    Asn-143
• KNNTYIVK (8aa)
  •    Q6P4E1    Asn-150
• NNTYLVK (7aa)
  •    Q6P4E1    Asn-150
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• REDHRVNFSCLAELDLRPHGLGLFANSSAPR (31aa)
  •    Q60625    Asn-195
• VINFYAGANQSMNVTCVGKR (20aa)
  •    P14231    Asn-197
• GNITEYQCHQYITK (14aa)
  •    Q92896    Asn-210
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241
• SHTNTSHVMQYGNK (14aa)
  •    Q99538    Asn-263
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311
• LQVVYLHSNNITK (13aa)
  •    P21810    Asn-311
• NVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVR (35aa)
  •    P15586    Asn-422
• ALPQPQNVTSLLGCTH (16aa)
  •    P02790    Asn-453
• DATGNVNDTIVTEITNCTSAACK (23aa)
  •    P55011    Asn-553
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• TRLPTLRNETGQGPVDLSDPSKR (23aa)
  •    Q920P3    Asn-630
• QQQHLFGSNVTDCSGNFCLFR (21aa)
  •    P02787    Asn-630
• AATCINPINGSVCERPANHSAK (22aa)
  •    O75882    Asn-914
• GTVLCGPPPAVENASLVGVR (20aa)
  •    P55066    Asn-1175