taxonomy (7)
protein (83)
source (14)
structure (14)
composition (1)
disease (4)
reference (16)
site (90)
peptide (62)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Agrin / Homo sapiens O00468
- Alpha-2-macroglobulin / Homo sapiens P01023
- Attractin / Homo sapiens O75882
- Beta-glucuronidase / Homo sapiens P08236
- Calponin-3 / Homo sapiens Q15417
- Claudin domain-containing protein 1 / Homo sapiens Q9NY35
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Homo sapiens P18850
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Fibrillin-1 / Homo sapiens P35555
- Fibrinogen alpha chain / Homo sapiens P02671
- Fibronectin / Homo sapiens P02751
- Folate receptor alpha / Homo sapiens P15328
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Hemopexin / Homo sapiens P02790
- High affinity cationic amino acid transporter 1 / Homo sapiens P30825
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens P30450
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens P30453
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens P30456
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens P30457
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens Q29865
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens P30504
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens P10321
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Integral membrane protein DGCR2/IDD / Homo sapiens P98153
- Integrin beta-1 / Homo sapiens P05556
- Intercellular adhesion molecule 2 / Homo sapiens P13598
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-5 / Homo sapiens O15230
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Neurexin-1 / Homo sapiens Q9ULB1
- Neurocan core protein / Homo sapiens O14594
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Plexin-B2 / Homo sapiens O15031
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prosaposin / Homo sapiens P07602
- Protocadherin gamma-B1 / Homo sapiens Q9Y5G3
- Protocadherin gamma-B2 / Homo sapiens Q9Y5G2
- Protocadherin gamma-B4 / Homo sapiens Q9UN71
- Protocadherin gamma-B5 / Homo sapiens Q9Y5G0
- Protocadherin gamma-B7 / Homo sapiens Q9Y5F8
- Serine--tRNA ligase, cytoplasmic / Homo sapiens P49591
- Teneurin-2 / Homo sapiens Q9NT68
- Thrombospondin-1 / Homo sapiens P07996
- Translocating chain-associated membrane protein 1 / Homo sapiens Q15629
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens Q6NSJ0
- Uromodulin / Homo sapiens P07911
- Uroplakin-3b-like protein / Homo sapiens B0FP48
- Vesicle-trafficking protein SEC22b / Homo sapiens O75396
- Villin-1 / Homo sapiens P09327
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- Platelet glycoprotein IV / Bos taurus P26201
- Uncharacterized protein from Milk / Bos taurus
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Isoform 2 of Acid-sensing ion channel 1 / Mus musculus Q6NXK8-2
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Acetylcholine receptor protein / Torpedo californica P02718 P02712 P02710 P02714
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Milk (UBERON_0001913) Plasma Membrane (GO_0005886)
- Prefrontal Cortex (UBERON:0000451)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- 3Y1-B clone 1 (CVCL_4563)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Egg Cell
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2014
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 10012
- N-Linked / Complex / Structure 10189
- N-Linked / Complex / Structure 11113
- N-Linked / Complex / Structure 11517
- N-Linked / Complex / Structure 11598
Reported structure
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
Composition
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
Disease
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
Reference
- Agrin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Attractin / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Calponin-3 / Homo sapiens
- Claudin domain-containing protein 1 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- High affinity cationic amino acid transporter 1 / Homo sapiens
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integral membrane protein DGCR2/IDD / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Neurexin-1 / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Protocadherin gamma-B1 / Homo sapiens
- Protocadherin gamma-B2 / Homo sapiens
- Protocadherin gamma-B4 / Homo sapiens
- Protocadherin gamma-B5 / Homo sapiens
- Protocadherin gamma-B7 / Homo sapiens
- Serine--tRNA ligase, cytoplasmic / Homo sapiens
- Teneurin-2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Translocating chain-associated membrane protein 1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
- Uromodulin / Homo sapiens
- Uroplakin-3b-like protein / Homo sapiens
- Vesicle-trafficking protein SEC22b / Homo sapiens
- Villin-1 / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
- Cell cycle control protein 50A / Mus musculus
- Isoform 2 of Acid-sensing ion channel 1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NSSDLNK (7aa)
- FECHFFNGTER (11aa)
- P04229 Asn-48     HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- Q9TQE0 Asn-48     HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Q30167 Asn-48     HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- DIYTFDGAINK (11aa)
- FHAIHVSGTNGTKRF (15aa)
- KEDALNETR (9aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEDGSHTIQR (15aa)
- P30450 Asn-110     HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- P30453 Asn-110     HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- P30457 Asn-110     HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- P30456 Asn-110     HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- Q29865 Asn-110     HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- P10321 Asn-110     HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- P30504 Asn-110     HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- ANATLLLGPLR (11aa)
- TQSLLIVNNATNVVIK (16aa)
- NTTLFIDQVEAK (12aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- VGNDTHCQPTK (11aa)
- INGSIATFSTDQEIR (15aa)
- GWNWTSGFNK (10aa)
- ANNLSSLSK (9aa)
- ITIAINNTLTPTTLPPGTIQYLTDTSK (27aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- NPCTSEQNCTSPFSYK (16aa)
- GINESYK (7aa)
- FSDGIESNSSTQFEVK (16aa)
- NWQITEEDFGNTSGR (15aa)
- ITIQPVDNSTISIQMGTNK (19aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- IININPNK (8aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- AGKPTHVNVSV (11aa)
- FPNITNLCPFGE (12aa)
- KGTENGVNGTLTSNVADSPR (20aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- TCIMEASTDFLPGLNFSNCSR (21aa)
- ECADPALDFLVEKDQEYCVCEMPCNLTR (28aa)
- KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
- NATMCATTR (9aa)
- FNSTEYQVVTR (11aa)
- AIPQPQNVTSIIGCTH (16aa)
- ALMVLTEEPLLYIPPPPCQPLINTTESLR (29aa)
- VGYQSQNISCFFR (13aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- KENSSEICSNNGECVCGQCVCR (22aa)
- LFQVQGTGANNTK (13aa)
- DQGSPAISANVSIR (14aa)
- Q9UN71 Asn-543     Protocadherin gamma-B4 / Homo sapiens
- Q9Y5G0 Asn-541     Protocadherin gamma-B5 / Homo sapiens
- Q9Y5F8 Asn-545     Protocadherin gamma-B7 / Homo sapiens
- Q9Y5G2 Asn-545     Protocadherin gamma-B2 / Homo sapiens
- Q9Y5G3 Asn-541     Protocadherin gamma-B1 / Homo sapiens
- ADFGNHTK (8aa)
- MDGSINFNR (9aa)
- NCSFQPER (8aa)
- CINQSICEK (9aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- WTPINSSTIIGYR (13aa)
- SNQTLSLFFTVLQDVPVR (18aa)
- DNTTCYEFK (9aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- LGPYANTTK (9aa)
- MIEAYNITEK (10aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- NASLALSASIGR (12aa)
- ITSCATNASICGDEAR (16aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2047.8973)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Egg Cell
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 2047.8973)
-
- N-Linked / Complex
(avg mass : 2047.8973)
-
- Hex:5 HexNAc:6 / N-Linked
(avg mass : 2047.8973)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2014
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 10012
- N-Linked / Complex / Structure 10189
- N-Linked / Complex / Structure 11113
- N-Linked / Complex / Structure 11517
- N-Linked / Complex / Structure 11598
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Agrin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Attractin / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Calponin-3 / Homo sapiens
- Claudin domain-containing protein 1 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- High affinity cationic amino acid transporter 1 / Homo sapiens
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integral membrane protein DGCR2/IDD / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Neurexin-1 / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Protocadherin gamma-B1 / Homo sapiens
- Protocadherin gamma-B2 / Homo sapiens
- Protocadherin gamma-B4 / Homo sapiens
- Protocadherin gamma-B5 / Homo sapiens
- Protocadherin gamma-B7 / Homo sapiens
- Serine--tRNA ligase, cytoplasmic / Homo sapiens
- Teneurin-2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Translocating chain-associated membrane protein 1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
- Uromodulin / Homo sapiens
- Uroplakin-3b-like protein / Homo sapiens
- Vesicle-trafficking protein SEC22b / Homo sapiens
- Villin-1 / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
- Cell cycle control protein 50A / Mus musculus
- Isoform 2 of Acid-sensing ion channel 1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NSSDLNK (7aa)
- FECHFFNGTER (11aa)
- P04229 Asn-48     HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- Q9TQE0 Asn-48     HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Q30167 Asn-48     HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- DIYTFDGAINK (11aa)
- FHAIHVSGTNGTKRF (15aa)
- KEDALNETR (9aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEDGSHTIQR (15aa)
- P30450 Asn-110     HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- P30453 Asn-110     HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- P30457 Asn-110     HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- P30456 Asn-110     HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- Q29865 Asn-110     HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- P10321 Asn-110     HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- P30504 Asn-110     HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- ANATLLLGPLR (11aa)
- NTTLFIDQVEAK (12aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- VGNDTHCQPTK (11aa)
- INGSIATFSTDQEIR (15aa)
- GWNWTSGFNK (10aa)
- ANNLSSLSK (9aa)
- ITIAINNTLTPTTLPPGTIQYLTDTSK (27aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- NPCTSEQNCTSPFSYK (16aa)
- GINESYK (7aa)
- FSDGIESNSSTQFEVK (16aa)
- NWQITEEDFGNTSGR (15aa)
- ITIQPVDNSTISIQMGTNK (19aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- IININPNK (8aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- AGKPTHVNVSV (11aa)
- KGTENGVNGTLTSNVADSPR (20aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- TCIMEASTDFLPGLNFSNCSR (21aa)
- ECADPALDFLVEKDQEYCVCEMPCNLTR (28aa)
- KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
- NATMCATTR (9aa)
- FNSTEYQVVTR (11aa)
- AIPQPQNVTSIIGCTH (16aa)
- ALMVLTEEPLLYIPPPPCQPLINTTESLR (29aa)
- VGYQSQNISCFFR (13aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- KENSSEICSNNGECVCGQCVCR (22aa)
- LFQVQGTGANNTK (13aa)
- DQGSPAISANVSIR (14aa)
- Q9UN71 Asn-543     Protocadherin gamma-B4 / Homo sapiens
- Q9Y5G0 Asn-541     Protocadherin gamma-B5 / Homo sapiens
- Q9Y5F8 Asn-545     Protocadherin gamma-B7 / Homo sapiens
- Q9Y5G2 Asn-545     Protocadherin gamma-B2 / Homo sapiens
- Q9Y5G3 Asn-541     Protocadherin gamma-B1 / Homo sapiens
- ADFGNHTK (8aa)
- MDGSINFNR (9aa)
- NCSFQPER (8aa)
- CINQSICEK (9aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- WTPINSSTIIGYR (13aa)
- SNQTLSLFFTVLQDVPVR (18aa)
- DNTTCYEFK (9aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- LGPYANTTK (9aa)
- MIEAYNITEK (10aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- NASLALSASIGR (12aa)
- ITSCATNASICGDEAR (16aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:6 / N-Linked
(avg mass : 2047.8973)
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2047.8973)
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)