taxonomy (7)
protein (83)
source (12)
structure (11)
composition (1)
disease (4)
reference (14)
site (90)
peptide (62)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Agrin / Homo sapiens O00468
- Alpha-2-macroglobulin / Homo sapiens P01023
- Attractin / Homo sapiens O75882
- Beta-glucuronidase / Homo sapiens P08236
- Calponin-3 / Homo sapiens Q15417
- Claudin domain-containing protein 1 / Homo sapiens Q9NY35
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-3(VI) chain / Homo sapiens P12111
- Complement c4-a / Homo sapiens P0C0L4
- Complement C4-B / Homo sapiens P0C0L5
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Homo sapiens P18850
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens Q13444
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens Q9Y5L3
- Fibrillin-1 / Homo sapiens P35555
- Fibrinogen alpha chain / Homo sapiens P02671
- Fibronectin / Homo sapiens P02751
- Folate receptor alpha / Homo sapiens P15328
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Golgi membrane protein 1 / Homo sapiens Q8NBJ4
- Hemopexin / Homo sapiens P02790
- High affinity cationic amino acid transporter 1 / Homo sapiens P30825
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens P30450
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens P30453
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens P30456
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens P30457
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens Q29865
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens P30504
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens P10321
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens P04229
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens Q30167
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens Q9TQE0
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Integral membrane protein DGCR2/IDD / Homo sapiens P98153
- Integrin beta-1 / Homo sapiens P05556
- Intercellular adhesion molecule 2 / Homo sapiens P13598
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-5 / Homo sapiens O15230
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Mannosyl-oligosaccharide glucosidase / Homo sapiens Q13724
- Neurexin-1 / Homo sapiens Q9ULB1
- Neurocan core protein / Homo sapiens O14594
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Plexin-B2 / Homo sapiens O15031
- Prolactin-inducible protein / Homo sapiens P12273
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prosaposin / Homo sapiens P07602
- Protocadherin gamma-B1 / Homo sapiens Q9Y5G3
- Protocadherin gamma-B2 / Homo sapiens Q9Y5G2
- Protocadherin gamma-B4 / Homo sapiens Q9UN71
- Protocadherin gamma-B5 / Homo sapiens Q9Y5G0
- Protocadherin gamma-B7 / Homo sapiens Q9Y5F8
- Serine--tRNA ligase, cytoplasmic / Homo sapiens P49591
- Teneurin-2 / Homo sapiens Q9NT68
- Thrombospondin-1 / Homo sapiens P07996
- Translocating chain-associated membrane protein 1 / Homo sapiens Q15629
- Translocon-associated protein subunit alpha / Homo sapiens P43307
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens Q6NSJ0
- Uromodulin / Homo sapiens P07911
- Uroplakin-3b-like protein / Homo sapiens B0FP48
- Vesicle-trafficking protein SEC22b / Homo sapiens O75396
- Villin-1 / Homo sapiens P09327
- Zymogen granule protein 16 homolog B / Homo sapiens Q96DA0
- Platelet glycoprotein IV / Bos taurus P26201
- Uncharacterized protein from Milk / Bos taurus
- Cell cycle control protein 50A / Mus musculus Q8VEK0
- Isoform 2 of Acid-sensing ion channel 1 / Mus musculus Q6NXK8-2
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Uncharacterized protein / Rattus norvegicus
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Acetylcholine receptor protein / Torpedo californica P02712 P02718 P02710 P02714
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Electric Organ (UBERON_0006869)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Milk (UBERON_0001913) Plasma Membrane (GO_0005886)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- 3Y1-B clone 1 (CVCL_4563)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Egg Cell
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2014
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 10012
- N-Linked / Complex / Structure 10189
Reported structure
- Hex:5 HexNAc:6 (avg mass : 2047.8973 )
Composition
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Differential Glycosylation of Polymeric and Monomeric IgA: A Possible Role in Glomerular Inflammation in IgA Nephropathy (2006 - Beatrijs D. Oortwijn, Anja Roos, Louise Royle, Daniëlle J. van Gijlswijk-Janssen, Maria C. Faber-Krol, Jan-Willem Eijgenraam, Raymond A. Dwek, Mohamed R. Daha, Pauline M. Rudd, Cees van Kooten) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Transfection with fragments of the adenovirus 12 gene induces tumorigenicity-associated alteration of N-linked sugar chains in rat cells. (1990 - Hiraizumi S, Takasaki S, Shiroki K, Kochibe N, Kobata A) / Status : Reviewed
Reference
- Agrin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Attractin / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Calponin-3 / Homo sapiens
- Claudin domain-containing protein 1 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- High affinity cationic amino acid transporter 1 / Homo sapiens
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integral membrane protein DGCR2/IDD / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Neurexin-1 / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Protocadherin gamma-B1 / Homo sapiens
- Protocadherin gamma-B2 / Homo sapiens
- Protocadherin gamma-B4 / Homo sapiens
- Protocadherin gamma-B5 / Homo sapiens
- Protocadherin gamma-B7 / Homo sapiens
- Serine--tRNA ligase, cytoplasmic / Homo sapiens
- Teneurin-2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Translocating chain-associated membrane protein 1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
- Uromodulin / Homo sapiens
- Uroplakin-3b-like protein / Homo sapiens
- Vesicle-trafficking protein SEC22b / Homo sapiens
- Villin-1 / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
- Cell cycle control protein 50A / Mus musculus
- Isoform 2 of Acid-sensing ion channel 1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NSSDLNK (7aa)
- FECHFFNGTER (11aa)
- DIYTFDGAINK (11aa)
- FHAIHVSGTNGTKRF (15aa)
- KEDALNETR (9aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEDGSHTIQR (15aa)
- P30504 Asn-110 HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- P10321 Asn-110 HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- P30456 Asn-110 HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- P30453 Asn-110 HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- Q29865 Asn-110 HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- P30457 Asn-110 HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- P30450 Asn-110 HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- ANATLLLGPLR (11aa)
- TQSLLIVNNATNVVIK (16aa)
- NTTLFIDQVEAK (12aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- VGNDTHCQPTK (11aa)
- INGSIATFSTDQEIR (15aa)
- GWNWTSGFNK (10aa)
- ANNLSSLSK (9aa)
- ITIAINNTLTPTTLPPGTIQYLTDTSK (27aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- NPCTSEQNCTSPFSYK (16aa)
- GINESYK (7aa)
- FSDGIESNSSTQFEVK (16aa)
- NWQITEEDFGNTSGR (15aa)
- ITIQPVDNSTISIQMGTNK (19aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- IININPNK (8aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- AGKPTHVNVSV (11aa)
- FPNITNLCPFGE (12aa)
- KGTENGVNGTLTSNVADSPR (20aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- TCIMEASTDFLPGLNFSNCSR (21aa)
- ECADPALDFLVEKDQEYCVCEMPCNLTR (28aa)
- KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
- NATMCATTR (9aa)
- FNSTEYQVVTR (11aa)
- AIPQPQNVTSIIGCTH (16aa)
- ALMVLTEEPLLYIPPPPCQPLINTTESLR (29aa)
- VGYQSQNISCFFR (13aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- KENSSEICSNNGECVCGQCVCR (22aa)
- LFQVQGTGANNTK (13aa)
- DQGSPAISANVSIR (14aa)
- ADFGNHTK (8aa)
- MDGSINFNR (9aa)
- NCSFQPER (8aa)
- CINQSICEK (9aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- WTPINSSTIIGYR (13aa)
- SNQTLSLFFTVLQDVPVR (18aa)
- DNTTCYEFK (9aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- LGPYANTTK (9aa)
- MIEAYNITEK (10aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- NASLALSASIGR (12aa)
- ITSCATNASICGDEAR (16aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2047.8973)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- 3Y1-B clone 1 (CVCL_4563)
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Rattus norvegicus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Egg Cell
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
-
- N-Linked / Complex
(avg mass : 2047.8973)
-
Uncharacterized protein from Milk / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2047.8973)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- FPNITNLCPFGE (12aa)
-
- N-Linked / Complex
(avg mass : 2047.8973)
- Blood Serum (UBERON_0001977)
- Control/Healthy
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
- Hex:5 HexNAc:6 / N-Linked
(avg mass : 2047.8973)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-?)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[GalNAc(b1-4)GlcNAc(b1-6)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-6)[GalNAc(b1-4)GlcNAc(b1-2)]Man(a1-?)[Gal(b1-4)GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4)"
- N-Linked / Complex / Structure 2014
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x Gal(b1-4) + GalNAc(b1-4)"
- N-Linked / Complex / Structure 10012
- N-Linked / Complex / Structure 10189
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Agrin / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Attractin / Homo sapiens
- Beta-glucuronidase / Homo sapiens
- Calponin-3 / Homo sapiens
- Claudin domain-containing protein 1 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-3(VI) chain / Homo sapiens
- Complement c4-a / Homo sapiens
- Complement C4-B / Homo sapiens
- Cyclic AMP-dependent transcription factor ATF-6 alpha / Homo sapiens
- Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
- Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen alpha chain / Homo sapiens
- Fibronectin / Homo sapiens
- Folate receptor alpha / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Golgi membrane protein 1 / Homo sapiens
- Hemopexin / Homo sapiens
- High affinity cationic amino acid transporter 1 / Homo sapiens
- HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-1 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-10 beta chain / Homo sapiens
- HLA class II histocompatibility antigen, DRB1-9 beta chain / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integral membrane protein DGCR2/IDD / Homo sapiens
- Integrin beta-1 / Homo sapiens
- Intercellular adhesion molecule 2 / Homo sapiens
- Laminin subunit alpha-5 / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Mannosyl-oligosaccharide glucosidase / Homo sapiens
- Neurexin-1 / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Plexin-B2 / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Protocadherin gamma-B1 / Homo sapiens
- Protocadherin gamma-B2 / Homo sapiens
- Protocadherin gamma-B4 / Homo sapiens
- Protocadherin gamma-B5 / Homo sapiens
- Protocadherin gamma-B7 / Homo sapiens
- Serine--tRNA ligase, cytoplasmic / Homo sapiens
- Teneurin-2 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Translocating chain-associated membrane protein 1 / Homo sapiens
- Translocon-associated protein subunit alpha / Homo sapiens
- Uncharacterized family 31 glucosidase KIAA1161 / Homo sapiens
- Uromodulin / Homo sapiens
- Uroplakin-3b-like protein / Homo sapiens
- Vesicle-trafficking protein SEC22b / Homo sapiens
- Villin-1 / Homo sapiens
- Zymogen granule protein 16 homolog B / Homo sapiens
- Cell cycle control protein 50A / Mus musculus
- Isoform 2 of Acid-sensing ion channel 1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NSSDLNK (7aa)
- FECHFFNGTER (11aa)
- DIYTFDGAINK (11aa)
- FHAIHVSGTNGTKRF (15aa)
- KEDALNETR (9aa)
- TCDWIPKPNMSASCK (15aa)
- TFYWDFYTNR (10aa)
- AVIVNNITTGER (12aa)
- GYYNQSEDGSHTIQR (15aa)
- P30504 Asn-110 HLA class I histocompatibility antigen, Cw-4 alpha chain / Homo sapiens
- P10321 Asn-110 HLA class I histocompatibility antigen, Cw-7 alpha chain / Homo sapiens
- P30456 Asn-110 HLA class I histocompatibility antigen, A-43 alpha chain / Homo sapiens
- P30453 Asn-110 HLA class I histocompatibility antigen, A-34 alpha chain / Homo sapiens
- Q29865 Asn-110 HLA class I histocompatibility antigen, Cw-18 alpha chain / Homo sapiens
- P30457 Asn-110 HLA class I histocompatibility antigen, A-66 alpha chain / Homo sapiens
- P30450 Asn-110 HLA class I histocompatibility antigen, A-26 alpha chain / Homo sapiens
- ANATLLLGPLR (11aa)
- NTTLFIDQVEAK (12aa)
- YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
- VGNDTHCQPTK (11aa)
- INGSIATFSTDQEIR (15aa)
- GWNWTSGFNK (10aa)
- ANNLSSLSK (9aa)
- ITIAINNTLTPTTLPPGTIQYLTDTSK (27aa)
- SIGFEWNYPLEEPTTEPPVNLTYSANSPVGR (31aa)
- NPCTSEQNCTSPFSYK (16aa)
- GINESYK (7aa)
- FSDGIESNSSTQFEVK (16aa)
- NWQITEEDFGNTSGR (15aa)
- ITIQPVDNSTISIQMGTNK (19aa)
- KDNTTVTR (8aa)
- DPCSNVTCSFGSTCAR (16aa)
- IININPNK (8aa)
- GFSTQVLLGDVYQSPCTMAQRPQNFNSSAR (30aa)
- RDDLHPTLPAGQYFLNITYNYPVHSFDGR (29aa)
- ALIYQFSPIYTGNISSFQQ (19aa)
- AGKPTHVNVSV (11aa)
- KGTENGVNGTLTSNVADSPR (20aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- TCIMEASTDFLPGLNFSNCSR (21aa)
- ECADPALDFLVEKDQEYCVCEMPCNLTR (28aa)
- KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
- NATMCATTR (9aa)
- FNSTEYQVVTR (11aa)
- AIPQPQNVTSIIGCTH (16aa)
- ALMVLTEEPLLYIPPPPCQPLINTTESLR (29aa)
- VGYQSQNISCFFR (13aa)
- FALLMTNCYATPSSNATDPLK (21aa)
- KENSSEICSNNGECVCGQCVCR (22aa)
- LFQVQGTGANNTK (13aa)
- DQGSPAISANVSIR (14aa)
- ADFGNHTK (8aa)
- MDGSINFNR (9aa)
- NCSFQPER (8aa)
- CINQSICEK (9aa)
- NGTHWFVT (8aa)
- KYFKNHTS (8aa)
- WTPINSSTIIGYR (13aa)
- SNQTLSLFFTVLQDVPVR (18aa)
- DNTTCYEFK (9aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- LGPYANTTK (9aa)
- MIEAYNITEK (10aa)
- QIINAIQINNTAVGHAIVIPAGR (23aa)
- NASLALSASIGR (12aa)
- ITSCATNASICGDEAR (16aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:5 HexNAc:6 / N-Linked
(avg mass : 2047.8973)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2047.8973)
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2047.8973)
