taxonomy (24)
protein (102)
source (56)
structure (39)
composition (1)
disease (22)
reference (77)
site (137)
peptide (95)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Felis catus (Cat)
- Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
- Mus musculus (House mouse)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Rana palustris
- Rana pipiens (Northern leopard frog)
- Nicotiana alata (Persian tobacco)
- Gallus gallus (Chicken)
- Physomitrella patens
- Caenorhabditis elegans
- Trichinella spiralis
- Drosophila melanogaster (Fruit fly)
- Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
- Drosophila melanogaster (fdl mutant) (Fruit fly)
- Panulirus interruptus (California spiny lobster)
- Lupinus luteus (Yellow lupine)
- Marburg virus (strain musoke)
- Semliki forest virus
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Schistosoma mansoni
Taxonomy
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein D / Homo sapiens P05090
- Attractin / Homo sapiens O75882
- Calreticulin / Homo sapiens P27797
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Complement c3 / Homo sapiens P01024
- Decorin / Homo sapiens P07585
- Extracellular calcium-sensing receptor / Homo sapiens P41180
- Fibronectin / Homo sapiens P02751
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens O95479
- Glycoprotein rg / Homo sapiens
- Haptoglobin / Homo sapiens P00738
- Histone deacetylase complex subunit sap30 / Homo sapiens O75446
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Interferon gamma / Homo sapiens P01579
- Lactotransferrin / Homo sapiens P02788
- Latent transforming growth factor beta binding protein 1 / Homo sapiens Q14766
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Mammaglobin-A / Homo sapiens Q13296
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Membrane component, chromosome 17, surface marker 2 / Homo sapiens Q14596
- Muc1 fusion protein / Homo sapiens
- Multimerin-1 / Homo sapiens Q13201
- Nicalin / Homo sapiens Q969V3
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens Q96AY3
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Prosaposin / Homo sapiens P07602
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Recombinant Mucin-1 Muc1f/4tr / Homo sapiens P15941 Q99102
- Rhodopsin / Homo sapiens P08100
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Stabilin-1 / Homo sapiens Q9NY15
- T-cell surface glycoprotein cd4 / Homo sapiens P01730
- Translocon-associated protein subunit beta / Homo sapiens P43308
- Transmembrane protein 106B / Homo sapiens Q9NUM4
- Uncharacterized protein from Meconium / Homo sapiens
- Uncharacterized protein from Ovary / Homo sapiens
- Unspecified mucin / Homo sapiens
- Uromodulin / Homo sapiens P07911
- Zona pellucida sperm-binding protein 3 / Homo sapiens P21754
- Lactotransferrin / Bos taurus P24627
- Rhodopsin / Bos taurus P02699
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Immunoglobulin gamma / Felis catus
- Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus P56528
- Contactin-1 / Mus musculus P12960
- Contactin-associated protein-like 2 / Mus musculus Q9CPW0
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Immunoglobulin gamma-2a heavy chain / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Laminin subunit alpha-4 / Mus musculus P97927
- Laminin subunit gamma-1 / Mus musculus P02468
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Nicalin / Mus musculus Q8VCM8
- Plexin-B2 / Mus musculus B2RXS4
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Tenascin-r / Mus musculus Q8BYI9
- Zona pellucida sperm-binding protein 3 / Mus musculus P10761
- Mucin / Ovis aries
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Thy-1 membrane glycoprotein / Rattus norvegicus
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Mucin / Rana palustris
- Rhodopsin / Rana pipiens P31355
- Ribonuclease s-1 / Nicotiana alata
- Ribonuclease s-2 / Nicotiana alata P04007
- Ribonuclease s-3 / Nicotiana alata O24103
- Ribonuclease s-6 / Nicotiana alata Q40379
- Ribonuclease s-7 / Nicotiana alata Q40381
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein / Gallus gallus
- Uncharacterized protein / Physomitrella patens
- Uncharacterized protein / Caenorhabditis elegans
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Drosophila melanogaster
- Hemocyanin / Panulirus interruptus
- Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Spike glycoprotein e1 / Semliki forest virus P03315
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Circulating cathodic antigen / Schistosoma mansoni O02197
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Colon (UBERON_0001155)
- Embryo (UBERON_0000922)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Mammary Gland (UBERON_0001911)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Ovary (UBERON_0000992) OVCAR-3 (CVCL_0465)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Pituitary Gland (UBERON_0000007)
- Pulmonary Mucosa
- Retina (UBERON_0000966)
- Spleen (UBERON_0002106)
- Stomach (UBERON_0000945)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- Zona Pellucida (UBERON_0000086)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- BTI-Tn-5B1-4 (CVCL_C190)
- C10 (CVCL_5245)
- C6/36 (CVCL_Z230)
- FreeStyle 293-F (CVCL_D603)
- HCT 116 (CVCL_0291)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- LS180 (CVCL_0397)
- LS411N (CVCL_1385)
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- SPC-Mb-92-C6 (CVCL_VT62)
- SW1398 (CVCL_3885)
- SW480 (CVCL_0546)
- SW948 (CVCL_0632)
- T84 (CVCL_0555)
- Egg Cell
- Egg Cell Jelly Coat
- Leukocyte (CL_0000738)
- Neutrophil (CL_0000775)
- Seed (BTO_0001226)
- Style (BTO_0001313)
Source
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-2)"
- N-Linked / Complex / Structure 2843
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / Structure 10412
- N-Linked / Complex / Structure 10416
- N-Linked / Complex / Structure 10893
- N-Linked / Hybrid / Structure 9772
- N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / GlcNAc(b1-4)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc"
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11090
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-?)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc+"+ Gal"
- O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+ Gal"
- O-Linked / Core 2 / HexNAc(b1-?)Gal(b1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Structure 11030
- O-Linked / Core 2 / Structure 11073
- O-Linked / No-core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-3)GalNAc
- O-Linked / Undefined core / Gal(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]GalNAc
- O-Linked / Undefined core / Gal(b1-3)GalNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-?)"
Reported structure
- Hex:3 HexNAc:3 (avg mass : 1114.0275 )
Composition
- Adenocarcinoma (DOID:299)
- Bronchiectasis, due to Kartagener's Syndrome
- Cancer, breast (DOID:1612)
- Cancer, Ovarian (DOID:2394)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cecum adenocarcinoma (DOID:3039)
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Colorectal carcinoma (DOID:0080199)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Gangliosidosis GM1 (DOID:3322)
- Gangliosidosis GM2, Sandhoff Disease (DOID:3323)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Hypersensitivity reaction disease (DOID:0060056)
- Mixed phenotype acute leukemia (DOID:9953)
- Myeloma (DOID:0070004)
- Myeloma, Multiple (DOID:9538)
- Ovarian cyst (DOID:5119)
- Plasmacytoma (Mouse) (DOID:3721)
- Prostate cancer (DOID:10283)
Disease
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
- In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Structure and distribution of N-glycans on the S7-allele stylar self-incompatibility ribonuclease of Nicotiana alata. (1998 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Isolation and characterization of ovarian cancer antigen CA 125 using a new monoclonal antibody (VK-8): identification as a mucin-type molecule. (1997 - Lloyd K, Yin B, Kudryashov V) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
- Microheterogeneity of N-glycosylation on a stylar self-incompatibility glycoprotein of Nicotiana alata. (1995 - Oxley D, Bacic A) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Retinal GlcNAc-transferases and the glycosylation of rhodopsin. (1994 - Ju J, Kean E) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
- Structural analysis of the N-linked glycan chains from a stylar glycoprotein associated with expression of self-incompatibility in Nicotiana alata. (1992 - Woodward J, Craik D, Dell A, Khoo K, Munro S, Clarke A, Bacic A) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
- Primary structure of the neutral carbohydrate chains of hemocyanin from Panulirus interruptus (1986 - van Kuik J, Van Halbeek H, Kamerling J, Vliegenthart J) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Characterization and analysis of branched-chain N-acetylglucosaminyl oligosaccharides accumulating in Sandhoff disease tissue. Evidence that biantennary bisected oligosaccharide side chains of glycoproteins are abundant substrates for lysosomes. (1985 - Warner TG, deKremer RD, Sjoberg ER, Mock AK) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
- A new O-glycosidically linked tri-hexosamine core structure in sheep gastric mucin: a preliminary note. (1980 - Hounsell E, Fukuda M, Powell M, Feizi T, Hakomori S) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
- Rhodopsin carbohydrate. Structure of small oligosaccharides attached at two sites near the NH2 terminus (1979 - Fukuda M, Papermaster D, Hargrave P) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
Reference
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein D / Homo sapiens
- Attractin / Homo sapiens
- Calreticulin / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Extracellular calcium-sensing receptor / Homo sapiens
- Fibronectin / Homo sapiens
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
-
Glycoprotein rg / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Histone deacetylase complex subunit sap30 / Homo sapiens
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
- Lactotransferrin / Homo sapiens
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Mammaglobin-A / Homo sapiens
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Membrane component, chromosome 17, surface marker 2 / Homo sapiens
- Undefined site
-
Muc1 fusion protein / Homo sapiens
- Undefined site
- Multimerin-1 / Homo sapiens
- Nicalin / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Asn-80
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
- Stabilin-1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
- Uromodulin / Homo sapiens
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
- Lactotransferrin / Bos taurus
-
Rhodopsin / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
- Uncharacterized protein (gene name abca4) / Bos taurus
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Laminin subunit alpha-4 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Nicalin / Mus musculus
- Plexin-B2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
-
Tenascin-r / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
Mucin / Ovis aries
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Thy-1 membrane glycoprotein / Rattus norvegicus
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Mucin / Rana palustris
- Undefined site
- Rhodopsin / Rana pipiens
-
Ribonuclease s-1 / Nicotiana alata
- Undefined site
- Ribonuclease s-2 / Nicotiana alata
-
Ribonuclease s-3 / Nicotiana alata
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
- Ribonuclease s-7 / Nicotiana alata
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Hemocyanin / Panulirus interruptus
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
Reported glycosite
- QCVNLTTR (8aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- SNVTWF (6aa)
- CIQANYSIMENGK (13aa)
- RNESTQNCVVAEPEKM (16aa)
- YHYNGTFEDGK (11aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- HAIHVSGTNGTKR (13aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- IRNVSDTTKR (10aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
- SISNSTAR (8aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- LVTQTIPCNK (10aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- YHKNNKSWMESEF (13aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- NINSSCR (7aa)
- SSANNCTF (8aa)
- VYSSANNCTF (10aa)
- SSANNCTFEY (10aa)
- EQINITIDHR (10aa)
- GNYSCFVSSPSITK (14aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- KNLFLNHSENATAKD (15aa)
- GINIT (5aa)
- YQYVDCGRNTT (11aa)
- LAYATINDSR (10aa)
- ACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (66aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- VIYQNHNK (8aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- FPNITNLCPF (10aa)
- RFPNIT (6aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- VIYNITEK (8aa)
- VIYNLTEK (8aa)
- VGVHINNTQTK (11aa)
- FTNGSCADIK (10aa)
- FFPYANGTLSIR (12aa)
- GKANSTGTLVITNPTR (16aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- RHEEGHMINCTCFGQGR (17aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- LYQDVNCT (8aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMT (41aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIA (80aa)
- TNFTISVTTEILPVSMTK (18aa)
- NFTIS (5aa)
- LSHDGNETLPLHLYVK (16aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- FGGFNFS (7aa)
- RPASNISASIQR (12aa)
- KNFTTAPAICHDGK (14aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- HVTYVPAQEKNF (12aa)
- GVFVSNGTHWFVTQR (15aa)
- EGVFVSNGTHW (11aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (55aa)
- EGVFVSNGTHWFVTQRN (17aa)
- EGVFVSNGTHWF (12aa)
- AHFPREGVFVSNGT (14aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- TANETSAEAYNLLLR (15aa)
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
- Lactotransferrin / Bos taurus
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Blood Plasma (UBERON_0001969)
- Hemolymph (UBERON_0001011)
- Ovary (UBERON_0000992) IM4/V/IV-G1 (CVCL_VT68)
- Ovary (UBERON_0000992) IM4/V/IV-G4 (CVCL_VT71)
- Ovary (UBERON_0000992) IM4/V/IV-G5 (CVCL_VT72)
- Retina (UBERON_0000966)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- NS0 (CVCL_3940)
- P3X63Ag8U.1 (CVCL_3412)
- Style (BTO_0001313)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
- N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Structure and distribution of N-glycans on the S7-allele stylar self-incompatibility ribonuclease of Nicotiana alata. (1998 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
- Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
- Microheterogeneity of N-glycosylation on a stylar self-incompatibility glycoprotein of Nicotiana alata. (1995 - Oxley D, Bacic A) / Status : Reviewed
- Retinal GlcNAc-transferases and the glycosylation of rhodopsin. (1994 - Ju J, Kean E) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Structural analysis of the N-linked glycan chains from a stylar glycoprotein associated with expression of self-incompatibility in Nicotiana alata. (1992 - Woodward J, Craik D, Dell A, Khoo K, Munro S, Clarke A, Bacic A) / Status : Reviewed
- Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
- Primary structure of the neutral carbohydrate chains of hemocyanin from Panulirus interruptus (1986 - van Kuik J, Van Halbeek H, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
- Rhodopsin carbohydrate. Structure of small oligosaccharides attached at two sites near the NH2 terminus (1979 - Fukuda M, Papermaster D, Hargrave P) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Interferon gamma / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Serotransferrin / Homo sapiens
- Undefined site
-
Rhodopsin / Bos taurus
- Undefined site
-
Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
- Undefined site
-
Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
- Undefined site
-
Immunoglobulin gamma-2a heavy chain / Mus musculus
- Undefined site
- Rhodopsin / Rana pipiens
-
Ribonuclease s-1 / Nicotiana alata
- Undefined site
- Ribonuclease s-2 / Nicotiana alata
-
Ribonuclease s-3 / Nicotiana alata
- Undefined site
-
Ribonuclease s-6 / Nicotiana alata
- Undefined site
- Ribonuclease s-7 / Nicotiana alata
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Hemocyanin / Panulirus interruptus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Spleen (UBERON_0002106)
- Seed (BTO_0001226)
- Gaucher Disease (DOID:1926)
- Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
- Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
- Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Uncharacterized protein / Caenorhabditis elegans
- Undefined site
-
Uncharacterized protein / Drosophila melanogaster
- Undefined site
-
Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
-
Uncharacterized protein / Physomitrella patens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992)
- BTI-Tn-5B1-4 (CVCL_C190) Egg Cell
- Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Latent transforming growth factor beta binding protein 1 / Homo sapiens
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Thy-1 membrane glycoprotein / Rattus norvegicus
- Undefined site
- CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Liver (UBERON_0002107)
- Gangliosidosis GM1 (DOID:3322)
-
Prosaposin / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- COVID-19 (DOID:0080600)
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RNESTQNCVVAEPEKM (16aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KNLFLNHSENATAKD (15aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Blood Plasma (UBERON_0001969)
- Egg Cell
- Myeloma, Multiple (DOID:9538)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Ascitic fluid (UBERON_0007795)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Colon (UBERON_0001155)
- LS174T (CVCL_1384)
- Colon adenocarcinoma (DOID:234)
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1114.0275)
- Blood Plasma (UBERON_0001969)
- Myeloma, Multiple (DOID:9538)
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1114.0275)
- Embryo (UBERON_0000922)
-
- N-Linked / No-core
(avg mass : 1114.0275)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
-
T-cell surface glycoprotein cd4 / Homo sapiens
- Undefined site
-
- N-Linked / No-core
(avg mass : 1114.0275)
- Brain (UBERON_0000955)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107)
- Lung (UBERON_0002048)
- Pancreas (UBERON_0001264)
- Spleen (UBERON_0002106)
-
- N-Linked / Pauci-Mannose
(avg mass : 1114.0275)
- Brain (UBERON_0000955)
- Egg Cell
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
-
Tenascin-r / Mus musculus
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
- N-Linked / Pauci-Mannose
(avg mass : 1114.0275)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
- Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
-
Immunoglobulin epsilon chain c region / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Spike glycoprotein e1 / Semliki forest virus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VFNATR (6aa)
- DFGGFNFSQILPDPSKPSK (19aa)
- KNFTTAPAICHDGK (14aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Egg Cell Jelly Coat
-
Mucin / Rana palustris
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Ovary (UBERON_0000992)
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
- Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Uncharacterized protein from Ovary / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Ovary (UBERON_0000992)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Meconium (UBERON_0007109)
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Colon adenocarcinoma (DOID:234)
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Unreviewed
- Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
- O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Meconium (UBERON_0007109)
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
- O-Linked / Core 1
(avg mass : 1114.0275)
- Cecum adenocarcinoma (DOID:3039)
- Colon adenocarcinoma (DOID:234)
- Colorectal carcinoma (DOID:0080199)
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) OVCAR-3 (CVCL_0465)
- Pulmonary Mucosa
- Isolation and characterization of ovarian cancer antigen CA 125 using a new monoclonal antibody (VK-8): identification as a mucin-type molecule. (1997 - Lloyd K, Yin B, Kudryashov V) / Status : Reviewed
- The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Membrane component, chromosome 17, surface marker 2 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Circulating cathodic antigen / Schistosoma mansoni
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Bone Marrow (UBERON_0002371)
- Meconium (UBERON_0007109)
- Zona Pellucida (UBERON_0000086)
- Leukocyte (CL_0000738)
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
- Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
- Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Kidney (UBERON_0002113)
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Cancer, breast (DOID:1612)
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Mammary Gland (UBERON_0001911) MCF-7 (CVCL_0031)
- Mammary Gland (UBERON_0001911) ZR-75-1 (CVCL_0588)
- Cancer, breast (DOID:1612)
-
Muc1 fusion protein / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- Zona Pellucida (UBERON_0000086)
-
Zona pellucida sperm-binding protein 3 / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 3 / Mus musculus
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1114.0275)
- C10 (CVCL_5245)
- Colon adenocarcinoma (DOID:234)
-
- O-Linked / Core 2
(avg mass : 1114.0275)
-
- O-Linked / No-core
(avg mass : 1114.0275)
- Colon (UBERON_0001155) LS174T (CVCL_1384)
- Adenocarcinoma (DOID:299)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1114.0275)
- Stomach (UBERON_0000945)
-
Mucin / Ovis aries
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 1114.0275)
- Colon (UBERON_0001155) Caco-2 (CVCL_0025)
- Adenocarcinoma (DOID:299)
-
Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:3 / N-Linked
(avg mass : 1114.0275)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Retina (UBERON_0000966)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-2)"
- N-Linked / Complex / Structure 2843
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / Structure 10412
- N-Linked / Complex / Structure 10416
- N-Linked / Complex / Structure 10893
- N-Linked / Hybrid / Structure 9772
- N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / GlcNAc(b1-4)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc"
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Apolipoprotein D / Homo sapiens
- Attractin / Homo sapiens
- Calreticulin / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Extracellular calcium-sensing receptor / Homo sapiens
- Fibronectin / Homo sapiens
- GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
- Histone deacetylase complex subunit sap30 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Mammaglobin-A / Homo sapiens
- Multimerin-1 / Homo sapiens
- Nicalin / Homo sapiens
- Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
- Periostin / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Serpin h1 / Homo sapiens
- Stabilin-1 / Homo sapiens
- Translocon-associated protein subunit beta / Homo sapiens
- Transmembrane protein 106B / Homo sapiens
- Uromodulin / Homo sapiens
- Uncharacterized protein (gene name abca4) / Bos taurus
- ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
- Contactin-1 / Mus musculus
- Contactin-associated protein-like 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Laminin subunit alpha-4 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Nicalin / Mus musculus
- Plexin-B2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- ELLQEFIDDNATTNAIDELK (20aa)
- FSNVTWF (7aa)
- FSNVTW (6aa)
- SNVTWF (6aa)
- CIQANYSIMENGK (13aa)
- YHYNGTFEDGK (11aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- HAIHVSGTNGTKR (13aa)
- DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
- TVLTPATNHMGNVTFTIPANR (21aa)
- IRNVSDTTKR (10aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
- SISNSTAR (8aa)
- LIVNNATNVVIK (12aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- LVTQTIPCNK (10aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- YHKNNKSWMESEF (13aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- NINSSCR (7aa)
- SSANNCTF (8aa)
- VYSSANNCTF (10aa)
- SSANNCTFEY (10aa)
- EQINITIDHR (10aa)
- GNYSCFVSSPSITK (14aa)
- FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- GINIT (5aa)
- YQYVDCGRNTT (11aa)
- LAYATINDSR (10aa)
- ACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (66aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- VIYQNHNK (8aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
- FPNITNLCPF (10aa)
- RFPNIT (6aa)
- GEVFNATR (8aa)
- CPFGEVFNATR (11aa)
- SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
- VIYNITEK (8aa)
- VIYNLTEK (8aa)
- VGVHINNTQTK (11aa)
- FTNGSCADIK (10aa)
- FFPYANGTLSIR (12aa)
- GKANSTGTLVITNPTR (16aa)
- RHEEGHMINCTCFGQGR (17aa)
- YIDKGNR (7aa)
- EVNDTLLVNELK (12aa)
- FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
- QDVNCTEVPVAIHADQLTPTWR (22aa)
- LYQDVNCT (8aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMT (41aa)
- IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIA (80aa)
- TNFTISVTTEILPVSMTK (18aa)
- NFTIS (5aa)
- LSHDGNETLPLHLYVK (16aa)
- DFGGFNF (7aa)
- NFSQILPDPSK (11aa)
- FGGFNFS (7aa)
- RPASNISASIQR (12aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- HVTYVPAQEKNF (12aa)
- EGVFVSNGTHW (11aa)
- AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (55aa)
- EGVFVSNGTHWFVTQRN (17aa)
- EGVFVSNGTHWF (12aa)
- AHFPREGVFVSNGT (14aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- NHTSPDVDLGDISGINASVVNIQK (24aa)
- TANETSAEAYNLLLR (15aa)
-
- Hex:3 HexNAc:3 / O-Linked
(avg mass : 1114.0275)
- O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
- O-Linked / Core 1 / Structure 11090
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-?)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc+"+ Gal"
- O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+ Gal"
- O-Linked / Core 2 / HexNAc(b1-?)Gal(b1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Structure 11030
- O-Linked / Core 2 / Structure 11073
- O-Linked / No-core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-3)GalNAc
- O-Linked / Undefined core / Gal(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]GalNAc
- O-Linked / Undefined core / Gal(b1-3)GalNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-?)"
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Uromodulin / Homo sapiens
Suggested structure
Disease
Reference
Reported glycosite
- Hex:3 HexNAc:3 / O-Linked
(avg mass : 1114.0275)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:3 / N-Linked
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1114.0275)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- O-Linked / No-core
(avg mass : 1114.0275)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Source
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Disease
Reference
Reported glycosite
- O-Linked / Core 2
(avg mass : 1114.0275)
Disease
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Source
Reference
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Source
Reported glycosite
- O-Linked / Core 1
(avg mass : 1114.0275)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Pauci-Mannose
(avg mass : 1114.0275)
Source
Reference
Reported glycosite
- N-Linked / Pauci-Mannose
(avg mass : 1114.0275)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1114.0275)
Source
Reported glycosite
- N-Linked / No-core
(avg mass : 1114.0275)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1114.0275)