Hex:3 HexNAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Felis catus (Cat)
• Hybrid - homo sapiens/mus musculus (Hybrid - human/mouse)
• Mus musculus (House mouse)
• Ovis aries (Sheep)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Rana palustris
• Rana pipiens (Northern leopard frog)
• Nicotiana alata (Persian tobacco)
• Gallus gallus (Chicken)
• Physomitrella patens
• Caenorhabditis elegans
• Trichinella spiralis
• Drosophila melanogaster (Fruit fly)
• Drosophila melanogaster (Df(2R)achi2 mutant) (Fruit fly)
• Drosophila melanogaster (fdl mutant) (Fruit fly)
• Panulirus interruptus (California spiny lobster)
• Lupinus luteus (Yellow lupine)
• Marburg virus (strain musoke)
• Semliki forest virus
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• Schistosoma mansoni

Protein

• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Attractin / Homo sapiens    O75882
• Calreticulin / Homo sapiens    P27797
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Complement c3 / Homo sapiens    P01024
• Decorin / Homo sapiens    P07585
• Extracellular calcium-sensing receptor / Homo sapiens    P41180
• Fibronectin / Homo sapiens    P02751
• GDH/6PGL endoplasmic bifunctional protein / Homo sapiens    O95479
• Glycoprotein rg / Homo sapiens    
• Haptoglobin / Homo sapiens    P00738
• Histone deacetylase complex subunit sap30 / Homo sapiens    O75446
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Immunoglobulin gamma / Homo sapiens    P01859    P01861    P01857    P01860
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Interferon gamma / Homo sapiens    P01579
• Lactotransferrin / Homo sapiens    P02788
• Latent transforming growth factor beta binding protein 1 / Homo sapiens    Q14766
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Mammaglobin-A / Homo sapiens    Q13296
• Matrix metalloproteinase-9 / Homo sapiens    P14780
• Membrane component, chromosome 17, surface marker 2 / Homo sapiens    Q14596
• Muc1 fusion protein / Homo sapiens    
• Multimerin-1 / Homo sapiens    Q13201
• Nicalin / Homo sapiens    Q969V3
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Periostin / Homo sapiens    Q15063
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Prosaposin / Homo sapiens    P07602
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens    P15941    Q99102
• Rhodopsin / Homo sapiens    P08100
• Serotransferrin / Homo sapiens    P02787
• Serpin h1 / Homo sapiens    P50454
• Stabilin-1 / Homo sapiens    Q9NY15
• T-cell surface glycoprotein cd4 / Homo sapiens    P01730
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane protein 106B / Homo sapiens    Q9NUM4
• Uncharacterized protein from Meconium / Homo sapiens    
• Uncharacterized protein from Ovary / Homo sapiens    
• Unspecified mucin / Homo sapiens    
• Uromodulin / Homo sapiens    P07911
• Zona pellucida sperm-binding protein 3 / Homo sapiens    P21754
• Lactotransferrin / Bos taurus    P24627
• Rhodopsin / Bos taurus    P02699
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Immunoglobulin gamma / Felis catus    
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus    
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus    P56528
• Contactin-1 / Mus musculus    P12960
• Contactin-associated protein-like 2 / Mus musculus    Q9CPW0
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus    
• Immunoglobulin gamma-2a heavy chain / Mus musculus    
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Laminin subunit alpha-4 / Mus musculus    P97927
• Laminin subunit gamma-1 / Mus musculus    P02468
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Nicalin / Mus musculus    Q8VCM8
• Plexin-B2 / Mus musculus    B2RXS4
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Tenascin-r / Mus musculus    Q8BYI9
• Zona pellucida sperm-binding protein 3 / Mus musculus    P10761
• Mucin / Ovis aries    
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Thy-1 membrane glycoprotein / Rattus norvegicus    
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa    
• Mucin / Rana palustris    
• Rhodopsin / Rana pipiens    P31355
• Ribonuclease s-1 / Nicotiana alata    
• Ribonuclease s-2 / Nicotiana alata    P04007
• Ribonuclease s-3 / Nicotiana alata    O24103
• Ribonuclease s-6 / Nicotiana alata    Q40379
• Ribonuclease s-7 / Nicotiana alata    Q40381
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Uncharacterized protein / Physomitrella patens    
• Uncharacterized protein / Caenorhabditis elegans    
• Tsl-1 antigens / Trichinella spiralis    
• Uncharacterized protein / Drosophila melanogaster    
• Hemocyanin / Panulirus interruptus    
• Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus    
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Spike glycoprotein e1 / Semliki forest virus    P03315
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Circulating cathodic antigen / Schistosoma mansoni    O02197

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)   Caco-2 (CVCL_0025)  
• Colon (UBERON_0001155)   LS174T (CVCL_1384)  
• Colon (UBERON_0001155)  
• Embryo (UBERON_0000922)  
• Hemolymph (UBERON_0001011)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)  
• Lung (UBERON_0002048)  
• Mammary Gland (UBERON_0001911)   MCF-7 (CVCL_0031)  
• Mammary Gland (UBERON_0001911)   ZR-75-1 (CVCL_0588)  
• Mammary Gland (UBERON_0001911)  
• Meconium (UBERON_0007109)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Ovary (UBERON_0000992)   OVCAR-3 (CVCL_0465)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Pituitary Gland (UBERON_0000007)  
• Pulmonary Mucosa  
• Retina (UBERON_0000966)  
• Spleen (UBERON_0002106)  
• Stomach (UBERON_0000945)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• Zona Pellucida (UBERON_0000086)  
• BTI-Tn-5B1-4 (CVCL_C190)   Egg Cell  
• BTI-Tn-5B1-4 (CVCL_C190)  
• C6/36 (CVCL_Z230)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• LS174T (CVCL_1384)  
• NS0 (CVCL_3940)  
• P3X63Ag8U.1 (CVCL_3412)  
• SPC-Mb-92-C6 (CVCL_VT62)  
• Egg Cell  
• Egg Cell   Jelly Coat  
• Leukocyte (CL_0000738)  
• Neutrophil (CL_0000775)  
• Seed (BTO_0001226)  
• Style (BTO_0001313)  

Reported structure

• N-Linked / Complex / GlcNAc(?1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-4)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-6)Man(a1-6)[Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-?)Man(a1-?)[Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-2)"
• N-Linked / Complex / Structure 2843
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc(b1-?)"
• N-Linked / Complex / Structure 10412
• N-Linked / Complex / Structure 10416
• N-Linked / Complex / Structure 10893
• N-Linked / Hybrid / Structure 9772
• N-Linked / No-core / Gal(b1-?)GlcNAc(b1-?)Man(a1-?)Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / No-core / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc
• N-Linked / Pauci-Mannose / GlcNAc(b1-4)[Man(a1-3)][Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Pauci-Mannose / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GlcNAc"
• O-Linked / Core 1 / Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc(a1-4)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 1 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-?)GlcNAc(b1-3)Gal(b1-3)GalNAc
• O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-?)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-3)[Gal(b1-4)GlcNAc(b1-6)]GalNAc+"+ Gal"
• O-Linked / Core 2 / GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc+"+ Gal"
• O-Linked / Core 2 / HexNAc(b1-?)Gal(b1-3)[Gal(a1-3)Gal(b1-4)GlcNAc(b1-6)]GalNAc
• O-Linked / No-core / Gal(?1-?)GlcNAc(?1-?)[Gal(?1-?)GlcNAc(?1-?)]Gal(?1-3)GalNAc
• O-Linked / Undefined core / Gal(b1-3)Gal(b1-4)GlcNAc(b1-?)[Gal(b1-4)GlcNAc(b1-?)]GalNAc
• O-Linked / Undefined core / Gal(b1-3)GalNAc+"+ 2 x Gal(b1-4)GlcNAc(b1-?)"

Composition

• Hex:3 HexNAc:3 (avg mass : 1114.0275 )

Disease

• Adenocarcinoma (DOID:299)
• Bronchiectasis, due to Kartagener's Syndrome
• Cancer, breast (DOID:1612)
• Cancer, Ovarian (DOID:2394)
• Cancer, Ovarian (Cystic) (DOID:2394)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Gangliosidosis GM1 (DOID:3322)
• Gangliosidosis GM2, Sandhoff Disease (DOID:3323)
• Gastritis (DOID:4029)
• Gaucher Disease (DOID:1926)
• Hypersensitivity reaction disease (DOID:0060056)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma (DOID:0070004)
• Myeloma, Multiple (DOID:9538)
• Ovarian cyst (DOID:5119)
• Plasmacytoma (Mouse) (DOID:3721)
• Prostate cancer (DOID:10283)

Reference

• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
• Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Automated assignments of N- and O-site specific glycosylation with extensive glycan heterogeneity of glycoprotein mixtures (2013 - Strum JS1, Nwosu CC, Hua S, Kronewitter SR, Seipert RR, Bachelor RJ, An HJ, Lebrilla CB) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• The Drosophila fused lobes gene encodes an N-acetylglucosaminidase involved in N-glycan processing. (2006 - Renaud Léonard, Dubravko Rendic, Catherine Rabouille, Iain B H Wilson, Thomas Préat, Friedrich Altmann) / Status : Reviewed
• Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
• The Glycosylation of Human Serum IgD and IgE and the Accessibility of Identified Oligomannose Structures for Interaction with Mannan-Binding Lectin (2004 - James N. Arnold, Catherine M. Radcliffe, Mark R. Wormald, Louise Royle, David J. Harvey, Max Crispin, Raymond A. Dwek, Robert B. Sim and Pauline M. Rudd) / Status : Reviewed
• Protein N-glycosylation is similar in the moss Physcomitrella patens and in higher plants. (2003 - Vietor R, Loutelier-Bourhis C, Fitchette AC, Margerie P, Gonneau M, Faye L, Lerouge P) / Status : Reviewed
• Murine and human zona pellucida 3 derived from mouse eggs express identical O-glycans. (2003 - Dell A, Chalabi S, Easton RL, Haslam SM, Sutton-Smith M, Patankar MS, Lattanzio F, Panico M, Morris HR, Clark GF) / Status : Reviewed
• Structural analysis of N-linked glycans in Caenorhabditis elegans (2002 - Natsuka S, Adachi J, Kawaguchi M, Nakakita S, Hase S, Ichikawa A, Ikura K) / Status : Reviewed
• Recombinant MUC1 probe authentically reflects cell-specific O-glycosylation profiles of endogenous breast cancer mucin. High density and prevalent core 2-based glycosylation. (2002 - Muller S, Hanisch FG) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Neutralization of pH in the Golgi apparatus causes redistribution of glycosyltransferases and changes in the O-glycosylation of mucins. (2001 - Axelsson M, Karlsson N, Steel D, Ouwendijk J, Nilsson T, Hansson G) / Status : Reviewed
• In vivo glycosylation of mucin tandem repeats (2001 - Silverman, Parry, Sutton-Smith, Burdick, McDermott, Reid, Batra, Morris, Hollingsworth, Dell, Harris) / Status : Reviewed
• Identification of core alpha 1,3-fucosylated glycans and cloning of the requisite fucosyltransferase cDNA from Drosophila melanogaster. Potential basis of the neural anti-horseradish peroxidase epitope. (2001 - Fabini G, Freilinger A, Altmann F, Wilson I) / Status : Reviewed
• Hybrid and complex glycans are linked to the conserved N-glycosylation site of the third eight-cysteine domain of LTBP-1 in insect cells. (2000 - Rudd P, Downing A, Cadene M, Harvey D, Wormald M, Weir I, Dwek R, Rifkin D, Gleizes P) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
• Structural analysis of N-glycans from yellow lupin (Lupinus luteus) seed diphosphonucleotide phosphatase/phosphodiesterase. (2000 - Olczak M, Watorek W) / Status : Reviewed
• N-glycan patterns of human transferrin produced in Trichoplusia ni insect cells: effects of mammalian galactosyltransferase. (2000 - Ailor E, Takahashi N, Tsukamoto Y, Masuda K, Rahman B, Jarvis D, Lee Y, Betenbaugh M) / Status : Reviewed
• Structural analysis of 20 oligosaccharide-alditols released from the jelly coat of Rana palustris eggs by reductive beta-elimination characterization of the polymerized sequence [Gal(beta1, 3)GalNAc(alpha1-4)]n. (1999 - Maes E, Florea D, Coppin A, Strecker G) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Structure and distribution of N-glycans on the S7-allele stylar self-incompatibility ribonuclease of Nicotiana alata. (1998 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
• Structural study of the O-linked sugar chains of human leukocyte tyrosine phosphatase CD45. (1998 - Furukawa K, Funakoshi Y, Autero M, Horejsi V, Kobata A, Gahmberg C) / Status : Reviewed
• Isolation and characterization of ovarian cancer antigen CA 125 using a new monoclonal antibody (VK-8): identification as a mucin-type molecule. (1997 - Lloyd K, Yin B, Kudryashov V) / Status : Reviewed
• Differential N-glycan patterns of secreted and intracellular IgG produced in Trichoplusia ni cells. (1997 - Hsu T, Takahashi N, Tsukamoto Y, Kato K, Shimada I, Masuda K, Whiteley E, Fan J, Lee Y, Betenbaugh M) / Status : Reviewed
• Microheterogeneity of the oligosaccharides carried by the recombinant bovine lactoferrin expressed in Mamestra brassicae cells. (1997 - Lopez M, Coddeville B, Langridge J, Plancke Y, Sautire P, Chaabihi H, Chirat F, Harduin-Lepers A, Cerutti M, Verbert A, Delannoy P) / Status : Reviewed
• Structure of N-glycans on the S3- and S6-allele stylar self-incompatibility ribonucleases of Nicotiana alata. (1996 - Oxley D, Munro S, Craik D, Bacic A) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Microheterogeneity of N-glycosylation on a stylar self-incompatibility glycoprotein of Nicotiana alata. (1995 - Oxley D, Bacic A) / Status : Reviewed
• Structural characterization of the N-glycans of a humanized anti-CD18 murine immunoglobulin G. (1994 - Ip C, Miller W, Silberklang M, Mark G, Ellis R, Huang L, Glushka J, Van Halbeek H, Zhu J, Alhadeff J) / Status : Reviewed
• Structure of the O-linked carbohydrate chains of porcine zona pellucida glycoproteins. (1994 - Hokke C, Damm J, Penninkhof B, Aitken R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Retinal GlcNAc-transferases and the glycosylation of rhodopsin. (1994 - Ju J, Kean E) / Status : Reviewed
• The immunologically reactive O-linked polysaccharide chains derived from circulating cathodic antigen isolated from the human blood fluke Schistosoma mansoni have Lewis x as repeating unit. (1994 - van Dam G, Bergwerff A, Thomas-Oates J, Rotmans J, Kamerling J, Vliegenthart J, Deelder A) / Status : Reviewed
• O-linked neutral sugar chains of porcine zona pellucida glycoproteins. (1993 - Hirano T, Takasaki S, Hedrick J, Wardrip N, Amano J, Kobata A) / Status : Reviewed
• Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Asparagine-linked oligosaccharides of Semliki Forest virus grown in mosquito cells. (1992 - Naim HY, Koblet H) / Status : Reviewed
• Structural analysis of the N-linked glycan chains from a stylar glycoprotein associated with expression of self-incompatibility in Nicotiana alata. (1992 - Woodward J, Craik D, Dell A, Khoo K, Munro S, Clarke A, Bacic A) / Status : Reviewed
• Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
• Characterisation of minor tetra- to hepta-saccharides O-linked to human meconium glycoproteins by t.l.c.-m.s. microsequencing of neoglycolipid derivatives in conjunction with conventional m.s. and 1H-n.m.r. spectroscopy. (1991 - Lawson A, Hounsell E, Stoll M, Feeney J, Chai W, Rosankiewicz J, Feizi T) / Status : Reviewed
• Structural study of the sugar moieties of monoclonal antibodies secreted by human-mouse hybridoma. (1991 - Tandai M, Endo T, Sasaki S, Masuho Y, Kochibe N, Kobata A) / Status : Reviewed
• The spectrum of N-linked oligosaccharide structures detected by enzymic microsequencing on a recombinant soluble CD4 glycoprotein from Chinese hamster ovary cells. (1990 - Yuen C, Carr S, Feizi T) / Status : Reviewed
• Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
• Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 1. Structure of 16 oligosaccharides having the Gal beta(1---3)GalNAc-ol cor (1988 - Klein A, Lamblin G, Lhermitte M, Roussel P, Breg J, Van Halbeek H, Vliegenthart J) / Status : Reviewed
• Primary structure of the neutral carbohydrate chains of hemocyanin from Panulirus interruptus (1986 - van Kuik J, Van Halbeek H, Kamerling J, Vliegenthart J) / Status : Reviewed
• Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
• Characterization and analysis of branched-chain N-acetylglucosaminyl oligosaccharides accumulating in Sandhoff disease tissue. Evidence that biantennary bisected oligosaccharide side chains of glycoproteins are abundant substrates for lysosomes. (1985 - Warner TG, deKremer RD, Sjoberg ER, Mock AK) / Status : Reviewed
• Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
• A new O-glycosidically linked tri-hexosamine core structure in sheep gastric mucin: a preliminary note. (1980 - Hounsell E, Fukuda M, Powell M, Feizi T, Hakomori S) / Status : Reviewed
• Structure of the carbohydrate moieties of bovine rhodopsin (1979 - Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A) / Status : Reviewed
• Rhodopsin carbohydrate. Structure of small oligosaccharides attached at two sites near the NH2 terminus (1979 - Fukuda M, Papermaster D, Hargrave P) / Status : Reviewed
• Structures of oligosaccharides produced by base--borohydride degradation of human ovarian cyst blood group H, Le-b and Le-a active glycoproteins. (1973 - Rovis L, Anderson B, Kabat E, Gruenzo F, Liao J) / Status : Reviewed

Reported glycosite

• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Attractin / Homo sapiens
  •        Asn-325
• Calreticulin / Homo sapiens
  •        Asn-344
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Complement c3 / Homo sapiens
  •        Asn-85
• Decorin / Homo sapiens
  •        Asn-211
• Extracellular calcium-sensing receptor / Homo sapiens
  •        Asn-446
• Fibronectin / Homo sapiens
  •        Asn-542
• GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
  •        Asn-157
• Glycoprotein rg / Homo sapiens
  •        Undefined site
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-207
  •        Asn-211
• Histone deacetylase complex subunit sap30 / Homo sapiens
  •        Asn-209
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Ser-105
  •        Asn-144
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-131
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
• Interferon gamma / Homo sapiens
  •        Undefined site
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Latent transforming growth factor beta binding protein 1 / Homo sapiens
  •        Asn-1366
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-390
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Matrix metalloproteinase-9 / Homo sapiens
  •        Undefined site
• Membrane component, chromosome 17, surface marker 2 / Homo sapiens
  •        Undefined site
• Muc1 fusion protein / Homo sapiens
  •        Undefined site
• Multimerin-1 / Homo sapiens
  •        Asn-344
• Nicalin / Homo sapiens
  •        Asn-428
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
  •        Asn-70
• Periostin / Homo sapiens
  •        Asn-599
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-197
• Prosaposin / Homo sapiens
  •        Undefined site
  •        Asn-80
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Recombinant Mucin-1 Muc1f/4tr / Homo sapiens
  •        Undefined site
• Rhodopsin / Homo sapiens
  •        Undefined site
• Serotransferrin / Homo sapiens
  •        Undefined site
• Serpin h1 / Homo sapiens
  •        Asn-120
• Stabilin-1 / Homo sapiens
  •        Asn-606
• T-cell surface glycoprotein cd4 / Homo sapiens
  •        Undefined site
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-104
• Transmembrane protein 106B / Homo sapiens
  •        Asn-256
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Ovary / Homo sapiens
  •        Undefined site
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Uromodulin / Homo sapiens
  •        Ser-252
  •        Asn-275
  •        Thr-296
• Zona pellucida sperm-binding protein 3 / Homo sapiens
  •        Undefined site
• Lactotransferrin / Bos taurus
  •        Asn-495
• Rhodopsin / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein (gene name abca4) / Bos taurus
  •        Asn-1455
• Immunoglobulin gamma / Felis catus
  •        Undefined site
• Immunoglobulin gamma-2 (p8-4 antibody) / Hybrid - homo sapiens/mus musculus
  •        Undefined site
• ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
  •        Asn-124
• Contactin-1 / Mus musculus
  •        Asn-208
  •        Asn-494
• Contactin-associated protein-like 2 / Mus musculus
  •        Asn-436
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
• Humanized anti-cd18 murine immunoglobulin g4 (mab 1b4) / Mus musculus
  •        Undefined site
• Immunoglobulin gamma-2a heavy chain / Mus musculus
  •        Undefined site
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-580
• Laminin subunit alpha-4 / Mus musculus
  •        Asn-803
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1203
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
  •        Asn-478
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-613
• Nicalin / Mus musculus
  •        Asn-428
• Plexin-B2 / Mus musculus
  •        Asn-735
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-92
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-153
• Tenascin-r / Mus musculus
  •        Undefined site
• Zona pellucida sperm-binding protein 3 / Mus musculus
  •        Undefined site
• Mucin / Ovis aries
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Thy-1 membrane glycoprotein / Rattus norvegicus
  •        Undefined site
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Mucin / Rana palustris
  •        Undefined site
• Rhodopsin / Rana pipiens
  •        Asn-15
• Ribonuclease s-1 / Nicotiana alata
  •        Undefined site
• Ribonuclease s-2 / Nicotiana alata
  •        Asn-49
• Ribonuclease s-3 / Nicotiana alata
  •        Undefined site
• Ribonuclease s-6 / Nicotiana alata
  •        Undefined site
• Ribonuclease s-7 / Nicotiana alata
  •        Asn-49
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Physomitrella patens
  •        Undefined site
• Uncharacterized protein / Caenorhabditis elegans
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein / Drosophila melanogaster
  •        Undefined site
• Hemocyanin / Panulirus interruptus
  •        Undefined site
• Diphosphonucleotide phosphatase / phosphodiesterase / Lupinus luteus
  •        Undefined site
• Structural glycoprotein / Marburg virus (strain musoke)
  •        Undefined site
• Spike glycoprotein e1 / Semliki forest virus
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-165
  •        Asn-331
  •        Asn-343
  •        Asn-615
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1159
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-717
  •        Asn-1098
• Circulating cathodic antigen / Schistosoma mansoni
  •        Undefined site

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FSNVTW (6aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SNVTWF (6aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• RNESTQNCVVAEPEKM (16aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• YHYNGTFEDGK (11aa)
  •    Q96AY3    Asn-70     Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTK (13aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HAIHVSGTNGTKR (13aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DVVTAAGDMIKDNATEEEIIVYIEK (25aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
• TVLTPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• IRNVSDTTKR (10aa)
  •    P97797    Asn-92     Signal-regulatory protein alpha / Mus musculus
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104     Translocon-associated protein subunit beta / Homo sapiens
• HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR (38aa)
  •    P01876    Ser-105     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• SISNSTAR (8aa)
  •    P50454    Asn-120     Serpin h1 / Homo sapiens
• LIVNNATNVVIK (12aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LVTQTIPCNK (10aa)
  •    P56528    Asn-124     ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 / Mus musculus
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RACQFNR (7aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• ACQFNR (6aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• NINSSCR (7aa)
  •    O95479    Asn-157     GDH/6PGL endoplasmic bifunctional protein / Homo sapiens
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VYSSANNCTF (10aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EQINITIDHR (10aa)
  •    Q02809    Asn-197     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
• GNYSCFVSSPSITK (14aa)
  •    P12960    Asn-208     Contactin-1 / Mus musculus
• FVSQTNGNLYIANVESSDRGNYSCFVSSPSITK (33aa)
  •    P12960    Asn-208     Contactin-1 / Mus musculus
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• GINIT (5aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YQYVDCGRNTT (11aa)
  •    Q9NUM4    Asn-256     Transmembrane protein 106B / Homo sapiens
• LAYATINDSR (10aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• ACAHWSGHCCLWDASVQVKACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (66aa)
  •    P07911    Asn-275     Uromodulin / Homo sapiens
  •    P07911    Ser-252     Uromodulin / Homo sapiens
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCKSNNGR (47aa)
  •    P07911    Asn-275     Uromodulin / Homo sapiens
  •    P07911    Thr-296     Uromodulin / Homo sapiens
• FPNITNLCPF (10aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CPFGEVFNATR (11aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SGTIFDNFIITNDEAYAEEFGNETWGVTK (29aa)
  •    P27797    Asn-344     Calreticulin / Homo sapiens
• VIYNITEK (8aa)
  •    Q969V3    Asn-428     Nicalin / Homo sapiens
• VIYNLTEK (8aa)
  •    Q8VCM8    Asn-428     Nicalin / Mus musculus
• VGVHINNTQTK (11aa)
  •    Q9CPW0    Asn-436     Contactin-associated protein-like 2 / Mus musculus
• FTNGSCADIK (10aa)
  •    P41180    Asn-446     Extracellular calcium-sensing receptor / Homo sapiens
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478     Neural cell adhesion molecule L1 / Mus musculus
• GKANSTGTLVITNPTR (16aa)
  •    P12960    Asn-494     Contactin-1 / Mus musculus
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• YIDKGNR (7aa)
  •    O08532-4    Asn-580     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• FSTDKDHLVVSDVKDDDGGTYTCTANTTLDSASASAVLR (39aa)
  •    Q810U4    Asn-613     Neuronal cell adhesion molecule / Mus musculus
• QDVNCTEVPVAIHADQLTPTWR (22aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMT (41aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIA (80aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TNFTISVTTEILPVSMTK (18aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LSHDGNETLPLHLYVK (16aa)
  •    B2RXS4    Asn-735     Plexin-B2 / Mus musculus
• DFGGFNFSQILPDPSKPSK (19aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DFGGFNF (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFSQILPDPSK (11aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RPASNISASIQR (12aa)
  •    P97927    Asn-803     Laminin subunit alpha-4 / Mus musculus
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HVTYVPAQEKNF (12aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (55aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQRN (17aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWF (12aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AHFPREGVFVSNGT (14aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHWF (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• NHTSPDVDLGDISGINASVVNIQK (24aa)
  •    P0DTC2    Asn-1159     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TANETSAEAYNLLLR (15aa)
  •    P02468    Asn-1203     Laminin subunit gamma-1 / Mus musculus
• CDNVLAPNVTKQECCCTSGVGWGDNCEIFPC (31aa)
  •    Q14766    Asn-1366     Latent transforming growth factor beta binding protein 1 / Homo sapiens