taxonomy (5)
protein (25)
source (7)
structure (7)
composition (1)
disease (3)
reference (9)
site (27)
peptide (22)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Gallus gallus (Chicken)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-n-acetylglucosaminidase / Homo sapiens P54802
- Biglycan / Homo sapiens P21810
- Ceramide synthase 6 / Homo sapiens Q6ZMG9
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Endothelin-converting enzyme 1 / Homo sapiens P42892
- Fibrillin-1 / Homo sapiens P35555
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit alpha-4 / Homo sapiens Q16363
- Lumican / Homo sapiens P51884
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens Q02809
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Thrombospondin-1 / Homo sapiens P07996
- Platelet glycoprotein IV / Bos taurus P26201
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Ovalbumin / Gallus gallus P01012
- Ovomucoid / Gallus gallus P01005
- Riboflavin-binding protein / Gallus gallus P02752
- Uncharacterized protein from Egg Cell / Gallus gallus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Egg Cell
Source
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-2)][GlcNAc(b1-?)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-2)]Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)][GlcNAc(b1-?)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9411
Reported structure
- Hex:4 HexNAc:7 (avg mass : 2088.9499 )
Composition
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed
Reference
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Biglycan / Homo sapiens
- Ceramide synthase 6 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Endothelin-converting enzyme 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Lumican / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Thrombospondin-1 / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
- Neuronal cell adhesion molecule / Mus musculus
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NVTWADLK (8aa)
- DVNCSVMGPQEK (12aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- LHINHNNLTESVGPLPK (17aa)
- GTFTDCALANMTEQIR (16aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
- ACMNETR (7aa)
- NTTGFK (6aa)
- FPQVNVTK (8aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- IIQVVYIHSNNITK (14aa)
- FNSTEYQVVTR (11aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- NVTIMANLK (9aa)
- YIHQNYTK (8aa)
- VYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (48aa)
- NFTIS (5aa)
- VVNSTTGPGEHIR (13aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- MIEAYNITEK (10aa)
- LNGTDPIVAADSK (13aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Egg Cell
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Egg Cell
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Egg Cell
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Egg Cell
-
Ovalbumin / Gallus gallus
- Undefined site
-
Ovomucoid / Gallus gallus
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Uncharacterized protein from Egg Cell / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Egg Cell
-
Ovomucoid / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 2088.9499)
- Milk (UBERON_0001913)
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
-
- Hex:4 HexNAc:7 / N-Linked
(avg mass : 2088.9499)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-2)][GlcNAc(b1-?)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-2)]Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)][GlcNAc(b1-?)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"
- N-Linked / Complex / GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
- N-Linked / Complex / Structure 9411
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Alpha-n-acetylglucosaminidase / Homo sapiens
- Biglycan / Homo sapiens
- Ceramide synthase 6 / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Endothelin-converting enzyme 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Laminin subunit alpha-4 / Homo sapiens
- Lumican / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Neuronal cell adhesion molecule / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- NVTWADLK (8aa)
- DVNCSVMGPQEK (12aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- LHINHNNLTESVGPLPK (17aa)
- GTFTDCALANMTEQIR (16aa)
- ACMNETR (7aa)
- NTTGFK (6aa)
- FPQVNVTK (8aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- IIQVVYIHSNNITK (14aa)
- FNSTEYQVVTR (11aa)
- GSALHEDIYVLHDNGTLEIPVAQK (24aa)
- NVTIMANLK (9aa)
- YIHQNYTK (8aa)
- VYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (48aa)
- NFTIS (5aa)
- VVNSTTGPGEHIR (13aa)
- AWGTPCEMCPAVNTSEYK (18aa)
- MIEAYNITEK (10aa)
- LNGTDPIVAADSK (13aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:7 / N-Linked
(avg mass : 2088.9499)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 2088.9499)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2088.9499)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2088.9499)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2088.9499)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2088.9499)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2088.9499)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 2088.9499)