Hex:4 HexNAc:7

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Gallus gallus (Chicken)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Biglycan / Homo sapiens    P21810
• Ceramide synthase 6 / Homo sapiens    Q6ZMG9
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Endothelin-converting enzyme 1 / Homo sapiens    P42892
• Fibrillin-1 / Homo sapiens    P35555
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit alpha-4 / Homo sapiens    Q16363
• Lumican / Homo sapiens    P51884
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Thrombospondin-1 / Homo sapiens    P07996
• Platelet glycoprotein IV / Bos taurus    P26201
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein from Egg Cell / Gallus gallus    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Brain (UBERON_0000955)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Egg Cell  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-2)][GlcNAc(b1-?)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-2)]Man(a1-6)[GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-?)[GlcNAc(b1-?)][GlcNAc(b1-?)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4) + 2 x GalNAc(b1-4)"
• N-Linked / Complex / GlcNAc(b1-4)[GlcNAc(b1-2)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ Gal(b1-4)"
• N-Linked / Complex / Structure 9411

Composition

• Hex:4 HexNAc:7 (avg mass : 2088.9499 )

Disease

• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed

Reported glycosite

• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Biglycan / Homo sapiens
  •        Asn-311
• Ceramide synthase 6 / Homo sapiens
  •        Asn-18
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
• Endothelin-converting enzyme 1 / Homo sapiens
  •        Asn-187
• Fibrillin-1 / Homo sapiens
  •        Asn-1581
• Lactotransferrin / Homo sapiens
  •        Asn-156
• Laminin subunit alpha-4 / Homo sapiens
  •        Asn-215
• Lumican / Homo sapiens
  •        Asn-127
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-505
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-90
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-538
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-446
  •        Asn-4075
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-501
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Egg Cell / Gallus gallus
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-717
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-282
  •        Asn-657

Mass spectrometry observed peptide

• NVTWADLK (8aa)
  •    Q6ZMG9    Asn-18
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-90
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140
• RRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (33aa)
  •    P02788    Asn-156
• ACMNETR (7aa)
  •    P42892    Asn-187
• NTTGFK (6aa)
  •    Q16363    Asn-215
• FPQVNVTK (8aa)
  •    P54802    Asn-261
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311
• FNSTEYQVVTR (11aa)
  •    Q07954    Asn-446
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501
• NVTIMANLK (9aa)
  •    P32004    Asn-505
• YIHQNYTK (8aa)
  •    Q02809    Asn-538
• VYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (48aa)
  •    P0DTC2    Asn-657
• NFTIS (5aa)
  •    P0DTC2    Asn-717
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• AWGTPCEMCPAVNTSEYK (18aa)
  •    P35555    Asn-1581
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528
• LNGTDPIVAADSK (13aa)
  •    Q07954    Asn-4075