Hex:7 HexNAc:6 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Rattus norvegicus (Norway rat)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Aminopeptidase n / Homo sapiens    P15144
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• C4b-binding protein alpha chain / Homo sapiens    P04003
• Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens    Q9HCU4
• Catalase / Homo sapiens    P04040
• CD166 antigen / Homo sapiens    Q13740
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Coagulation factor V / Homo sapiens    P12259
• Complement c1r subcomponent / Homo sapiens    P00736
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Dopamine beta-hydroxylase / Homo sapiens    P09172
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibroleukin / Homo sapiens    Q14314
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glucosylceramidase / Homo sapiens    P04062
• Haptoglobin / Homo sapiens    P00738
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Integrin alpha-5 / Homo sapiens    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Keratin, type I cytoskeletal 9 / Homo sapiens    P35527
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens    P08637
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Midasin / Homo sapiens    Q9NU22
• Multimerin-1 / Homo sapiens    Q13201
• Nectin-1 / Homo sapiens    Q15223
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolargin / Homo sapiens    P51888
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens    P23470
• Signal transducer CD24 / Homo sapiens    P25063
• Single-stranded DNA-binding protein 4 / Homo sapiens    Q9BWG4
• Tenascin / Homo sapiens    P24821
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Trem-like transcript 2 protein / Homo sapiens    Q5T2D2
• Uromodulin / Homo sapiens    P07911
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Neuroligin 1 / Rattus norvegicus    Q62765
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)   Mature NK T cell (CL_0000814)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Prefrontal Cortex (UBERON:0000451)  
• Seminal Fluid (UBERON_0006530)  
• Urine (UBERON_0001088)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• Jurkat (CVCL_0065)  
• EBV-transformed B-cell (CL_0000236)  
• Neutrophil (CL_0000775)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Structure 138
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + NeuAc(a2-3)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Structure 9256
• N-Linked / Complex / Structure 9482
• N-Linked / Complex / Structure 10158
• N-Linked / Complex / Structure 10164
• N-Linked / Complex / Structure 10247
• N-Linked / Complex / Structure 10619
• N-Linked / Complex / Structure 10997
• N-Linked / Complex / Structure 11849

Composition

• Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
• IgE myeloma (DOID:9538)
• Mixed phenotype acute leukemia (DOID:9953)
• Multiple myeloma (DOID:9538)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-424
• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-718
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Aminopeptidase n / Homo sapiens
  •        Asn-818
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
• C4b-binding protein alpha chain / Homo sapiens
  •        Asn-506
• Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
  •        Asn-1501
• Catalase / Homo sapiens
  •        Asn-244
• CD166 antigen / Homo sapiens
  •        Asn-265
  •        Asn-306
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-374
• Coagulation factor V / Homo sapiens
  •        Asn-938
• Complement c1r subcomponent / Homo sapiens
  •        Asn-221
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Decorin / Homo sapiens
  •        Asn-262
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Dopamine beta-hydroxylase / Homo sapiens
  •        Asn-184
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-178
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-311
• Fibroleukin / Homo sapiens
  •        Asn-179
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Glucosylceramidase / Homo sapiens
  •        Asn-185
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-241
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Integrin alpha-5 / Homo sapiens
  •        Asn-868
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Keratin, type I cytoskeletal 9 / Homo sapiens
  •        Asn-266
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1223
• Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •        Asn-180
  •        Asn-187
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-49
  •        Asn-58
  •        Asn-123
  •        Asn-257
  •        Asn-275
• Midasin / Homo sapiens
  •        Asn-602
• Multimerin-1 / Homo sapiens
  •        Asn-97
  •        Asn-981
• Nectin-1 / Homo sapiens
  •        Asn-139
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prolargin / Homo sapiens
  •        Asn-124
  •        Asn-327
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-215
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
  •        Asn-600
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-234
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
  •        Asn-1181
• Signal transducer CD24 / Homo sapiens
  •        Asn-52
• Single-stranded DNA-binding protein 4 / Homo sapiens
  •        Asn-327
• Tenascin / Homo sapiens
  •        Asn-166
  •        Asn-184
  •        Asn-1366
  •        Asn-1392
  •        Asn-1485
  •        Asn-1809
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• Trem-like transcript 2 protein / Homo sapiens
  •        Asn-89
• Uromodulin / Homo sapiens
  •        Asn-322
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-615
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• APNPTNATTK (10aa)
  •    P25063    Asn-52     Signal transducer CD24 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• ENTSDPSIVIAFGR (14aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRESETKL (15aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRE (10aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• VVNITMVALK (10aa)
  •    Q5T2D2    Asn-89     Trem-like transcript 2 protein / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AQLLQGLGFNLTER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• NQTLTSTEK (9aa)
  •    Q13201    Asn-97     Multimerin-1 / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• KFNLTETSEAEIHQSFQHLLRT (22aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
  •    P13473    Asn-123     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IHYLYLQNNFITELPVESFQNATGLR (26aa)
  •    P51888    Asn-124     Prolargin / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• ESQLNLTVMAK (11aa)
  •    Q15223    Asn-139     Nectin-1 / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166     Tenascin / Homo sapiens
• DSIMENGTLCYEVHYR (16aa)
  •    Q93070    Asn-178     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• VANITFVVNSIDGK (14aa)
  •    Q14314    Asn-179     Fibroleukin / Homo sapiens
• CRGLVGSKNVSSE (13aa)
  •    P08637    Asn-180     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
  •    VAR_003960   176:F→V   dbSNP:rs396991
• GPNCSEPECPGNCHIR (16aa)
  •    P24821    Asn-184     Tenascin / Homo sapiens
• SLEAINGSGLQMGLQR (16aa)
  •    P09172    Asn-184     Dopamine beta-hydroxylase / Homo sapiens
• TYTYADTPDDFQIHNFSIPEEDTK (24aa)
  •    P04062    Asn-185     Glucosylceramidase / Homo sapiens
• TVNITITQGLA (11aa)
  •    P08637    Asn-187     Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• CNYSIR (6aa)
  •    P00736    Asn-221     Complement c1r subcomponent / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• YANITVDYLYNK (12aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• NLSVEDAAR (9aa)
  •    P04040    Asn-244     Catalase / Homo sapiens
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• NAIKEGDNITIK (12aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• EGDNITIK (8aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• QVLDNLTMEK (10aa)
  •    P35527    Asn-266     Keratin, type I cytoskeletal 9 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• NICHLR (6aa)
  •    Q16610    Asn-311     Extracellular matrix protein 1 / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• ANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPK (38aa)
  •    Q9BWG4    Asn-327     Single-stranded DNA-binding protein 4 / Homo sapiens
• INGTQICPNDIVAFHDFSSDIENVPHIR (28aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• SIVTQYINATGNR (13aa)
  •    P08195    Asn-424     4F2 cell-surface antigen heavy chain / Homo sapiens
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462     Desmoglein-2 / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR (36aa)
  •    P04003    Asn-506     C4b-binding protein alpha chain / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• YSVLIMAEKPVGDLSSPNETK (21aa)
  •    Q9P2B2    Asn-600     Prostaglandin F2 receptor negative regulator / Homo sapiens
• MAEVIGSKLNISR (13aa)
  •    Q9NU22    Asn-602     Midasin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NDCISAPINSLLQMAK (16aa)
  •    Q8IZF2    Asn-718     Adhesion G protein-coupled receptor F5 / Homo sapiens
• NATLVNEADK (10aa)
  •    P15144    Asn-818     Aminopeptidase n / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• VTGLNCTTNHPINPK (15aa)
  •    P08648    Asn-868     Integrin alpha-5 / Homo sapiens
• QSNSSK (6aa)
  •    P12259    Asn-938     Coagulation factor V / Homo sapiens
• TQAALSNLTCCIDR (14aa)
  •    Q13201    Asn-981     Multimerin-1 / Homo sapiens
• VPAQEKNFTTAPAICHDGKAHFPREGVF (28aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQRNFYEPQIITTDN (28aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NSSVVPSER (9aa)
  •    P23470    Asn-1181     Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
• TLAGENQTAFEIEELNRK (18aa)
  •    P11047    Asn-1223     Laminin subunit gamma-1 / Homo sapiens
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• LNWTAADNAYEHFVIQVQEVNK (22aa)
  •    P24821    Asn-1366     Tenascin / Homo sapiens
• KVEAAQNLTLPGSLRA (16aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VEAAQNITIPGSIR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• FGSVLGNYSCAAQGTQGGSK (20aa)
  •    Q9HCU4    Asn-1501     Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
• GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
  •    P24821    Asn-1809     Tenascin / Homo sapiens