Hex:7 HexNAc:6 dHex:1 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Desmodus rotundus (Common vampire bat)
• Rattus norvegicus (Norway rat)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• 4F2 cell-surface antigen heavy chain / Homo sapiens    P08195
• Adhesion G protein-coupled receptor F5 / Homo sapiens    Q8IZF2
• Alpha-1-acid glycoprotein 1 / Homo sapiens    P02763
• Alpha-1-antichymotrypsin / Homo sapiens    P01011
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Alpha-S1-casein / Homo sapiens    P47710
• Aminopeptidase n / Homo sapiens    P15144
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein D / Homo sapiens    P05090
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• C4b-binding protein alpha chain / Homo sapiens    P04003
• Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens    Q9HCU4
• Catalase / Homo sapiens    P04040
• CD166 antigen / Homo sapiens    Q13740
• CD59 glycoprotein / Homo sapiens    P13987
• Clusterin / Homo sapiens    P10909
• Coagulation factor V / Homo sapiens    P12259
• Complement c1r subcomponent / Homo sapiens    P00736
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Dopamine beta-hydroxylase / Homo sapiens    P09172
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens    Q93070
• Epithelial cell adhesion molecule / Homo sapiens    P16422
• Erythropoietin / Homo sapiens    P01588
• Extracellular matrix protein 1 / Homo sapiens    Q16610
• Fibroleukin / Homo sapiens    Q14314
• Galectin-3-binding protein / Homo sapiens    Q08380
• Glucosylceramidase / Homo sapiens    P04062
• Haptoglobin / Homo sapiens    P00738
• Homeobox protein Hox-B3 / Homo sapiens    P14651
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin epsilon chain c region / Homo sapiens    P01854
• Inactive tyrosine-protein kinase 7 / Homo sapiens    Q13308
• Integrin alpha-5 / Homo sapiens    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Keratin, type I cytoskeletal 9 / Homo sapiens    P35527
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit beta-1 / Homo sapiens    P07942
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Lumican / Homo sapiens    P51884
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Midasin / Homo sapiens    Q9NU22
• Multimerin-1 / Homo sapiens    Q13201
• Nectin-1 / Homo sapiens    Q15223
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolargin / Homo sapiens    P51888
• Prosaposin / Homo sapiens    P07602
• Prostaglandin F2 receptor negative regulator / Homo sapiens    Q9P2B2
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens    P23470
• Signal transducer CD24 / Homo sapiens    P25063
• Single-stranded DNA-binding protein 4 / Homo sapiens    Q9BWG4
• Tenascin / Homo sapiens    P24821
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Trem-like transcript 2 protein / Homo sapiens    Q5T2D2
• Uromodulin / Homo sapiens    P07911
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Neuroligin 1 / Rattus norvegicus    Q62765
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Urine (UBERON_0001088)  
• CHO (CVCL_0213)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• HEK293T (CVCL_0063)  
• Jurkat (CVCL_0065)  
• EBV-transformed B-cell (CL_0000236)  
• Neutrophil (CL_0000775)  

Reported structure

• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-4)]Man(a1-3)[Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ NeuAc(a2-3)"
• N-Linked / Complex / Structure 138
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)[Gal(b1-4)GlcNAc(b1-6)]Man(a1-6)[Gal(b1-4)GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ Gal(b1-4)GlcNAc(b1-3) + NeuAc(a2-3)"
• N-Linked / Complex / Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)[Hex(?1-?)HexNAc(?1-?)[Hex(?1-?)HexNAc(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc+"+ NeuAc"
• N-Linked / Complex / Structure 9256
• N-Linked / Complex / Structure 9482
• N-Linked / Complex / Structure 10158
• N-Linked / Complex / Structure 10164
• N-Linked / Complex / Structure 10247
• N-Linked / Complex / Structure 10619

Composition

• Hex:7 HexNAc:6 dHex:1 NeuAc:1 (avg mass : 2809.583 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Hyper IgE syndrome (HIES, p.Glu340del) (DOID:0080545)
• Hyper IgE syndrome (HIES, p.Leu83Ser) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Asp507Tyr) (DOID:0080545)
• Hyper IgE syndrome (PGM3 mutation, p.Leu83Ser) (DOID:0080545)
• IgE myeloma (DOID:9538)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• T-cell childhood acute lymphocytic leukemia (DOID:0080145)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Cysteine Aminoethylation Enables the Site-Specific Glycosylation Analysis of Recombinant Human Erythropoietin using Trypsin (2020 - Steffen Lippold, Alexander Büttner, Matthew S.F. Choo, Michaela Hook, Coen J. de Jong, Terry Nguyen-Khuong, Markus Haberger, Dietmar Reusch, Manfred Wuhrer, Noortje de Haan) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Glycoproteomic Analysis of MGL-Binding Proteins on Acute T-Cell Leukemia Cells. (2019 - Martina Pirro, Esmee Schoof, Sandra J. van Vliet, Yoann Rombouts, Alexandre Stella, Arnoud de Ru, Yassene Mohammed, Manfred Wuhrer, Peter A. van Veelen, Paul J. Hensbergen) / Status : Reviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
• Site-specific N-glycosylation analysis of human immunoglobulin E. (2014 - Plomp R, Hensbergen PJ, Rombouts Y, Zauner G, Dragan I, Koeleman CA, Deelder AM, Wuhrer M) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Hypomorphic homozygous mutations in phosphoglucomutase 3 (PGM3) impair immunity and increase serum IgE levels, (2014 - Atfa Sassi, Sandra Lazaroski, Gang Wu, Stuart M. Haslam, Manfred Fliegauf, Fethi Mellouli, Turkan Patiroglu, Ekrem Unal, Mehmet Akif Ozdemir, Zineb Jouhadi, Khadija Khadir, Leila Ben-Khemis, Meriem Ben-Ali, Imen Ben-Mustapha, Lamia Borchani, Dietmar Pfeifer, Thilo Jakob, Monia Khemiri, A. Charlotta Asplund, Manuela O. Gustafsson, Karin E. Lundin, Elin Falk-Sörqvist, Lotte N. Moens, Hatice Eke Gungor, Karin R. Engelhardt, Magdalena Dziadzio, Hans Stauss, Bernhard Fleckenstein, Rebecca Meier, Khairunnadiya Prayitno, Andrea Maul-Pavicic, Sandra Schaffer, Mirzokhid Rakhmanov, Philipp Henneke, Helene Kraus, Hermann Eibel, Uwe Kölsch, Sellama Nadifi, Mats Nilsson, Mohamed Bejaoui, Alejandro A. Schäffer, C.I. Edvard Smith, Anne Dell, Mohamed-Ridha Barbouche, Bodo Grimbacher) / Status : Reviewed
• Structural characterization of recombinant soluble rat neuroligin 1: mapping of secondary structure and glycosylation by mass spectrometry. (2004 - Hoffman RC, Jennings LL, Tsigelny I, Comoletti D, Flynn RE, Sudhof TC, Taylor P) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed

Reported glycosite

• 4F2 cell-surface antigen heavy chain / Homo sapiens
  •        Asn-424
• Adhesion G protein-coupled receptor F5 / Homo sapiens
  •        Asn-718
• Alpha-1-acid glycoprotein 1 / Homo sapiens
  •        Asn-93
• Alpha-1-antichymotrypsin / Homo sapiens
  •        Asn-106
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Aminopeptidase n / Homo sapiens
  •        Asn-818
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein D / Homo sapiens
  •        Asn-98
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
• C4b-binding protein alpha chain / Homo sapiens
  •        Asn-506
• Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
  •        Asn-1501
• Catalase / Homo sapiens
  •        Asn-244
• CD166 antigen / Homo sapiens
  •        Asn-265
  •        Asn-306
• CD59 glycoprotein / Homo sapiens
  •        Asn-43
• Clusterin / Homo sapiens
  •        Asn-86
  •        Asn-374
• Coagulation factor V / Homo sapiens
  •        Asn-938
• Complement c1r subcomponent / Homo sapiens
  •        Asn-221
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-96
• Decorin / Homo sapiens
  •        Asn-262
• Desmoglein-2 / Homo sapiens
  •        Asn-462
• Dopamine beta-hydroxylase / Homo sapiens
  •        Asn-184
• Ecto-ADP-ribosyltransferase 4 / Homo sapiens
  •        Asn-178
• Epithelial cell adhesion molecule / Homo sapiens
  •        Asn-74
• Erythropoietin / Homo sapiens
  •        Asn-51
  •        Asn-65
  •        Asn-110
• Extracellular matrix protein 1 / Homo sapiens
  •        Asn-311
• Fibroleukin / Homo sapiens
  •        Asn-179
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Glucosylceramidase / Homo sapiens
  •        Asn-185
• Haptoglobin / Homo sapiens
  •        Asn-207
  •        Asn-241
• Homeobox protein Hox-B3 / Homo sapiens
  •        Asn-226
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-830
• Immunoglobulin epsilon chain c region / Homo sapiens
  •        Asn-21
  •        Asn-49
  •        Asn-99
  •        Asn-146
• Inactive tyrosine-protein kinase 7 / Homo sapiens
  •        Asn-116
• Integrin alpha-5 / Homo sapiens
  •        Asn-868
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
  •        Asn-577
• Keratin, type I cytoskeletal 9 / Homo sapiens
  •        Asn-266
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1223
• Lumican / Homo sapiens
  •        Asn-88
  •        Asn-127
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-84
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-32
  •        Asn-49
  •        Asn-58
  •        Asn-123
  •        Asn-257
  •        Asn-275
• Midasin / Homo sapiens
  •        Asn-602
• Multimerin-1 / Homo sapiens
  •        Asn-97
  •        Asn-981
• Nectin-1 / Homo sapiens
  •        Asn-139
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Prolargin / Homo sapiens
  •        Asn-124
  •        Asn-327
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-215
• Prostaglandin F2 receptor negative regulator / Homo sapiens
  •        Asn-286
  •        Asn-600
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Asn-234
• Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
  •        Asn-1181
• Signal transducer CD24 / Homo sapiens
  •        Asn-52
• Single-stranded DNA-binding protein 4 / Homo sapiens
  •        Asn-327
• Tenascin / Homo sapiens
  •        Asn-166
  •        Asn-184
  •        Asn-1366
  •        Asn-1392
  •        Asn-1485
  •        Asn-1809
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• Trem-like transcript 2 protein / Homo sapiens
  •        Asn-89
• Uromodulin / Homo sapiens
  •        Asn-322
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-398
• Neuroligin 1 / Rattus norvegicus
  •        Undefined site
• Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331
  •        Asn-615
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-331

Mass spectrometry observed peptide

• LELNLTDSENATCLYAK (17aa)
  •    P13473    Asn-32     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• TAVNCSSDFDACLITK (16aa)
  •    P13987    Asn-43     CD59 glycoprotein / Homo sapiens
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• EAENITTGC (9aa)
  •    P01588    Asn-51     Erythropoietin / Homo sapiens
• APNPTNATTK (10aa)
  •    P25063    Asn-52     Signal transducer CD24 / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SLNENITVPDTK (12aa)
  •    P01588    Asn-65     Erythropoietin / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• AEMNGSK (7aa)
  •    P16422    Asn-74     Epithelial cell adhesion molecule / Homo sapiens
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• ENTSDPSIVIAFGR (14aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• SSCGKENTSDPSIVIAFGR (19aa)
  •    P11279    Asn-84     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• KKKEDALNETRE (12aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KKKEDALNETRESETKL (17aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRESETKL (15aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• KEDALNETRE (10aa)
  •    P10909    Asn-86     Clusterin / Homo sapiens
• AFENVTDLQWLILDHNLLENSK (22aa)
  •    P51884    Asn-88     Lumican / Homo sapiens
• VVNITMVALK (10aa)
  •    Q5T2D2    Asn-89     Trem-like transcript 2 protein / Homo sapiens
• QDQCIYNTTYLNVQR (15aa)
  •    P02763    Asn-93     Alpha-1-acid glycoprotein 1 / Homo sapiens
• AQLLQGLGFNLTER (14aa)
  •    P08185    Asn-96     Corticosteroid-binding globulin / Homo sapiens
• NQTLTSTEK (9aa)
  •    Q13201    Asn-97     Multimerin-1 / Homo sapiens
• ADGTVNQIEGEATPVNLTEPAK (22aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• KFNLTETSEAEIHQSFQHLLRT (22aa)
  •    P01011    Asn-106     Alpha-1-antichymotrypsin / Homo sapiens
• GQALLVNSSQPWEPLQLHVDK (21aa)
  •    P01588    Asn-110     Erythropoietin / Homo sapiens
• SANASFNIK (9aa)
  •    Q13308    Asn-116     Inactive tyrosine-protein kinase 7 / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• AASTYSIDSVSFSYNTGDNTTFPDAEDK (28aa)
  •    P13473    Asn-123     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IHYLYLQNNFITELPVESFQNATGLR (26aa)
  •    P51888    Asn-124     Prolargin / Homo sapiens
• KLHINHNNLTESVGPLPK (18aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• LHINHNNLTESVGPLPK (17aa)
  •    P51884    Asn-127     Lumican / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• ESQLNLTVMAK (11aa)
  •    Q15223    Asn-139     Nectin-1 / Homo sapiens
• RTAGWNVPIGTLRPFLNWTGPPEPIEAAVARF (32aa)
  •    P02788    Asn-156     Lactotransferrin / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GNFSTEGCGCVCEPGWK (17aa)
  •    P24821    Asn-166     Tenascin / Homo sapiens
• DSIMENGTLCYEVHYR (16aa)
  •    Q93070    Asn-178     Ecto-ADP-ribosyltransferase 4 / Homo sapiens
• VANITFVVNSIDGK (14aa)
  •    Q14314    Asn-179     Fibroleukin / Homo sapiens
• GPNCSEPECPGNCHIR (16aa)
  •    P24821    Asn-184     Tenascin / Homo sapiens
• SLEAINGSGLQMGLQR (16aa)
  •    P09172    Asn-184     Dopamine beta-hydroxylase / Homo sapiens
• TYTYADTPDDFQIHNFSIPEEDTK (24aa)
  •    P04062    Asn-185     Glucosylceramidase / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-207     Haptoglobin / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• CNYSIR (6aa)
  •    P00736    Asn-221     Complement c1r subcomponent / Homo sapiens
• VEMANLLNLSER (12aa)
  •    P14651    Asn-226     Homeobox protein Hox-B3 / Homo sapiens
• YANITVDYLYNK (12aa)
  •    P08575    Asn-234     Receptor-type tyrosine-protein phosphatase C / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KVVLHPNYSQVDIGLIKL (18aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• NLSVEDAAR (9aa)
  •    P04040    Asn-244     Catalase / Homo sapiens
• VASVININPNTTHSTGSCR (19aa)
  •    P13473    Asn-257     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262     Decorin / Homo sapiens
• NAIKEGDNITIK (12aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• EGDNITIK (8aa)
  •    Q13740    Asn-265     CD166 antigen / Homo sapiens
• QVLDNLTMEK (10aa)
  •    P35527    Asn-266     Keratin, type I cytoskeletal 9 / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• NVSVAEGK (8aa)
  •    Q9P2B2    Asn-286     Prostaglandin F2 receptor negative regulator / Homo sapiens
• NATGDYK (7aa)
  •    Q13740    Asn-306     CD166 antigen / Homo sapiens
• NICHLR (6aa)
  •    Q16610    Asn-311     Extracellular matrix protein 1 / Homo sapiens
• QDFNITDISLLEHR (14aa)
  •    P07911    Asn-322     Uromodulin / Homo sapiens
• ANFPLGPGPEGPMAAMSAMEPHHVNGSLGSGDMDGLPK (38aa)
  •    Q9BWG4    Asn-327     Single-stranded DNA-binding protein 4 / Homo sapiens
• INGTQICPNDIVAFHDFSSDIENVPHIR (28aa)
  •    P51888    Asn-327     Prolargin / Homo sapiens
• FPNIT (5aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LANLTQGEDQYYLR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• SIVTQYINATGNR (13aa)
  •    P08195    Asn-424     4F2 cell-surface antigen heavy chain / Homo sapiens
• YVQNGTYTVK (10aa)
  •    Q14126    Asn-462     Desmoglein-2 / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• LSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNR (36aa)
  •    P04003    Asn-506     C4b-binding protein alpha chain / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• YSVLIMAEKPVGDLSSPNETK (21aa)
  •    Q9P2B2    Asn-600     Prostaglandin F2 receptor negative regulator / Homo sapiens
• MAEVIGSKLNISR (13aa)
  •    Q9NU22    Asn-602     Midasin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NDCISAPINSLLQMAK (16aa)
  •    Q8IZF2    Asn-718     Adhesion G protein-coupled receptor F5 / Homo sapiens
• NATLVNEADK (10aa)
  •    P15144    Asn-818     Aminopeptidase n / Homo sapiens
• LSALDNLLNHSSMFLK (16aa)
  •    Q9Y4L1    Asn-830     Hypoxia up-regulated protein 1 / Homo sapiens
• VTGLNCTTNHPINPK (15aa)
  •    P08648    Asn-868     Integrin alpha-5 / Homo sapiens
• QSNSSK (6aa)
  •    P12259    Asn-938     Coagulation factor V / Homo sapiens
• TQAALSNLTCCIDR (14aa)
  •    Q13201    Asn-981     Multimerin-1 / Homo sapiens
• VPAQEKNFTTAPAICHDGKAHFPREGVF (28aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQRNFYEPQIITTDN (28aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NSSVVPSER (9aa)
  •    P23470    Asn-1181     Receptor-type tyrosine-protein phosphatase gamma / Homo sapiens
• TLAGENQTAFEIEELNRK (18aa)
  •    P11047    Asn-1223     Laminin subunit gamma-1 / Homo sapiens
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• LNWTAADNAYEHFVIQVQEVNK (22aa)
  •    P24821    Asn-1366     Tenascin / Homo sapiens
• KVEAAQNLTLPGSLRA (16aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• VEAAQNITIPGSIR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• IIETVEYNISGAER (14aa)
  •    P24821    Asn-1485     Tenascin / Homo sapiens
• FGSVLGNYSCAAQGTQGGSK (20aa)
  •    Q9HCU4    Asn-1501     Cadherin EGF LAG seven-pass G-type receptor 2 / Homo sapiens
• GFEESEPVSGSFTTAIDGPSGIVTANITDSEAIAR (35aa)
  •    P24821    Asn-1809     Tenascin / Homo sapiens