Hex:6 HexNAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Rana pipiens (Northern leopard frog)
• Nicotiana tabacum (Common tobacco)
• Gallus gallus (Chicken)
• Megathura crenulata (Californian giant keyhole limpet)
• Friend murine leukemia virus (F-mulv)
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Armoracia rusticana (Horseradish)
• Marburg virus (strain musoke)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Angiotensin-converting enzyme / Homo sapiens    P12821
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein B-100 / Homo sapiens    P04114
• Attractin / Homo sapiens    O75882
• Beta-galactosidase / Homo sapiens    P16278
• Biglycan / Homo sapiens    P21810
• Bile-salt-activated lipase / Homo sapiens    P19835
• Carboxypeptidase Q / Homo sapiens    Q9Y646
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• Cathepsin D / Homo sapiens    P07339
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens    P20645
• CD166 antigen / Homo sapiens    Q13740
• Clusterin / Homo sapiens    P10909
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens    Q11201
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Complement c3 / Homo sapiens    P01024
• Decorin / Homo sapiens    P07585
• Deoxyribonuclease-2-alpha / Homo sapiens    O00115
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Fibrillin-1 / Homo sapiens    P35555
• Fibrillin-2 / Homo sapiens    P35556
• Fibrillin-3 / Homo sapiens    Q75N90
• Fibronectin / Homo sapiens    P02751
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-M / Homo sapiens    P11215
• Integrin alpha-V / Homo sapiens    P06756
• Integrin beta-2 / Homo sapiens    P05107
• Junctional adhesion molecule c / Homo sapiens    Q9BX67
• KDEL motif-containing protein 2 / Homo sapiens    Q7Z4H8
• Lactadherin / Homo sapiens    Q08431
• Lactotransferrin / Homo sapiens    P02788
• Leukocyte surface antigen CD47 / Homo sapiens    Q08722
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Monocyte differentiation antigen cd14 / Homo sapiens    P08571
• Mucolipin-3 / Homo sapiens    Q8TDD5
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Neurocan core protein / Homo sapiens    O14594
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Peroxidasin homolog / Homo sapiens    Q92626
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prorenin / Homo sapiens    P00797
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens    P07288
• Protein CREG1 / Homo sapiens    O75629
• Putative phospholipase B-like 2 / Homo sapiens    Q8NHP8
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Rhodopsin / Homo sapiens    P08100
• Secreted frizzled-related protein 4 / Homo sapiens    Q6FHJ7
• Serpin h1 / Homo sapiens    P50454
• Sparc / Homo sapiens    P09486
• SUN domain-containing ossification factor / Homo sapiens    Q9UBS9
• Sushi domain-containing protein 2 / Homo sapiens    Q9UGT4
• Synaptophysin-like protein 1 / Homo sapiens    Q16563
• Tetraspanin-3 / Homo sapiens    O60637
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thyroglobulin / Homo sapiens    P01266
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Transmembrane protein 87A / Homo sapiens    Q8NBN3
• Uromodulin / Homo sapiens    P07911
• Vesicle-trafficking protein SEC22b / Homo sapiens    O75396
• Vitronectin / Homo sapiens    P04004
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Platelet glycoprotein IV / Bos taurus    P26201
• Ribonuclease pancreatic [b] / Bos taurus    P61823
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Aminopeptidase N / Mus musculus    P97449
• Angiotensin-converting enzyme / Mus musculus    P09470
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Cadherin-13 / Mus musculus    Q9WTR5
• Cation-dependent mannose-6-phosphate receptor / Mus musculus    P24668
• Cytoplasmic FMR1-interacting protein 2 / Mus musculus    Q5SQX6
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• DNA mismatch repair protein Mlh1 / Mus musculus    Q9JK91
• Ephrin-A4 / Mus musculus    O08542
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus    P62812
• Junctional adhesion molecule C / Mus musculus    Q9D8B7
• Laminin subunit gamma-1 / Mus musculus    P02468
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Protein disulfide-isomerase TMX3 / Mus musculus    Q8BXZ1
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium channel subunit beta-1 / Mus musculus    P97952
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Solute carrier family 12 member 9 / Mus musculus    Q99MR3
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Rhodopsin / Rana pipiens    P31355
• Uncharacterized protein / Nicotiana tabacum    
• Ovalbumin / Gallus gallus    P01012
• Hemocyanin / Megathura crenulata    Q10584    Q10583
• Envelope glycoprotein / Friend murine leukemia virus    P03395
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Peroxidase c / Armoracia rusticana    
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Colon (UBERON_0001155)  
• Hemolymph (UBERON_0001011)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Seminal Fluid (UBERON_0006530)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)  
• Eveline (CVCL_A1LI)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• LS174T (CVCL_1384)  
• Adipocytes (CL_0000136)  
• Adipose-derived stem cells (ADSCs) (CL_0000136)  
• Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)  
• Egg Cell  
• Leukocyte (CL_0000738)  
• Low-Density Lipoprotein Particle (GO_0034362)  

Reported structure

• N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-3)GlcNAc(b1-4)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 939
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 9403
• N-Linked / Hybrid / Structure 9669
• N-Linked / Hybrid / Structure 10023
• N-Linked / Hybrid / Structure 10699
• N-Linked / Hybrid / Structure 10953

Composition

• Hex:6 HexNAc:3 (avg mass : 1600.4547 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Hepatocellular (DOID:684)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Hypercholesterolemia, Familial (DOID:13810)
• Leukemia, Acute lymphoblastic (DOID:9952)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
• In vivo conversion of a glycan to human compatible type by transformed tobacco cells (2001 - Fujiyama, Palacpac, Sakai, Kimura, Shinmyo, Yoshida, Seki) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Analysis of carbohydrate heterogeneity in a glycoprotein using liquid chromatography/mass spectrometry and liquid chromatography with tandem mass spectrometry. (1999 - Kawasaki N, Ohta M, Hyuga S, Hashimoto O, Hayakawa T) / Status : Reviewed
• Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
• Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
• Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed

Reported glycosite

• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-869
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
  •        Asn-124
• Angiotensin-converting enzyme / Homo sapiens
  •        Asn-714
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein B-100 / Homo sapiens
  •        Undefined site
• Attractin / Homo sapiens
  •        Asn-428
• Beta-galactosidase / Homo sapiens
  •        Asn-464
• Biglycan / Homo sapiens
  •        Asn-270
• Bile-salt-activated lipase / Homo sapiens
  •        Undefined site
• Carboxypeptidase Q / Homo sapiens
  •        Asn-179
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Cartilage intermediate layer protein 1 / Homo sapiens
  •        Asn-346
• Cathepsin D / Homo sapiens
  •        Asn-134
  •        Asn-263
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-57
• CD166 antigen / Homo sapiens
  •        Asn-480
• Clusterin / Homo sapiens
  •        Asn-374
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
  •        Asn-79
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Complement c3 / Homo sapiens
  •        Asn-85
• Decorin / Homo sapiens
  •        Asn-211
• Deoxyribonuclease-2-alpha / Homo sapiens
  •        Asn-266
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
  •        Asn-119
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Fibrillin-2 / Homo sapiens
  •        Asn-1112
• Fibrillin-3 / Homo sapiens
  •        Asn-1025
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-542
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-95
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-340
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
• Integrin alpha-2 / Homo sapiens
  •        Asn-1074
• Integrin alpha-M / Homo sapiens
  •        Asn-900
  •        Asn-1050
• Integrin alpha-V / Homo sapiens
  •        Asn-74
  •        Asn-945
• Integrin beta-2 / Homo sapiens
  •        Asn-642
• Junctional adhesion molecule c / Homo sapiens
  •        Asn-104
• KDEL motif-containing protein 2 / Homo sapiens
  •        Asn-306
• Lactadherin / Homo sapiens
  •        Asn-238
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Leukocyte surface antigen CD47 / Homo sapiens
  •        Asn-73
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-470
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-103
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2203
  •        Asn-2500
  •        Asn-2693
• Monocyte differentiation antigen cd14 / Homo sapiens
  •        Asn-151
• Mucolipin-3 / Homo sapiens
  •        Asn-205
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-130
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-279
  •        Asn-362
• Neurocan core protein / Homo sapiens
  •        Asn-122
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
  •        Asn-212
  •        Asn-232
• Periostin / Homo sapiens
  •        Asn-599
• Peroxidasin homolog / Homo sapiens
  •        Asn-1280
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-499
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-4075
• Prorenin / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-215
  •        Asn-332
  •        Asn-426
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
  •        Asn-69
• Protein CREG1 / Homo sapiens
  •        Asn-160
  •        Asn-216
• Putative phospholipase B-like 2 / Homo sapiens
  •        Asn-515
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Rhodopsin / Homo sapiens
  •        Undefined site
• Secreted frizzled-related protein 4 / Homo sapiens
  •        Asn-194
• Serpin h1 / Homo sapiens
  •        Asn-125
• Sparc / Homo sapiens
  •        Asn-116
• SUN domain-containing ossification factor / Homo sapiens
  •        Asn-530
• Sushi domain-containing protein 2 / Homo sapiens
  •        Asn-162
• Synaptophysin-like protein 1 / Homo sapiens
  •        Asn-71
• Tetraspanin-3 / Homo sapiens
  •        Asn-167
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Transmembrane protein 87A / Homo sapiens
  •        Asn-62
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-275
• Vesicle-trafficking protein SEC22b / Homo sapiens
  •        Asn-172
• Vitronectin / Homo sapiens
  •        Asn-169
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Ribonuclease pancreatic [b] / Bos taurus
  •        Asn-60
• Uncharacterized protein (gene name abca4) / Bos taurus
  •        Asn-504
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Aminopeptidase N / Mus musculus
  •        Asn-128
• Angiotensin-converting enzyme / Mus musculus
  •        Asn-165
  •        Asn-514
  •        Asn-528
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-121
• Cadherin-13 / Mus musculus
  •        Asn-638
• Cation-dependent mannose-6-phosphate receptor / Mus musculus
  •        Asn-58
• Cytoplasmic FMR1-interacting protein 2 / Mus musculus
  •        Asn-441
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• DNA mismatch repair protein Mlh1 / Mus musculus
  •        Asn-64
• Ephrin-A4 / Mus musculus
  •        Asn-33
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
  •        Asn-137
• Junctional adhesion molecule C / Mus musculus
  •        Asn-192
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1203
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-61
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-478
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
• Oligodendrocyte-myelin glycoprotein / Mus musculus
  •        Asn-234
• Protein disulfide-isomerase TMX3 / Mus musculus
  •        Asn-261
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-168
  •        Asn-246
• Sodium channel subunit beta-1 / Mus musculus
  •        Asn-135
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-118
  •        Asn-153
  •        Asn-238
• Solute carrier family 12 member 9 / Mus musculus
  •        Asn-243
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Rhodopsin / Rana pipiens
  •        Asn-2
• Uncharacterized protein / Nicotiana tabacum
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Hemocyanin / Megathura crenulata
  •        Undefined site
• Envelope glycoprotein / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-12
• Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Peroxidase c / Armoracia rusticana
  •        Undefined site
• Structural glycoprotein / Marburg virus (strain musoke)
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-74
  •        Asn-122
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-122
  •        Asn-165
  •        Asn-234
  •        Asn-331
  •        Asn-602
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-343

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HPIYWNSSNPR (11aa)
  •    O08542    Asn-33     Ephrin-A4 / Mus musculus
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53     Dipeptidyl peptidase 1 / Homo sapiens
• LKPLFNK (7aa)
  •    P20645    Asn-57     Cation-dependent mannose-6-phosphate receptor / Homo sapiens
• LRPLFNK (7aa)
  •    P24668    Asn-58     Cation-dependent mannose-6-phosphate receptor / Mus musculus
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• WKLNK (5aa)
  •    Q61735    Asn-61     Leukocyte surface antigen CD47 / Mus musculus
• NTTIFLK (7aa)
  •    Q8NBN3    Asn-62     Transmembrane protein 87A / Homo sapiens
• LIQIQDNGTGIR (12aa)
  •    Q9JK91    Asn-64     DNA mismatch repair protein Mlh1 / Mus musculus
• NKSVLLGR (8aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
  •    P07288    Asn-69     Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• GQTEIQVNCPPAVTENK (17aa)
  •    Q16563    Asn-71     Synaptophysin-like protein 1 / Homo sapiens
• DIYTFDGAINK (11aa)
  •    Q08722    Asn-73     Leukocyte surface antigen CD47 / Homo sapiens
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ANTTQPGIVEGGQVIK (16aa)
  •    P06756    Asn-74     Integrin alpha-V / Homo sapiens
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78     Probable lysosomal cobalamin transporter / Homo sapiens
• FNQTMQPIITAQNAIIEDDTYR (22aa)
  •    Q11201    Asn-79     CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80     Prosaposin / Homo sapiens
• KTVLTPATNHMGNVTFTIPANRE (23aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• EILNVTLVPYGNAQEQNVSGR (21aa)
  •    P13284    Asn-95     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• LVMEILNVTLVPYGNAQEQNVSGR (24aa)
  •    P13284    Asn-95     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• GHTITINFTR (10aa)
  •    P11279    Asn-103     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• VCSNDNK (7aa)
  •    P09486    Asn-116     Sparc / Homo sapiens
• FLEPYNDSIQAQK (13aa)
  •    P14231    Asn-118     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119     Dipeptidyl peptidase 1 / Homo sapiens
• HINFTR (6aa)
  •    P15209    Asn-121     BDNF/NT-3 growth factors receptor / Mus musculus
• ANATLLLGPLR (11aa)
  •    O14594    Asn-122     Neurocan core protein / Homo sapiens
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LGIYADMGNFTCMGYPGTTLDK (22aa)
  •    P17050    Asn-124     Alpha-n-acetylgalactosaminidase / Homo sapiens
• FGCEIENNR (9aa)
  •    P25311    Asn-128     Zinc-alpha-2-glycoprotein / Homo sapiens
• KLNYTLK (7aa)
  •    P97449    Asn-128     Aminopeptidase N / Mus musculus
• DASINIENMQFIHNGTYICDVK (22aa)
  •    O95297    Asn-130     Myelin protein zero-like protein 1 / Homo sapiens
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134     Cathepsin D / Homo sapiens
• LLFFDNYEHNTSVVK (15aa)
  •    P97952    Asn-135     Sodium channel subunit beta-1 / Mus musculus
• SVAHNMTMPNK (11aa)
  •    P62812    Asn-137     Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140     Collagen alpha-2(VI) chain / Homo sapiens
• RLRNVSWATGRS (12aa)
  •    P08571    Asn-151     Monocyte differentiation antigen cd14 / Homo sapiens
• RNVSWATGRS (10aa)
  •    P08571    Asn-151     Monocyte differentiation antigen cd14 / Homo sapiens
• RACQFNR (7aa)
  •    P14231    Asn-153     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• VNETEMDIAK (10aa)
  •    O75629    Asn-160     Protein CREG1 / Homo sapiens
• SEIVNETR (8aa)
  •    Q9UGT4    Asn-162     Sushi domain-containing protein 2 / Homo sapiens
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VCFPNK (6aa)
  •    P09470    Asn-165     Angiotensin-converting enzyme / Mus musculus
• NQSVPISCCR (10aa)
  •    O60637    Asn-167     Tetraspanin-3 / Homo sapiens
• VNFTCK (6aa)
  •    P97797    Asn-168     Signal-regulatory protein alpha / Mus musculus
• ANNLSSLSK (9aa)
  •    O75396    Asn-172     Vesicle-trafficking protein SEC22b / Homo sapiens
• IVVYNQPYINYSR (13aa)
  •    Q9Y646    Asn-179     Carboxypeptidase Q / Homo sapiens
• FQNSSFHVNSETGTLVFNAVHK (22aa)
  •    Q9D8B7    Asn-192     Junctional adhesion molecule C / Mus musculus
• NYSYVIHAK (9aa)
  •    Q6FHJ7    Asn-194     Secreted frizzled-related protein 4 / Homo sapiens
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197     Palmitoyl-protein thioesterase 1 / Homo sapiens
• NLTLDFHR (8aa)
  •    Q8TDD5    Asn-205     Mucolipin-3 / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• GINESYKK (8aa)
  •    P50897    Asn-212     Palmitoyl-protein thioesterase 1 / Homo sapiens
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215     Prosaposin / Homo sapiens
• IVTPEEYYNVTV (12aa)
  •    O75629    Asn-216     Protein CREG1 / Homo sapiens
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217     Neuronal cell adhesion molecule / Mus musculus
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232     Uromodulin / Homo sapiens
• FINDSIVDPVDSEWFGFYR (19aa)
  •    P50897    Asn-232     Palmitoyl-protein thioesterase 1 / Homo sapiens
• WSCDHKQNITYLLK (14aa)
  •    Q63912    Asn-234     Oligodendrocyte-myelin glycoprotein / Mus musculus
• GINIT (5aa)
  •    P0DTC2    Asn-234     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FHVNYTQPLVAVK (13aa)
  •    P14231    Asn-238     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• NNSIPDK (7aa)
  •    Q08431    Asn-238     Lactadherin / Homo sapiens
• KFHVNYTQPLVAVK (14aa)
  •    P14231    Asn-238     Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
• HGHFTGFNGSTLR (13aa)
  •    Q99MR3    Asn-243     Solute carrier family 12 member 9 / Mus musculus
• GIANLSNFIR (10aa)
  •    P97797    Asn-246     Signal-regulatory protein alpha / Mus musculus
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• LVAIAVIDEKNTSLEHTR (18aa)
  •    Q8BXZ1    Asn-261     Protein disulfide-isomerase TMX3 / Mus musculus
• GSISYINVTR (10aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263     Cathepsin D / Homo sapiens
• TVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSK (39aa)
  •    O00115    Asn-266     Deoxyribonuclease-2-alpha / Homo sapiens
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270     Biglycan / Homo sapiens
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275     Uromodulin / Homo sapiens
• TPMTNSSIQFIDNAFRK (17aa)
  •    P15586    Asn-279     N-acetylglucosamine-6-sulfatase / Homo sapiens
• GVTNDIISIQGNTGPSWINK (20aa)
  •    Q7Z4H8    Asn-306     KDEL motif-containing protein 2 / Homo sapiens
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330     Thrombospondin-2 / Homo sapiens
• RFPNIT (6aa)
  •    P0DTC2    Asn-331     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LIDNNK (6aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• IIDNNKTEK (9aa)
  •    P07602    Asn-332     Prosaposin / Homo sapiens
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• VFNATR (6aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YFWYHNDTLLDPSLYK (16aa)
  •    O75339    Asn-346     Cartilage intermediate layer protein 1 / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• GPGIKPNQTSK (11aa)
  •    P15586    Asn-362     N-acetylglucosamine-6-sulfatase / Homo sapiens
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374     Clusterin / Homo sapiens
• NLEKNSTK (8aa)
  •    P07602    Asn-426     Prosaposin / Homo sapiens
• VFHIHNESWVLLTPK (15aa)
  •    O75882    Asn-428     Attractin / Homo sapiens
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• ATRYNYTSEEK (11aa)
  •    Q5SQX6    Asn-441     Cytoplasmic FMR1-interacting protein 2 / Mus musculus
• NNVITINITGK (11aa)
  •    P16278    Asn-464     Beta-galactosidase / Homo sapiens
• GVFITNETGQPIIGK (15aa)
  •    P10253    Asn-470     Lysosomal alpha-glucosidase / Homo sapiens
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478     Neural cell adhesion molecule L1 / Mus musculus
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KYWCKWNNTGCQALPSQDEGPSKA (24aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• NETHFDAGAK (10aa)
  •    P09470    Asn-514     Angiotensin-converting enzyme / Mus musculus
• SDINPANGSYPFQAIR (16aa)
  •    Q8NHP8    Asn-515     Putative phospholipase B-like 2 / Homo sapiens
• FHIPNVTPYIR (11aa)
  •    P09470    Asn-528     Angiotensin-converting enzyme / Mus musculus
• SISENATATAAPK (13aa)
  •    Q9UBS9    Asn-530     SUN domain-containing ossification factor / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• KAAIPSALDTNSSKS (15aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• ISKINNTHALVSLLQNLNK (19aa)
  •    Q9WTR5    Asn-638     Cadherin-13 / Mus musculus
• NCSAACPGLQLSNNPVK (17aa)
  •    P05107    Asn-642     Integrin beta-2 / Homo sapiens
• KFDVNQIQNTTIK (13aa)
  •    P12821    Asn-714     Angiotensin-converting enzyme / Homo sapiens
• NFTIS (5aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NVTAQICIDK (10aa)
  •    P12109    Asn-804     Collagen alpha-1(VI) chain / Homo sapiens
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
  •    P01023    Asn-869     Alpha-2-macroglobulin / Homo sapiens
• ANVTSENNMPR (11aa)
  •    P11215    Asn-900     Integrin alpha-M / Homo sapiens
• ENQNHSYSIK (10aa)
  •    P06756    Asn-945     Integrin alpha-V / Homo sapiens
• NCTDIDECR (9aa)
  •    Q75N90    Asn-1025     Fibrillin-3 / Homo sapiens
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
  •    P35556    Asn-1112     Fibrillin-2 / Homo sapiens
• GNLSFDWYIK (10aa)
  •    P11215    Asn-1050     Integrin alpha-M / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
• GEYFVNVTTR (10aa)
  •    P17301    Asn-1074     Integrin alpha-2 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VSNGTHWF (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• TANETSAEAYNLLLR (15aa)
  •    P02468    Asn-1203     Laminin subunit gamma-1 / Mus musculus
• IICDNADNITR (11aa)
  •    Q92626    Asn-1280     Peroxidasin homolog / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007     Matrix-remodeling-associated protein 5 / Homo sapiens
• VFANGTIVVK (10aa)
  •    Q9NR99    Asn-2203     Matrix-remodeling-associated protein 5 / Homo sapiens
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500     Matrix-remodeling-associated protein 5 / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• VSIIDNGTITVR (12aa)
  •    Q9NR99    Asn-2693     Matrix-remodeling-associated protein 5 / Homo sapiens
• LNGTDPIVAADSK (13aa)
  •    Q07954    Asn-4075     Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens