taxonomy (16)
protein (130)
source (43)
structure (17)
composition (1)
disease (13)
reference (49)
site (175)
peptide (148)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Desmodus rotundus (Common vampire bat)
- Mus musculus (House mouse)
- Rattus norvegicus (Norway rat)
- Rana pipiens (Northern leopard frog)
- Nicotiana tabacum (Common tobacco)
- Gallus gallus (Chicken)
- Megathura crenulata (Californian giant keyhole limpet)
- Friend murine leukemia virus (F-mulv)
- Human immunodeficiency virus type 1 (HIV-1)
- Human immunodeficiency virus type 1 (lw12.3 isolate)
- Armoracia rusticana (Horseradish)
- Marburg virus (strain musoke)
- Human betacoronavirus 2c EMC/2012
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-n-acetylgalactosaminidase / Homo sapiens P17050
- Angiotensin-converting enzyme / Homo sapiens P12821
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein B-100 / Homo sapiens P04114
- Attractin / Homo sapiens O75882
- Beta-galactosidase / Homo sapiens P16278
- Biglycan / Homo sapiens P21810
- Bile-salt-activated lipase / Homo sapiens P19835
- Carboxypeptidase Q / Homo sapiens Q9Y646
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Cartilage intermediate layer protein 1 / Homo sapiens O75339
- Cathepsin D / Homo sapiens P07339
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens P20645
- CD166 antigen / Homo sapiens Q13740
- Clusterin / Homo sapiens P10909
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens Q11201
- Coagulation factor V / Homo sapiens P12259
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Collagen alpha-2(VI) chain / Homo sapiens P12110
- Complement c3 / Homo sapiens P01024
- Decorin / Homo sapiens P07585
- Deoxyribonuclease-2-alpha / Homo sapiens O00115
- Dipeptidyl peptidase 1 / Homo sapiens P53634
- Fibrillin-1 / Homo sapiens P35555
- Fibrillin-2 / Homo sapiens P35556
- Fibrillin-3 / Homo sapiens Q75N90
- Fibronectin / Homo sapiens P02751
- Galectin-3-binding protein / Homo sapiens Q08380
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens P13284
- Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens P01215
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens P01857
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Integrin alpha-2 / Homo sapiens P17301
- Integrin alpha-M / Homo sapiens P11215
- Integrin alpha-V / Homo sapiens P06756
- Integrin beta-2 / Homo sapiens P05107
- Junctional adhesion molecule c / Homo sapiens Q9BX67
- KDEL motif-containing protein 2 / Homo sapiens Q7Z4H8
- Lactadherin / Homo sapiens Q08431
- Lactotransferrin / Homo sapiens P02788
- Leukocyte surface antigen CD47 / Homo sapiens Q08722
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Lysosomal alpha-glucosidase / Homo sapiens P10253
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix-remodeling-associated protein 5 / Homo sapiens Q9NR99
- Monocyte differentiation antigen cd14 / Homo sapiens P08571
- Mucolipin-3 / Homo sapiens Q8TDD5
- Myelin protein zero-like protein 1 / Homo sapiens O95297
- N-acetylglucosamine-6-sulfatase / Homo sapiens P15586
- Neurocan core protein / Homo sapiens O14594
- Palmitoyl-protein thioesterase 1 / Homo sapiens P50897
- Periostin / Homo sapiens Q15063
- Peroxidasin homolog / Homo sapiens Q92626
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Probable lysosomal cobalamin transporter / Homo sapiens Q9NUN5
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens Q07954
- Prorenin / Homo sapiens P00797
- Prosaposin / Homo sapiens P07602
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Protein CREG1 / Homo sapiens O75629
- Putative phospholipase B-like 2 / Homo sapiens Q8NHP8
- Receptor-type tyrosine-protein phosphatase C / Homo sapiens P08575
- Rhodopsin / Homo sapiens P08100
- Secreted frizzled-related protein 4 / Homo sapiens Q6FHJ7
- Serpin h1 / Homo sapiens P50454
- Sparc / Homo sapiens P09486
- SUN domain-containing ossification factor / Homo sapiens Q9UBS9
- Sushi domain-containing protein 2 / Homo sapiens Q9UGT4
- Synaptophysin-like protein 1 / Homo sapiens Q16563
- Tetraspanin-3 / Homo sapiens O60637
- Thrombospondin-1 / Homo sapiens P07996
- Thrombospondin-2 / Homo sapiens P35442
- Thyroglobulin / Homo sapiens P01266
- Transferrin receptor protein 1 / Homo sapiens P02786
- Transmembrane protein 87A / Homo sapiens Q8NBN3
- Uromodulin / Homo sapiens P07911
- Vesicle-trafficking protein SEC22b / Homo sapiens O75396
- Vitronectin / Homo sapiens P04004
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Platelet glycoprotein IV / Bos taurus P26201
- Ribonuclease pancreatic [b] / Bos taurus P61823
- Uncharacterized protein (gene name abca4) / Bos taurus F1MWM0
- Salivary plasminogen activator alpha 1 / Desmodus rotundus P98119
- Aminopeptidase N / Mus musculus P97449
- Angiotensin-converting enzyme / Mus musculus P09470
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Cadherin-13 / Mus musculus Q9WTR5
- Cation-dependent mannose-6-phosphate receptor / Mus musculus P24668
- Cytoplasmic FMR1-interacting protein 2 / Mus musculus Q5SQX6
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- DNA mismatch repair protein Mlh1 / Mus musculus Q9JK91
- Ephrin-A4 / Mus musculus O08542
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus P62812
- Junctional adhesion molecule C / Mus musculus Q9D8B7
- Laminin subunit gamma-1 / Mus musculus P02468
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Protein disulfide-isomerase TMX3 / Mus musculus Q8BXZ1
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium channel subunit beta-1 / Mus musculus P97952
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Solute carrier family 12 member 9 / Mus musculus Q99MR3
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus P08289
- T-cell surface glycoprotein cd4 / Rattus norvegicus P05540
- Rhodopsin / Rana pipiens P31355
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012 K0BRG7
- Uncharacterized protein / Nicotiana tabacum
- Ovalbumin / Gallus gallus P01012
- Hemocyanin / Megathura crenulata Q10584 Q10583
- Envelope glycoprotein / Friend murine leukemia virus P03395
- Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate) Q70626
- Peroxidase c / Armoracia rusticana
- Structural glycoprotein / Marburg virus (strain musoke) P35253
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Colon (UBERON_0001155)
- Hemolymph (UBERON_0001011)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Prefrontal Cortex (UBERON:0000451)
- Retina (UBERON_0000966)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BT-474 (CVCL_0179)
- BTI-Tn-5B1-4 (CVCL_C190)
- CHO-S (CVCL_7183)
- Detroit 551 (CVCL_2434)
- Eveline (CVCL_A1LI)
- FreeStyle 293-F (CVCL_D603)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- HEK293SF-3F6 (CVCL_4V95)
- HT-1080 (CVCL_0317)
- LS174T (CVCL_1384)
- MCF-7 (CVCL_0031)
- SK-BR-3 (CVCL_0033)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Leukocyte (CL_0000738)
- Low-Density Lipoprotein Particle (GO_0034362)
Source
- N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 939
- N-Linked / Hybrid / Gal(b1-3)GlcNAc(b1-4)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9403
- N-Linked / Hybrid / Structure 9669
- N-Linked / Hybrid / Structure 10023
- N-Linked / Hybrid / Structure 10699
- N-Linked / Hybrid / Structure 10953
- N-Linked / Hybrid / Structure 11167
- N-Linked / Hybrid / Structure 11478
- N-Linked / Hybrid / Structure 11818
- N-Linked / Hybrid / Structure 11890
Reported structure
- Hex:6 HexNAc:3 (avg mass : 1600.4547 )
Composition
- Cancer, breast (DOID:1612)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Middle East respiratory syndrome (DOID:0080642)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
Disease
- Differential N- and O-glycosylation signatures of HIV-1 Gag virus-like particles and coproduced extracellular vesicles (2022 - Lavado-García J, Zhang T, Cervera L, Gòdia F, Wuhrer M) / Status : Reviewed
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Malignant tissues produce divergent antibody glycosylation of relevance for cancer gene therapy effectiveness. (2020 - Brücher D, Franc V, Smith SN, Heck AJR, Plückthun A) / Status : Reviewed
- Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- In vivo conversion of a glycan to human compatible type by transformed tobacco cells (2001 - Fujiyama, Palacpac, Sakai, Kimura, Shinmyo, Yoshida, Seki) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Analysis of carbohydrate heterogeneity in a glycoprotein using liquid chromatography/mass spectrometry and liquid chromatography with tandem mass spectrometry. (1999 - Kawasaki N, Ohta M, Hyuga S, Hashimoto O, Hayakawa T) / Status : Reviewed
- Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
- Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
Reference
- Alpha-2-macroglobulin / Homo sapiens
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
- Asn-124
- Angiotensin-converting enzyme / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
- Attractin / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Biglycan / Homo sapiens
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
- Carboxypeptidase Q / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- CD166 antigen / Homo sapiens
- Clusterin / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Complement c3 / Homo sapiens
- Decorin / Homo sapiens
- Deoxyribonuclease-2-alpha / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibronectin / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-340
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- Asn-46
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Junctional adhesion molecule c / Homo sapiens
- KDEL motif-containing protein 2 / Homo sapiens
- Lactadherin / Homo sapiens
- Lactotransferrin / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Mucolipin-3 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
-
Prorenin / Homo sapiens
- Undefined site
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein CREG1 / Homo sapiens
- Putative phospholipase B-like 2 / Homo sapiens
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
- Secreted frizzled-related protein 4 / Homo sapiens
- Serpin h1 / Homo sapiens
- Sparc / Homo sapiens
- SUN domain-containing ossification factor / Homo sapiens
- Sushi domain-containing protein 2 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Thyroglobulin / Homo sapiens
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
- Transmembrane protein 87A / Homo sapiens
- Uromodulin / Homo sapiens
- Vesicle-trafficking protein SEC22b / Homo sapiens
- Vitronectin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
- Ribonuclease pancreatic [b] / Bos taurus
- Uncharacterized protein (gene name abca4) / Bos taurus
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
- Aminopeptidase N / Mus musculus
- Angiotensin-converting enzyme / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- Cytoplasmic FMR1-interacting protein 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- DNA mismatch repair protein Mlh1 / Mus musculus
- Ephrin-A4 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Junctional adhesion molecule C / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 9 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
- Rhodopsin / Rana pipiens
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
Hemocyanin / Megathura crenulata
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Peroxidase c / Armoracia rusticana
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- NSGALTSGVHTFPAVLQSSGLY (22aa)
- QCVNLTTR (8aa)
- HPIYWNSSNPR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- DVNCSVMGPQEK (12aa)
- LKPLFNK (7aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- WKLNK (5aa)
- NTTIFLK (7aa)
- LIQIQDNGTGIR (12aa)
- NKSVLLGR (8aa)
- NK (2aa)
- GQTEIQVNCPPAVTENK (17aa)
- DIYTFDGAINK (11aa)
- HAIHVSGTNGTK (12aa)
- ANTTQPGIVEGGQVIK (16aa)
- NQNGTFK (7aa)
- FNQTMQPIITAQNAIIEDDTYR (22aa)
- DNATEEEILVYLEK (14aa)
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- EILNVTLVPYGNAQEQNVSGR (21aa)
- LVMEILNVTLVPYGNAQEQNVSGR (24aa)
- GHTITINFTR (10aa)
- VCSNDNK (7aa)
- FLEPYNDSIQAQK (13aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- HINFTR (6aa)
- ANATLLLGPLR (11aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- FGCEIENNR (9aa)
- KLNYTLK (7aa)
- DASINIENMQFIHNGTYICDVK (22aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- LLFFDNYEHNTSVVK (15aa)
- SVAHNMTMPNK (11aa)
- GTFTDCALANMTEQIR (16aa)
- RLRNVSWATGRS (12aa)
- RNVSWATGRS (10aa)
- RACQFNR (7aa)
- VNETEMDIAK (10aa)
- SEIVNETR (8aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VCFPNK (6aa)
- NQSVPISCCR (10aa)
- VNFTCK (6aa)
- ANNLSSLSK (9aa)
- PREEQFNSTYR (11aa)
- TKPREEQFNSTYR (13aa)
- EEQFNSTYR (9aa)
- IVVYNQPYINYSR (13aa)
- GSKNVSSE (8aa)
- FQNSSFHVNSETGTLVFNAVHK (22aa)
- NYSYVIHAK (9aa)
- NHSIFLADINQER (13aa)
- NLTLDFHR (8aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- GINESYKK (8aa)
- TNSTFVQALVEHVK (14aa)
- IVTPEEYYNVTV (12aa)
- FNHTQTIQQK (10aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- WSCDHKQNITYLLK (14aa)
- GINIT (5aa)
- FHVNYTQPLVAVK (13aa)
- NNSIPDK (7aa)
- KFHVNYTQPLVAVK (14aa)
- HGHFTGFNGSTLR (13aa)
- GIANLSNFIR (10aa)
- IININPNK (8aa)
- LVAIAVIDEKNTSLEHTR (18aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- TVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSK (39aa)
- MIENGSISFIPTIR (14aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- TPMTNSSIQFIDNAFRK (17aa)
- GVTNDIISIQGNTGPSWINK (20aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- LIDNNK (6aa)
- IIDNNKTEK (9aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- VFNATR (6aa)
- YFWYHNDTLLDPSLYK (16aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GPGIKPNQTSK (11aa)
- IANITQGEDQYYIR (14aa)
- NLEKNSTK (8aa)
- VFHIHNESWVLLTPK (15aa)
- NYTDCTSEGR (10aa)
- ATRYNYTSEEK (11aa)
- NNVITINITGK (11aa)
- GVFITNETGQPIIGK (15aa)
- FFPYANGTLSIR (12aa)
- IIISPEENVTITCTAENQIER (21aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- CEGPGVPTVTVHNTTDK (17aa)
- NETHFDAGAK (10aa)
- SDINPANGSYPFQAIR (16aa)
- FHIPNVTPYIR (11aa)
- SISENATATAAPK (13aa)
- RHEEGHMINCTCFGQGR (17aa)
- KAAIPSALDTNSSKS (15aa)
- EVNDTLLVNELK (12aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- ISKINNTHALVSLLQNLNK (19aa)
- NCSAACPGLQLSNNPVK (17aa)
- KFDVNQIQNTTIK (13aa)
- NFTIS (5aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
- ANVTSENNMPR (11aa)
- ENQNHSYSIK (10aa)
- NCTDIDECR (9aa)
- GNLSFDWYIK (10aa)
- VVNSTTGPGEHIR (13aa)
- CDSGFALDSEERNCTDIDECR (21aa)
- GEYFVNVTTR (10aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- VNSSLHSQISR (11aa)
- TANETSAEAYNLLLR (15aa)
- IICDNADNITR (11aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- VFANGTIVVK (10aa)
- ITVHGNGSLDIR (12aa)
- MIEAYNITEK (10aa)
- VSIIDNGTITVR (12aa)
- LNGTDPIVAADSK (13aa)
Mass spectrometry observed peptide
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Retina (UBERON_0000966)
- Rhodopsin / Rana pipiens
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Mammary Gland (UBERON_0001911)
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Bone Marrow (UBERON_0002371)
- Colon (UBERON_0001155)
- Kidney (UBERON_0002113)
- Liver (UBERON_0002107) AH130 (CVCL_4367)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
- Ovary (UBERON_0000992)
- Pancreas (UBERON_0001264)
- Placenta (UBERON_0001987)
- Retina (UBERON_0000966)
- Urine (UBERON_0001088)
- Eveline (CVCL_A1LI)
- H9 (CVCL_1240) Lymphocyte (CL_0000542)
- HEK293 (CVCL_0045)
- HEK293-F (CVCL_6642)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Egg Cell
- Leukocyte (CL_0000738)
- Carcinoma, Hepatocellular (DOID:684)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Leukemia, Acute lymphoblastic (DOID:9952)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Glycan Profile Analysis of Engineered Trastuzumab with Rationally Added Glycosylation Sequons Presents Significantly Increased Glycan Complexity. (2021 - Cruz E, Sifniotis V, Sumer-Bayraktar Z, Reslan M, Wilkinson-White L, Cordwell S, Kayser V) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- In vivo conversion of a glycan to human compatible type by transformed tobacco cells (2001 - Fujiyama, Palacpac, Sakai, Kimura, Shinmyo, Yoshida, Seki) / Status : Reviewed
- Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
- Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
- Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
- Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
- Analysis of carbohydrate heterogeneity in a glycoprotein using liquid chromatography/mass spectrometry and liquid chromatography with tandem mass spectrometry. (1999 - Kawasaki N, Ohta M, Hyuga S, Hashimoto O, Hayakawa T) / Status : Reviewed
- Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
- Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
- Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
- Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
- The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
- Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
- Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
- Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
- Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
- Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
- Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Bile-salt-activated lipase / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant L182N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 (Trastuzumab) mutant Q178N / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Prorenin / Homo sapiens
- Undefined site
-
Receptor-type tyrosine-protein phosphatase C / Homo sapiens
- Undefined site
-
Rhodopsin / Homo sapiens
- Undefined site
-
Transferrin receptor protein 1 / Homo sapiens
- Undefined site
-
Platelet glycoprotein IV / Bos taurus
- Undefined site
- Ribonuclease pancreatic [b] / Bos taurus
-
Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
- Undefined site
-
T-cell surface glycoprotein cd4 / Rattus norvegicus
- Undefined site
-
Uncharacterized protein / Nicotiana tabacum
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Envelope glycoprotein / Friend murine leukemia virus
-
Surface protein gp120 / Human immunodeficiency virus type 1 (lw12.3 isolate)
- Undefined site
-
Peroxidase c / Armoracia rusticana
- Undefined site
-
Structural glycoprotein / Marburg virus (strain musoke)
- Undefined site
- NSGALTSGVHTFPAVLQSSGLY (22aa)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Blood Plasma (UBERON_0001969)
- Vitronectin / Homo sapiens
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Hemolymph (UBERON_0001011)
-
Hemocyanin / Megathura crenulata
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Salivary plasminogen activator alpha 1 / Desmodus rotundus
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Ovary (UBERON_0000992) CHO-DG44 (CVCL_7180)
-
Alpha-n-acetylgalactosaminidase / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Milk (UBERON_0001913)
- Complement c3 / Homo sapiens
- Galectin-3-binding protein / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Monocyte differentiation antigen cd14 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- KTVLTPATNHMGNVTFTIPANRE (23aa)
- RNVSWATGRS (10aa)
- RLRNVSWATGRS (12aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- KAAIPSALDTNSSKS (15aa)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VFNATR (6aa)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Coagulation factor V / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Blood Plasma (UBERON_0001969)
- Control/Healthy
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- Colon (UBERON_0001155)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- HEK293SF-3F6 (CVCL_4V95)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
- BT-474 (CVCL_0179)
- CHO-S (CVCL_7183)
- Detroit 551 (CVCL_2434)
- HT-1080 (CVCL_0317)
- MCF-7 (CVCL_0031)
- SK-BR-3 (CVCL_0033)
- PREEQFNSTYR (11aa)
- EEQFNSTYR (9aa)
- TKPREEQFNSTYR (13aa)
-
- N-Linked / Hybrid
(avg mass : 1600.4547)
-
- Hex:6 HexNAc:3 / N-Linked
(avg mass : 1600.4547)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Retina (UBERON_0000966)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- FreeStyle 293-F (CVCL_D603)
- N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 939
- N-Linked / Hybrid / Gal(b1-3)GlcNAc(b1-4)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Hybrid / Structure 9403
- N-Linked / Hybrid / Structure 9669
- N-Linked / Hybrid / Structure 10023
- N-Linked / Hybrid / Structure 10699
- N-Linked / Hybrid / Structure 10953
- N-Linked / Hybrid / Structure 11167
- N-Linked / Hybrid / Structure 11478
- N-Linked / Hybrid / Structure 11818
- N-Linked / Hybrid / Structure 11890
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-n-acetylgalactosaminidase / Homo sapiens
- Angiotensin-converting enzyme / Homo sapiens
- Attractin / Homo sapiens
- Beta-galactosidase / Homo sapiens
- Biglycan / Homo sapiens
- Carboxypeptidase Q / Homo sapiens
- Cartilage intermediate layer protein 1 / Homo sapiens
- Cathepsin D / Homo sapiens
- Cation-dependent mannose-6-phosphate receptor / Homo sapiens
- CD166 antigen / Homo sapiens
- Clusterin / Homo sapiens
- CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Collagen alpha-2(VI) chain / Homo sapiens
- Decorin / Homo sapiens
- Deoxyribonuclease-2-alpha / Homo sapiens
- Dipeptidyl peptidase 1 / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrillin-2 / Homo sapiens
- Fibrillin-3 / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin alpha-2 / Homo sapiens
- Integrin alpha-M / Homo sapiens
- Integrin alpha-V / Homo sapiens
- Integrin beta-2 / Homo sapiens
- Junctional adhesion molecule c / Homo sapiens
- KDEL motif-containing protein 2 / Homo sapiens
- Lactadherin / Homo sapiens
- Leukocyte surface antigen CD47 / Homo sapiens
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Lysosomal alpha-glucosidase / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Matrix-remodeling-associated protein 5 / Homo sapiens
- Mucolipin-3 / Homo sapiens
- Myelin protein zero-like protein 1 / Homo sapiens
- N-acetylglucosamine-6-sulfatase / Homo sapiens
- Neurocan core protein / Homo sapiens
- Palmitoyl-protein thioesterase 1 / Homo sapiens
- Periostin / Homo sapiens
- Peroxidasin homolog / Homo sapiens
- Probable lysosomal cobalamin transporter / Homo sapiens
- Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
- Prosaposin / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Protein CREG1 / Homo sapiens
- Putative phospholipase B-like 2 / Homo sapiens
- Secreted frizzled-related protein 4 / Homo sapiens
- Serpin h1 / Homo sapiens
- Sparc / Homo sapiens
- SUN domain-containing ossification factor / Homo sapiens
- Sushi domain-containing protein 2 / Homo sapiens
- Synaptophysin-like protein 1 / Homo sapiens
- Tetraspanin-3 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thrombospondin-2 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane protein 87A / Homo sapiens
- Uromodulin / Homo sapiens
- Vesicle-trafficking protein SEC22b / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- Uncharacterized protein (gene name abca4) / Bos taurus
- Aminopeptidase N / Mus musculus
- Angiotensin-converting enzyme / Mus musculus
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Cation-dependent mannose-6-phosphate receptor / Mus musculus
- Cytoplasmic FMR1-interacting protein 2 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- DNA mismatch repair protein Mlh1 / Mus musculus
- Ephrin-A4 / Mus musculus
- Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
- Junctional adhesion molecule C / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Protein disulfide-isomerase TMX3 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium channel subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Solute carrier family 12 member 9 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- HPIYWNSSNPR (11aa)
- HENNTKDNSIQHEFSLTR (18aa)
- DVNCSVMGPQEK (12aa)
- LKPLFNK (7aa)
- LRPLFNK (7aa)
- FSNVTWF (7aa)
- WKLNK (5aa)
- NTTIFLK (7aa)
- LIQIQDNGTGIR (12aa)
- NKSVLLGR (8aa)
- GQTEIQVNCPPAVTENK (17aa)
- DIYTFDGAINK (11aa)
- HAIHVSGTNGTK (12aa)
- ANTTQPGIVEGGQVIK (16aa)
- NQNGTFK (7aa)
- FNQTMQPIITAQNAIIEDDTYR (22aa)
- DNATEEEILVYLEK (14aa)
- EILNVTLVPYGNAQEQNVSGR (21aa)
- LVMEILNVTLVPYGNAQEQNVSGR (24aa)
- GHTITINFTR (10aa)
- VCSNDNK (7aa)
- FLEPYNDSIQAQK (13aa)
- VTTYCNETMTGWVHDVIGR (19aa)
- HINFTR (6aa)
- ANATLLLGPLR (11aa)
- IVNNATNVVIK (11aa)
- TQSLLIVNNATNVVIK (16aa)
- IVNNATNVVIKVCEF (15aa)
- LGIYADMGNFTCMGYPGTTLDK (22aa)
- FGCEIENNR (9aa)
- KLNYTLK (7aa)
- DASINIENMQFIHNGTYICDVK (22aa)
- NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
- LLFFDNYEHNTSVVK (15aa)
- SVAHNMTMPNK (11aa)
- GTFTDCALANMTEQIR (16aa)
- RACQFNR (7aa)
- VNETEMDIAK (10aa)
- SEIVNETR (8aa)
- SSANNCTF (8aa)
- SSANNCTFEY (10aa)
- VCFPNK (6aa)
- NQSVPISCCR (10aa)
- VNFTCK (6aa)
- ANNLSSLSK (9aa)
- IVVYNQPYINYSR (13aa)
- GSKNVSSE (8aa)
- FQNSSFHVNSETGTLVFNAVHK (22aa)
- NYSYVIHAK (9aa)
- NHSIFLADINQER (13aa)
- NLTLDFHR (8aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- GINESYKK (8aa)
- TNSTFVQALVEHVK (14aa)
- IVTPEEYYNVTV (12aa)
- FNHTQTIQQK (10aa)
- CNTAAPMWLNGTHPSSDEGIVSR (23aa)
- FINDSIVDPVDSEWFGFYR (19aa)
- WSCDHKQNITYLLK (14aa)
- GINIT (5aa)
- FHVNYTQPLVAVK (13aa)
- NNSIPDK (7aa)
- KFHVNYTQPLVAVK (14aa)
- HGHFTGFNGSTLR (13aa)
- GIANLSNFIR (10aa)
- IININPNK (8aa)
- LVAIAVIDEKNTSLEHTR (18aa)
- GSISYINVTR (10aa)
- GSLSYLNVTRK (11aa)
- TVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSK (39aa)
- MIENGSISFIPTIR (14aa)
- ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
- TPMTNSSIQFIDNAFRK (17aa)
- GVTNDIISIQGNTGPSWINK (20aa)
- FFAENETWVVDSCTTCTCK (19aa)
- RFPNIT (6aa)
- LIDNNK (6aa)
- IIDNNKTEK (9aa)
- YFWYHNDTLLDPSLYK (16aa)
- VQPFNVTQGK (10aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- GPGIKPNQTSK (11aa)
- IANITQGEDQYYIR (14aa)
- NLEKNSTK (8aa)
- VFHIHNESWVLLTPK (15aa)
- NYTDCTSEGR (10aa)
- ATRYNYTSEEK (11aa)
- NNVITINITGK (11aa)
- GVFITNETGQPIIGK (15aa)
- FFPYANGTLSIR (12aa)
- IIISPEENVTITCTAENQIER (21aa)
- CEGPGVPTVTVHNTTDK (17aa)
- NETHFDAGAK (10aa)
- SDINPANGSYPFQAIR (16aa)
- FHIPNVTPYIR (11aa)
- SISENATATAAPK (13aa)
- RHEEGHMINCTCFGQGR (17aa)
- EVNDTLLVNELK (12aa)
- VITPGTNTS (9aa)
- LYQDVNCT (8aa)
- ISKINNTHALVSLLQNLNK (19aa)
- NCSAACPGLQLSNNPVK (17aa)
- KFDVNQIQNTTIK (13aa)
- NFTIS (5aa)
- FGGFNFS (7aa)
- NVTAQICIDK (10aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
- ANVTSENNMPR (11aa)
- ENQNHSYSIK (10aa)
- NCTDIDECR (9aa)
- GNLSFDWYIK (10aa)
- VVNSTTGPGEHIR (13aa)
- CDSGFALDSEERNCTDIDECR (21aa)
- GEYFVNVTTR (10aa)
- VPAQEKNF (8aa)
- VPAQEKNFTTAPAICHDGK (19aa)
- NFTTAPAICHDGK (13aa)
- EGVFVSNGTHW (11aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- VSNGTHW (7aa)
- VSNGTHWF (8aa)
- VNSSLHSQISR (11aa)
- TANETSAEAYNLLLR (15aa)
- IICDNADNITR (11aa)
- NLQVYNATSNSLTVK (15aa)
- ITLHENR (7aa)
- VFANGTIVVK (10aa)
- ITVHGNGSLDIR (12aa)
- MIEAYNITEK (10aa)
- VSIIDNGTITVR (12aa)
- LNGTDPIVAADSK (13aa)
-
- Hex:6 HexNAc:3 / Undefined type
(avg mass : 1600.4547)
- HEK293 (CVCL_0045)
-
Recombinant Spike glycoprotein (HEK293) - RBD domain / Human betacoronavirus 2c EMC/2012
- Undefined site
Source
Suggested structure
Reported glycosite
- Hex:6 HexNAc:3 / Undefined type
(avg mass : 1600.4547)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:6 HexNAc:3 / N-Linked
(avg mass : 1600.4547)
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Disease
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1600.4547)