Hex:6 HexNAc:3

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Desmodus rotundus (Common vampire bat)
• Mus musculus (House mouse)
• Rattus norvegicus (Norway rat)
• Rana pipiens (Northern leopard frog)
• Nicotiana tabacum (Common tobacco)
• Gallus gallus (Chicken)
• Megathura crenulata (Californian giant keyhole limpet)
• Friend murine leukemia virus (F-mulv)
• Human immunodeficiency virus type 1 (lw12.3 isolate)
• Armoracia rusticana (Horseradish)
• Marburg virus (strain musoke)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-n-acetylgalactosaminidase / Homo sapiens    P17050
• Angiotensin-converting enzyme / Homo sapiens    P12821
• Apolipoprotein b-100 / Homo sapiens    P04114
• Beta-galactosidase / Homo sapiens    P16278
• Biglycan / Homo sapiens    P21810
• Bile-salt-activated lipase / Homo sapiens    P19835
• Carboxypeptidase Q / Homo sapiens    Q9Y646
• Cartilage intermediate layer protein 1 / Homo sapiens    O75339
• Cathepsin D / Homo sapiens    P07339
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens    P20645
• CD166 antigen / Homo sapiens    Q13740
• Clusterin / Homo sapiens    P10909
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens    Q11201
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Decorin / Homo sapiens    P07585
• Deoxyribonuclease-2-alpha / Homo sapiens    O00115
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Fibrillin-1 / Homo sapiens    P35555
• Fibrillin-2 / Homo sapiens    P35556
• Fibrillin-3 / Homo sapiens    Q75N90
• Fibronectin / Homo sapiens    P02751
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens    P01215
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Integrin alpha-2 / Homo sapiens    P17301
• Integrin alpha-M / Homo sapiens    P11215
• Integrin alpha-V / Homo sapiens    P06756
• Integrin beta-2 / Homo sapiens    P05107
• Junctional adhesion molecule c / Homo sapiens    Q9BX67
• KDEL motif-containing protein 2 / Homo sapiens    Q7Z4H8
• Lactadherin / Homo sapiens    Q08431
• Leukocyte surface antigen CD47 / Homo sapiens    Q08722
• Lysosomal alpha-glucosidase / Homo sapiens    P10253
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix-remodeling-associated protein 5 / Homo sapiens    Q9NR99
• Mucolipin-3 / Homo sapiens    Q8TDD5
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• N-acetylglucosamine-6-sulfatase / Homo sapiens    P15586
• Neurocan core protein / Homo sapiens    O14594
• Palmitoyl-protein thioesterase 1 / Homo sapiens    P50897
• Periostin / Homo sapiens    Q15063
• Peroxidasin homolog / Homo sapiens    Q92626
• Probable lysosomal cobalamin transporter / Homo sapiens    Q9NUN5
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens    Q07954
• Prorenin / Homo sapiens    P00797
• Prosaposin / Homo sapiens    P07602
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Protein CREG1 / Homo sapiens    O75629
• Putative phospholipase B-like 2 / Homo sapiens    Q8NHP8
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens    P08575
• Rhodopsin / Homo sapiens    P08100
• Secreted frizzled-related protein 4 / Homo sapiens    Q6FHJ7
• Serpin h1 / Homo sapiens    P50454
• Sparc / Homo sapiens    P09486
• SUN domain-containing ossification factor / Homo sapiens    Q9UBS9
• Sushi domain-containing protein 2 / Homo sapiens    Q9UGT4
• Synaptophysin-like protein 1 / Homo sapiens    Q16563
• Tetraspanin-3 / Homo sapiens    O60637
• Thrombospondin-1 / Homo sapiens    P07996
• Thrombospondin-2 / Homo sapiens    P35442
• Thyroglobulin / Homo sapiens    P01266
• Transferrin receptor protein 1 / Homo sapiens    P02786
• Transmembrane protein 87A / Homo sapiens    Q8NBN3
• Uromodulin / Homo sapiens    P07911
• Vesicle-trafficking protein SEC22b / Homo sapiens    O75396
• Vitronectin / Homo sapiens    P04004
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Platelet glycoprotein IV / Bos taurus    P26201
• Ribonuclease pancreatic [b] / Bos taurus    P61823
• Uncharacterized protein (gene name abca4) / Bos taurus    F1MWM0
• Salivary plasminogen activator alpha 1 / Desmodus rotundus    P98119
• Aminopeptidase N / Mus musculus    P97449
• Angiotensin-converting enzyme / Mus musculus    P09470
• BDNF/NT-3 growth factors receptor / Mus musculus    P15209
• Cadherin-13 / Mus musculus    Q9WTR5
• Cation-dependent mannose-6-phosphate receptor / Mus musculus    P24668
• Cytoplasmic FMR1-interacting protein 2 / Mus musculus    Q5SQX6
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• DNA mismatch repair protein Mlh1 / Mus musculus    Q9JK91
• Ephrin-A4 / Mus musculus    O08542
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus    P62812
• Junctional adhesion molecule C / Mus musculus    Q9D8B7
• Laminin subunit gamma-1 / Mus musculus    P02468
• Leukocyte surface antigen CD47 / Mus musculus    Q61735
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Oligodendrocyte-myelin glycoprotein / Mus musculus    Q63912
• Protein disulfide-isomerase TMX3 / Mus musculus    Q8BXZ1
• Signal-regulatory protein alpha / Mus musculus    P97797
• Sodium channel subunit beta-1 / Mus musculus    P97952
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus    P14231
• Solute carrier family 12 member 9 / Mus musculus    Q99MR3
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus    P08289
• T-cell surface glycoprotein cd4 / Rattus norvegicus    P05540
• Rhodopsin / Rana pipiens    P31355
• Uncharacterized protein from Undefined tissue / Nicotiana tabacum
• Ovalbumin / Gallus gallus    P01012
• Hemocyanin / Megathura crenulata    Q10583    Q10584
• Knob protein gp70 / Friend murine leukemia virus    P03395
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)    Q70626
• Peroxidase c / Armoracia rusticana
• Structural glycoprotein / Marburg virus (strain musoke)    P35253
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Hemolymph (UBERON_0001011)  
• Kidney (UBERON_0002113)  
• Liver (UBERON_0002107)   AH130 (CVCL_4367)  
• Mammary Gland (UBERON_0001911)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO-DG44 (CVCL_7180)  
• Ovary (UBERON_0000992)  
• Pancreas (UBERON_0001264)  
• Placenta (UBERON_0001987)  
• Retina (UBERON_0000966)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• BTI-Tn-5B1-4 (CVCL_C190)  
• FreeStyle 293-F (CVCL_D603)  
• H9 (CVCL_1240)   Lymphocyte (CL_0000542)  
• HEK293 (CVCL_0045)  
• Egg Cell  
• Leukocyte (CL_0000738)  
• Low-Density Lipoprotein Particle (GO_0034362)  

Reported structure

• N-Linked / Hybrid / Gal(?1-?)GlcNAc(?1-?)Man(a1-?)[Man(?1-?)[Man(?1-?)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-3)GlcNAc(b1-4)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-2)Man(a1-3)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[Man(a1-3)[Man(a1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 939
• N-Linked / Hybrid / Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[Man(a1-3)[Man(a1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Structure 2477
• N-Linked / Hybrid / Man(a1-2)Man(a1-6)[Man(a1-3)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Hybrid / Man(a1-?)[Man(a1-?)]Man(a1-?)[Gal(b1-?)GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc

Composition

• Hex:6 HexNAc:3 (avg mass : 1600.4547 )

Disease

• Cancer, breast (DOID:1612)
• Carcinoma, Hepatocellular (DOID:684)
• COVID-19 (DOID:0080600)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Hypercholesterolemia, Familial (DOID:13810)
• Leukemia, Acute lymphoblastic (DOID:9952)
• Prostate cancer (DOID:10283)

Reference

• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Identification of 22 N-glycosites on spike glycoprotein of SARS-CoV-2 and accessible surface glycopeptide motifs: Implications for vaccination and antibody therapeutics (2020 - Dapeng Zhou, Xiaoxu Tian, Ruibing Qi, Chao Peng, Wen Zhang) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• In-depth analysis of site-specific N-glycosylation in vitronectin from human plasma by tandem mass spectrometry with immunoprecipitation (2014 - Hwang H, Lee JY, Lee HK, Park GW, Jeong HK, Moon MH, Kim JY, Yoo JS.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Reliable determination of site-specific in vivo protein N-glycosylation based on collision-induced MS/MS and chromatographic retention time (2014 - Wang B, Tsybovsky Y, Palczewski K, Chance MR.) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Hemocyanin from the keyhole limpet Megathura crenulata (KLH) carries a novel type of N-glycans with Gal(beta1-6)Man-motifs. (2002 - Kurokawa T, Wuhrer M, Lochnit G, Geyer H, Markl J, Geyer R) / Status : Reviewed
• In vivo conversion of a glycan to human compatible type by transformed tobacco cells (2001 - Fujiyama, Palacpac, Sakai, Kimura, Shinmyo, Yoshida, Seki) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• Human alpha-N-acetylgalactosaminidase: site occupancy and structure of N-linked oligosaccharides. (2000 - Ohta M, Ohnishi T, Ioannou Y, Hodgson M, Matsuura F, Desnick R) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• Analysis of carbohydrate heterogeneity in a glycoprotein using liquid chromatography/mass spectrometry and liquid chromatography with tandem mass spectrometry. (1999 - Kawasaki N, Ohta M, Hyuga S, Hashimoto O, Hayakawa T) / Status : Reviewed
• Oligosaccharide analysis and molecular modeling of soluble forms of glycoproteins belonging to the Ly-6, scavenger receptor, and immunoglobulin superfamilies expressed in Chinese hamster ovary cells. (1999 - Rudd P, Wormald M, Harvey D, Devasahayam M, McAlister M, Brown M, Davis S, Barclay A, Dwek R) / Status : Reviewed
• Stable expression of human beta1,4-galactosyltransferase in plant cells modifies N-linked glycosylation patterns. (1999 - Palacpac N, Yoshida S, Sakai H, Kimura Y, Fujiyama K, Yoshida T, Seki T) / Status : Reviewed
• Analysis of site-specific N-glycosylation of recombinant Desmodus rotundus salivary plasminogen activator rDSPA alpha 1 expressed in Chinese hamster ovary cells. (1997 - Gohlke M, Nuck R, Kannicht C, Grunow D, Baude G, Donner P, Reutter W) / Status : Reviewed
• Comparative study of the sugar chains of alkaline phosphatases purified from rat liver and rat AH-130 hepatoma cells. Occurrence of fucosylated high-mannose-type and hybrid-type sugar chains. (1996 - Endo T, Fujiwara T, Ikehara Y, Kobata A) / Status : Reviewed
• Rapid and simple approach for the NMR resonance assignment of the carbohydrate chains of an intact glycoprotein. Application of gradient-enhanced natural abundance 1H-13C HSQC and HSQC-TOCSY to the alpha-subunit of human chorionic gonadotropin. (1994 - de Beer T, van Zuylen C, Hard K, Boelens R, Kaptein R, Kamerling J, Vliegenthart J) / Status : Reviewed
• Structural studies of the N-linked sugar chains of human rhodopsin. (1994 - Fujita S, Endo T, Ju J, Kean E, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of human leukocyte common antigen CD45. (1993 - Sato T, Furukawa K, Autero M, Gahmberg C, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid. (1993 - Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S) / Status : Reviewed
• The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase. (1993 - Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D) / Status : Reviewed
• Characterization of the oligosaccharide structures on recombinant human prorenin expressed in Chinese hamster ovary cells. (1992 - Aeed P, Guido D, Mathews W, Elhammer A) / Status : Reviewed
• Carbohydrate structure of Marburg virus glycoprotein. (1992 - Geyer H, Will C, Feldmann H, Klenk H, Geyer R) / Status : Reviewed
• Structure of the N-linked oligosaccharides of the human transferrin receptor. (1992 - Orberger G, Geyer R, Stirm S, Tauber R) / Status : Reviewed
• Diversity of oligosaccharide structures on the envelope glycoprotein gp 120 of human immunodeficiency virus 1 from the lymphoblastoid cell line H9. Presence of complex-type oligosaccharides with bisecting N-acetylglucosamine residues. (1990 - Mizuochi T, Matthews T, Kato M, Hamako J, Titani K, Solomon J, Feizi T) / Status : Reviewed
• Oligosaccharides at individual glycosylation sites in glycoprotein 71 of Friend murine leukemia virus. (1990 - Geyer R, Dabrowski J, Dabrowski U, Linder D, Schlter M, Schott H, Stirm S) / Status : Reviewed

Reported glycosite

• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-869
• Alpha-n-acetylgalactosaminidase / Homo sapiens
  •        Undefined site
  •        Asn-124
• Angiotensin-converting enzyme / Homo sapiens
  •        Asn-714
• Apolipoprotein b-100 / Homo sapiens
  •        Undefined site
• Beta-galactosidase / Homo sapiens
  •        Asn-464
• Biglycan / Homo sapiens
  •        Asn-270
• Bile-salt-activated lipase / Homo sapiens
  •        Undefined site
• Carboxypeptidase Q / Homo sapiens
  •        Asn-179
• Cartilage intermediate layer protein 1 / Homo sapiens
  •        Asn-346
• Cathepsin D / Homo sapiens
  •        Asn-134
  •        Asn-263
• Cation-dependent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-57
• CD166 antigen / Homo sapiens
  •        Asn-480
• Clusterin / Homo sapiens
  •        Asn-374
• CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 / Homo sapiens
  •        Asn-79
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-140
• Decorin / Homo sapiens
  •        Asn-211
• Deoxyribonuclease-2-alpha / Homo sapiens
  •        Asn-266
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-53
  •        Asn-119
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Fibrillin-2 / Homo sapiens
  •        Asn-1112
• Fibrillin-3 / Homo sapiens
  •        Asn-1025
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-542
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-95
• Glycoprotein hormones alpha chain - choriogonadotropin / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
• Integrin alpha-2 / Homo sapiens
  •        Asn-1074
• Integrin alpha-M / Homo sapiens
  •        Asn-900
  •        Asn-1050
• Integrin alpha-V / Homo sapiens
  •        Asn-74
  •        Asn-945
• Integrin beta-2 / Homo sapiens
  •        Asn-642
• Junctional adhesion molecule c / Homo sapiens
  •        Asn-104
• KDEL motif-containing protein 2 / Homo sapiens
  •        Asn-306
• Lactadherin / Homo sapiens
  •        Asn-238
• Leukocyte surface antigen CD47 / Homo sapiens
  •        Asn-73
• Lysosomal alpha-glucosidase / Homo sapiens
  •        Asn-470
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-103
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-356
• Matrix-remodeling-associated protein 5 / Homo sapiens
  •        Asn-2007
  •        Asn-2203
  •        Asn-2500
  •        Asn-2693
• Mucolipin-3 / Homo sapiens
  •        Asn-205
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-130
• N-acetylglucosamine-6-sulfatase / Homo sapiens
  •        Asn-279
  •        Asn-362
• Neurocan core protein / Homo sapiens
  •        Asn-122
• Palmitoyl-protein thioesterase 1 / Homo sapiens
  •        Asn-197
  •        Asn-212
  •        Asn-232
• Periostin / Homo sapiens
  •        Asn-599
• Peroxidasin homolog / Homo sapiens
  •        Asn-1280
• Probable lysosomal cobalamin transporter / Homo sapiens
  •        Asn-78
• Prolow-density lipoprotein receptor-related protein 1 / Homo sapiens
  •        Asn-4075
• Prorenin / Homo sapiens
  •        Undefined site
• Prosaposin / Homo sapiens
  •        Asn-80
  •        Asn-215
  •        Asn-332
  •        Asn-426
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Protein CREG1 / Homo sapiens
  •        Asn-160
  •        Asn-216
• Putative phospholipase B-like 2 / Homo sapiens
  •        Asn-515
• Receptor-type tyrosine-protein phosphatase C / Homo sapiens
  •        Undefined site
• Rhodopsin / Homo sapiens
  •        Undefined site
• Secreted frizzled-related protein 4 / Homo sapiens
  •        Asn-194
• Serpin h1 / Homo sapiens
  •        Asn-125
• Sparc / Homo sapiens
  •        Asn-116
• SUN domain-containing ossification factor / Homo sapiens
  •        Asn-530
• Sushi domain-containing protein 2 / Homo sapiens
  •        Asn-162
• Synaptophysin-like protein 1 / Homo sapiens
  •        Asn-71
• Tetraspanin-3 / Homo sapiens
  •        Asn-167
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Thrombospondin-2 / Homo sapiens
  •        Asn-330
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Transferrin receptor protein 1 / Homo sapiens
  •        Undefined site
• Transmembrane protein 87A / Homo sapiens
  •        Asn-62
• Uromodulin / Homo sapiens
  •        Asn-232
  •        Asn-275
• Vesicle-trafficking protein SEC22b / Homo sapiens
  •        Asn-172
• Vitronectin / Homo sapiens
  •        Asn-169
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Ribonuclease pancreatic [b] / Bos taurus
  •        Asn-60
• Uncharacterized protein (gene name abca4) / Bos taurus
  •        Asn-504
• Salivary plasminogen activator alpha 1 / Desmodus rotundus
  •        Asn-153
• Aminopeptidase N / Mus musculus
  •        Asn-128
• Angiotensin-converting enzyme / Mus musculus
  •        Asn-165
  •        Asn-514
  •        Asn-528
• BDNF/NT-3 growth factors receptor / Mus musculus
  •        Asn-121
• Cadherin-13 / Mus musculus
  •        Asn-638
• Cation-dependent mannose-6-phosphate receptor / Mus musculus
  •        Asn-58
• Cytoplasmic FMR1-interacting protein 2 / Mus musculus
  •        Asn-441
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-505
• DNA mismatch repair protein Mlh1 / Mus musculus
  •        Asn-64
• Ephrin-A4 / Mus musculus
  •        Asn-33
• Gamma-aminobutyric acid receptor subunit alpha-1 / Mus musculus
  •        Asn-137
• Junctional adhesion molecule C / Mus musculus
  •        Asn-192
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
  •        Asn-1203
• Leukocyte surface antigen CD47 / Mus musculus
  •        Asn-61
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-478
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-217
• Oligodendrocyte-myelin glycoprotein / Mus musculus
  •        Asn-234
• Protein disulfide-isomerase TMX3 / Mus musculus
  •        Asn-261
• Signal-regulatory protein alpha / Mus musculus
  •        Asn-168
  •        Asn-246
• Sodium channel subunit beta-1 / Mus musculus
  •        Asn-135
• Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
  •        Asn-118
  •        Asn-153
  •        Asn-238
• Solute carrier family 12 member 9 / Mus musculus
  •        Asn-243
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Alkaline phosphatase, tissue non-specific isozyme / Rattus norvegicus
  •        Undefined site
• T-cell surface glycoprotein cd4 / Rattus norvegicus
  •        Undefined site
• Rhodopsin / Rana pipiens
  •        Asn-2
• Uncharacterized protein from Undefined tissue / Nicotiana tabacum
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Hemocyanin / Megathura crenulata
  •        Undefined site
• Knob protein gp70 / Friend murine leukemia virus
  •        Asn-334 and/or Asn-341
  •        Asn-341 and/or Asn-334
  •        Asn-12
• Exterior membrane glycoprotein (gp120) / Human immunodeficiency virus type 1 (lw12.3 isolate)
  •        Undefined site
• Peroxidase c / Armoracia rusticana
  •        Undefined site
• Structural glycoprotein / Marburg virus (strain musoke)
  •        Undefined site
• Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-74
  •        Asn-122
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-122
  •        Asn-165
  •        Asn-234
  •        Asn-331
  •        Asn-602
  •        Asn-615
  •        Asn-717
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-282
  •        Asn-331
  •        Asn-615
  •        Asn-657

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• HPIYWNSSNPR (11aa)
  •    O08542    Asn-33
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42
• DVNCSVMGPQEK (12aa)
  •    P53634    Asn-53
• LKPLFNK (7aa)
  •    P20645    Asn-57
• LRPLFNK (7aa)
  •    P24668    Asn-58
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• WKLNK (5aa)
  •    Q61735    Asn-61
• NTTIFLK (7aa)
  •    Q8NBN3    Asn-62
• LIQIQDNGTGIR (12aa)
  •    Q9JK91    Asn-64
• GQTEIQVNCPPAVTENK (17aa)
  •    Q16563    Asn-71
• DIYTFDGAINK (11aa)
  •    Q08722    Asn-73
• HAIHVSGTNGTK (12aa)
  •    P0DTC2    Asn-74
• ANTTQPGIVEGGQVIK (16aa)
  •    P06756    Asn-74
• NQNGTFK (7aa)
  •    Q9NUN5    Asn-78
• FNQTMQPIITAQNAIIEDDTYR (22aa)
  •    Q11201    Asn-79
• DNATEEEILVYLEK (14aa)
  •    P07602    Asn-80
• EILNVTLVPYGNAQEQNVSGR (21aa)
  •    P13284    Asn-95
• LVMEILNVTLVPYGNAQEQNVSGR (24aa)
  •    P13284    Asn-95
• GHTITINFTR (10aa)
  •    P11279    Asn-103
• VCSNDNK (7aa)
  •    P09486    Asn-116
• FLEPYNDSIQAQK (13aa)
  •    P14231    Asn-118
• VTTYCNETMTGWVHDVIGR (19aa)
  •    P53634    Asn-119
• ANATLLLGPLR (11aa)
  •    O14594    Asn-122
• HINFTR (6aa)
  •    P15209    Asn-121
• IVNNATNVVIK (11aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• IVNNATNVVIKVCEF (15aa)
  •    P0DTC2    Asn-122
• LGIYADMGNFTCMGYPGTTLDK (22aa)
  •    P17050    Asn-124
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• KLNYTLK (7aa)
  •    P97449    Asn-128
• DASINIENMQFIHNGTYICDVK (22aa)
  •    O95297    Asn-130
• NGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVK (40aa)
  •    P07339    Asn-134
• LLFFDNYEHNTSVVK (15aa)
  •    P97952    Asn-135
• SVAHNMTMPNK (11aa)
  •    P62812    Asn-137
• GTFTDCALANMTEQIR (16aa)
  •    P12110    Asn-140
• RACQFNR (7aa)
  •    P14231    Asn-153
• VNETEMDIAK (10aa)
  •    O75629    Asn-160
• SEIVNETR (8aa)
  •    Q9UGT4    Asn-162
• SSANNCTF (8aa)
  •    P0DTC2    Asn-165
• SSANNCTFEY (10aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFEYVSQPFLMDLEGK (24aa)
  •    P0DTC2    Asn-165
• VCFPNK (6aa)
  •    P09470    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• NQSVPISCCR (10aa)
  •    O60637    Asn-167
• VNFTCK (6aa)
  •    P97797    Asn-168
• ANNLSSLSK (9aa)
  •    O75396    Asn-172
• IVVYNQPYINYSR (13aa)
  •    Q9Y646    Asn-179
• FQNSSFHVNSETGTLVFNAVHK (22aa)
  •    Q9D8B7    Asn-192
• NYSYVIHAK (9aa)
  •    Q6FHJ7    Asn-194
• NHSIFLADINQER (13aa)
  •    P50897    Asn-197
• NLTLDFHR (8aa)
  •    Q8TDD5    Asn-205
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• GINESYKK (8aa)
  •    P50897    Asn-212
• TNSTFVQALVEHVK (14aa)
  •    P07602    Asn-215
• IVTPEEYYNVTV (12aa)
  •    O75629    Asn-216
• FNHTQTIQQK (10aa)
  •    Q810U4    Asn-217
• CNTAAPMWLNGTHPSSDEGIVSR (23aa)
  •    P07911    Asn-232
• FINDSIVDPVDSEWFGFYR (19aa)
  •    P50897    Asn-232
• WSCDHKQNITYLLK (14aa)
  •    Q63912    Asn-234
• GINIT (5aa)
  •    P0DTC2    Asn-234
• FHVNYTQPLVAVK (13aa)
  •    P14231    Asn-238
• NNSIPDK (7aa)
  •    Q08431    Asn-238
• KFHVNYTQPLVAVK (14aa)
  •    P14231    Asn-238
• HGHFTGFNGSTLR (13aa)
  •    Q99MR3    Asn-243
• GIANLSNFIR (10aa)
  •    P97797    Asn-246
• IININPNK (8aa)
  •    P11279    Asn-261
• LVAIAVIDEKNTSLEHTR (18aa)
  •    Q8BXZ1    Asn-261
• GSISYINVTR (10aa)
  •    P07339    Asn-263
• GSLSYLNVTRK (11aa)
  •    P07339    Asn-263
• TVGILPSNCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSK (39aa)
  •    O00115    Asn-266
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• ACAGGYYVYNLTAPPECHLAYCTDPSSVEGTCEECSIDEDCK (42aa)
  •    P07911    Asn-275
• TPMTNSSIQFIDNAFRK (17aa)
  •    P15586    Asn-279
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• GVTNDIISIQGNTGPSWINK (20aa)
  •    Q7Z4H8    Asn-306
• FFAENETWVVDSCTTCTCK (19aa)
  •    P35442    Asn-330
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• LIDNNK (6aa)
  •    P07602    Asn-332
• IIDNNKTEK (9aa)
  •    P07602    Asn-332
• YFWYHNDTLLDPSLYK (16aa)
  •    O75339    Asn-346
• GPGIKPNQTSK (11aa)
  •    P15586    Asn-362
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• NLEKNSTK (8aa)
  •    P07602    Asn-426
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• ATRYNYTSEEK (11aa)
  •    Q5SQX6    Asn-441
• NNVITINITGK (11aa)
  •    P16278    Asn-464
• GVFITNETGQPIIGK (15aa)
  •    P10253    Asn-470
• FFPYANGTLSIR (12aa)
  •    P11627    Asn-478
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480
• CEGPGVPTVTVHNTTDK (17aa)
  •    Q9Z218    Asn-505
• NETHFDAGAK (10aa)
  •    P09470    Asn-514
• SDINPANGSYPFQAIR (16aa)
  •    Q8NHP8    Asn-515
• FHIPNVTPYIR (11aa)
  •    P09470    Asn-528
• SISENATATAAPK (13aa)
  •    Q9UBS9    Asn-530
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• VITPGTNTS (9aa)
  •    P0DTC2    Asn-602
• ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
  •    P0DTC2    Asn-615
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• ISKINNTHALVSLLQNLNK (19aa)
  •    Q9WTR5    Asn-638
• NCSAACPGLQLSNNPVK (17aa)
  •    P05107    Asn-642
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• KFDVNQIQNTTIK (13aa)
  •    P12821    Asn-714
• NFTIS (5aa)
  •    P0DTC2    Asn-717
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801
• NVTAQICIDK (10aa)
  •    P12109    Asn-804
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
  •    P01023    Asn-869
• ANVTSENNMPR (11aa)
  •    P11215    Asn-900
• ENQNHSYSIK (10aa)
  •    P06756    Asn-945
• NCTDIDECR (9aa)
  •    P35556    Asn-1112
• NCTDIDECR (9aa)
  •    P35555    Asn-1067
• NCTDIDECR (9aa)
  •    Q75N90    Asn-1025
• GNLSFDWYIK (10aa)
  •    P11215    Asn-1050
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067
• GEYFVNVTTR (10aa)
  •    P17301    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• VPAQEKNFTTAPAICHDGK (19aa)
  •    P0DTC2    Asn-1074
• NFTTAPAICHDGK (13aa)
  •    P0DTC2    Asn-1074
• EGVFVSNGTHW (11aa)
  •    P0DTC2    Asn-1098
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• VSNGTHW (7aa)
  •    P0DTC2    Asn-1098
• VSNGTHWF (8aa)
  •    P0DTC2    Asn-1098
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105
• TANETSAEAYNLLLR (15aa)
  •    P02468    Asn-1203
• IICDNADNITR (11aa)
  •    Q92626    Asn-1280
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763
• ITLHENR (7aa)
  •    Q9NR99    Asn-2007
• VFANGTIVVK (10aa)
  •    Q9NR99    Asn-2203
• ITVHGNGSLDIR (12aa)
  •    Q9NR99    Asn-2500
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528
• VSIIDNGTITVR (12aa)
  •    Q9NR99    Asn-2693
• LNGTDPIVAADSK (13aa)
  •    Q07954    Asn-4075