Hex:3 HexNAc:6

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Dirofilaria immitus (Canine heartworm nematode)
• Trichinella spiralis
• Bothrops moojeni (Brazilian lancehead)
• SARS coronavirus CUHK-W1
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adhesion G protein-coupled receptor L2 / Homo sapiens    O95490
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• All-trans retinoic acid-induced differentiation factor / Homo sapiens    Q6UW56
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Alpha-S1-casein / Homo sapiens    P47710
• Attractin / Homo sapiens    O75882
• Basal cell adhesion molecule / Homo sapiens    P50895
• Cartilage-associated protein / Homo sapiens    O75718
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD166 antigen / Homo sapiens    Q13740
• Choline transporter-like protein 2 / Homo sapiens    Q8IWA5
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Complement c3 / Homo sapiens    P01024
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens    Q13444
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens    P46977
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens    Q8TCJ2
• Dystroglycan / Homo sapiens    Q14118
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Endoplasmin / Homo sapiens    P14625
• ER membrane protein complex subunit 1 / Homo sapiens    Q8N766
• ER membrane protein complex subunit 10 / Homo sapiens    Q5UCC4
• Fibrillin-1 / Homo sapiens    P35555
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Glandular kallikrein 1 / Homo sapiens    P06870
• Glucosylceramidase / Homo sapiens    P04062
• Heat shock 70 kDa protein 13 / Homo sapiens    P48723
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Integrin beta-1 / Homo sapiens    P05556
• Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens    Q06033
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens    Q86UX2
• Interferon gamma / Homo sapiens    P01579
• Interferon-gamma receptor alpha chain / Homo sapiens    P15260
• Lactadherin / Homo sapiens    Q08431
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Mammaglobin-A / Homo sapiens    Q13296
• Mucin-2 / Homo sapiens    Q02817
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Neurocan core protein / Homo sapiens    O14594
• Nicastrin / Homo sapiens    Q92542
• Nodal modulator 1 / Homo sapiens    Q15155
• Nodal modulator 2 / Homo sapiens    Q5JPE7
• Nodal modulator 3 / Homo sapiens    P69849
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Peroxidasin homolog / Homo sapiens    Q92626
• Phosphatidylserine synthase 2 / Homo sapiens    Q9BVG9
• Phospholipase B-like 1 / Homo sapiens    Q6P4A8
• Phospholipase D3 / Homo sapiens    Q8IV08
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens    O60568
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Reticulocalbin-1 / Homo sapiens    Q15293
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Seipin / Homo sapiens    Q96G97
• Serum paraoxonase/arylesterase 2 / Homo sapiens    Q15165
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Thrombospondin-1 / Homo sapiens    P07996
• Tissue-type plasminogen activator / Homo sapiens    P00750
• TM2 domain-containing protein 3 / Homo sapiens    Q9BRN9
• Torsin-1A-interacting protein 2 / Homo sapiens    Q8NFQ8
• Transforming growth factor beta-1 / Homo sapiens    P01137
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane protein 87A / Homo sapiens    Q8NBN3
• Transmembrane protein 9 / Homo sapiens    Q9P0T7
• Vitronectin / Homo sapiens    P04004
• Wolframin / Homo sapiens    O76024
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Platelet glycoprotein IV / Bos taurus    P26201
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Uncharacterized protein from Milk / Bos taurus    
• ATPase family AAA domain-containing protein 1 / Mus musculus    Q9D5T0
• Attractin / Mus musculus    Q9WU60
• Beta-hexosaminidase subunit beta / Mus musculus    P20060
• Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus    Q8BTJ4
• Brevican core protein / Mus musculus    Q61361
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cadherin-11 / Mus musculus    P55288
• Calsyntenin-2 / Mus musculus    Q9ER65
• Calsyntenin-3 / Mus musculus    Q99JH7
• Carboxypeptidase M / Mus musculus    Q80V42
• Cathepsin B / Mus musculus    P10605
• Cation-independent mannose-6-phosphate receptor / Mus musculus    Q07113
• Cell cycle control protein 50A / Mus musculus    Q8VEK0
• Cerebellin-3 / Mus musculus    Q9JHG0
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus    Q8VBZ3
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus    Q8BXA5
• Contactin-1 / Mus musculus    P12960
• Contactin-associated protein 1 / Mus musculus    O54991
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus    Q91YQ5
• Ectonucleoside triphosphate diphosphohydrolase 3 / Mus musculus    Q8BFW6
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus    Q9R1E6
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus    Q9EQG7
• Endoplasmic reticulum aminopeptidase 1 / Mus musculus    Q9EQH2
• Endoplasmic reticulum metallopeptidase 1 / Mus musculus    Q3UVK0
• Endoplasmic reticulum-Golgi intermediate compartment protein 3 / Mus musculus    Q9CQE7
• Endoplasmin / Mus musculus    P08113
• Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus    Q3UZV7
• ER membrane protein complex subunit 10 / Mus musculus    Q3TAS6
• Extracellular sulfatase Sulf-2 / Mus musculus    Q8CFG0
• Glutamate carboxypeptidase 2 / Mus musculus    O35409
• Glutamate receptor 2 / Mus musculus    P23819
• Glutamate receptor 3 / Mus musculus    Q9Z2W9
• Glutamate receptor 4 / Mus musculus    Q9Z2W8
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus    P35438
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Isoform 2 of Integrin alpha-3 / Mus musculus    Q62470-2
• Isoform 2 of Protein O-mannosyl-transferase 2 / Mus musculus    Q8BGQ4-2
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus    P11881-3
• Laminin subunit alpha-5 / Mus musculus    Q61001
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Low-density lipoprotein receptor-related protein 8 / Mus musculus    Q924X6
• Monoacylglycerol lipase ABHD12 / Mus musculus    Q99LR1
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus    Q9Z2L6
• N-acetylgalactosamine-6-sulfatase / Mus musculus    Q571E4
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neural cell adhesion molecule L1-like protein / Mus musculus    P70232
• Neurofascin / Mus musculus    A0A087WPX3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuroplastin / Mus musculus    P97300
• Neuroserpin / Mus musculus    O35684
• Neutral cholesterol ester hydrolase 1 / Mus musculus    Q8BLF1
• Nicastrin / Mus musculus    P57716
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus    Q9Z247
• Phospholipase D3 / Mus musculus    O35405
• Plexin-A4 / Mus musculus    Q80UG2
• Plexin-C1 / Mus musculus    Q9QZC2
• Pro-opiomelanocortin / Mus musculus    P01193
• Probable G-protein coupled receptor 158 / Mus musculus    Q8C419
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Protein canopy homolog 3 / Mus musculus    Q9DAU1
• Protein CREG2 / Mus musculus    Q8BGC9
• Protein FAM234A / Mus musculus    Q8C0Z1
• Protein NOV homolog / Mus musculus    Q64299
• Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus    Q8BW41
• Protocadherin Fat 1 / Mus musculus    F2Z4A3
• Reticulocalbin-1 / Mus musculus    Q05186
• Semaphorin-7A / Mus musculus    Q9QUR8
• Serotransferrin / Mus musculus    Q921I1
• Serum paraoxonase/arylesterase 2 / Mus musculus    Q62086
• Sodium channel subunit beta-4 / Mus musculus    Q7M729
• Sodium/hydrogen exchanger 1 / Mus musculus    Q61165
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus    P14094
• Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus    P97370
• Sortilin-related receptor / Mus musculus    O88307
• SUN domain-containing ossification factor / Mus musculus    Q8C341
• Synaptotagmin-1 / Mus musculus    P46096
• Tenascin-r / Mus musculus    Q8BYI9
• Teneurin-1 / Mus musculus    Q9WTS4
• Teneurin-2 / Mus musculus    Q9WTS5
• Thioredoxin domain-containing protein 15 / Mus musculus    Q6P6J9
• Translocon-associated protein subunit beta / Mus musculus    Q9CPW5
• Tumor suppressor candidate 3 / Mus musculus    Q8BTV1
• VIP36-like protein / Mus musculus    P59481
• Uncharacterized protein from Aorta / Sus scrofa    
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Ovotransferrin / Gallus gallus    P02789
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Acetylcholine receptor protein / Torpedo californica    P02710    P02714    P02718    P02712
• Uncharacterized protein / Dirofilaria immitus    
• Tsl-1 antigens / Trichinella spiralis    
• Batroxobin / Bothrops moojeni    
• Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1    P59594
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Aorta (UBERON_0000947)   MYP30 (CVCL_Z591)   Endothelial Cell (CL_0000115)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Cerebrospinal Fluid (UBERON_0001359)  
• Colonic Mucosa (UBERON_0000317)  
• Electric Organ (UBERON_0006869)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Milk (UBERON_0001913)   Plasma Membrane (GO_0005886)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Pituitary Gland (UBERON_0000007)  
• Prefrontal Cortex (UBERON:0000451)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Spleen (UBERON_0002106)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Egg Cell  
• Egg Cell   Egg White  

Reported structure

• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-3)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-4)]Man(a1-3)[GlcNAc(?1-2)[GlcNAc(?1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-4)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GalNAc(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9423
• N-Linked / Complex / Structure 10018
• N-Linked / Complex / Structure 11555
• N-Linked / Complex / Structure 11775
• N-Linked / Complex / Structure 11806
• O-Linked / Core 3 / GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-3)[GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc

Composition

• Hex:3 HexNAc:6 (avg mass : 1723.6125 )

Disease

• Alzheimer's disease (DOID:10652)
• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diverticulosis (DOID:7475)
• Gaucher Disease (DOID:1926)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)
• Schizophrenia (DOID:5419)
• severe acute respiratory syndrome (DOID:2945)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Direct Comparison of N-Glycans and Their Isomers Derived from Spike Glycoprotein 1 of MERS-CoV, SARS-CoV-1, and SARS-CoV-2 (2021 - Cho BG, Gautam S, Peng W, Huang Y, Goli M, Mechref Y) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Glycan biomarkers for Alzheimer disease correlate with T-tau and P-tau in cerebrospinal fluid in subjective cognitive impairment (2020 - Schedin-Weiss S, Gaunitz S, Sui P, Chen Q, Haslam SM, Blennow K, Winblad B, Dell A, Tjernberg LO) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Spatial and temporal diversity of glycome expression in mammalian brain (2020 - Lee J, Ha S, Kim M, Kim SW, Yun J, Ozcan S, Hwang H, Ji IJ, Yin D, Webster MJ, Shannon Weickert C, Kim JH, Yoo JS, Grimm R, Bahn S, Shin HS, An HJ) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
• Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Derivatization and purification of bisecting tyrosinamide-oligosaccharides from ovotransferrin. (1994 - Corradi da Silva M, Tamura T, Rice K) / Status : Reviewed
• Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed

Reported glycosite

• Adhesion G protein-coupled receptor L2 / Homo sapiens
  •        Asn-731
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
  •        Asn-196
• All-trans retinoic acid-induced differentiation factor / Homo sapiens
  •        Asn-44
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Attractin / Homo sapiens
  •        Asn-300
• Basal cell adhesion molecule / Homo sapiens
  •        Asn-419
• Cartilage-associated protein / Homo sapiens
  •        Asn-87
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-581
  •        Asn-1312
• CD166 antigen / Homo sapiens
  •        Asn-480
• Choline transporter-like protein 2 / Homo sapiens
  •        Asn-417
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Complement c3 / Homo sapiens
  •        Asn-85
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-29
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
  •        Asn-389
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-264
  •        Asn-551
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
  •        Asn-544
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
  •        Asn-623
  •        Asn-641
• Dystroglycan / Homo sapiens
  •        Asn-661
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-443
• Endoplasmin / Homo sapiens
  •        Asn-217
• ER membrane protein complex subunit 1 / Homo sapiens
  •        Asn-913
• ER membrane protein complex subunit 10 / Homo sapiens
  •        Asn-182
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Glucosylceramidase / Homo sapiens
  •        Asn-58
• Heat shock 70 kDa protein 13 / Homo sapiens
  •        Asn-137
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-596
  •        Asn-931
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Integrin beta-1 / Homo sapiens
  •        Asn-50
  •        Asn-212
  •        Asn-669
• Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
  •        Asn-91
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
  •        Asn-97
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interferon-gamma receptor alpha chain / Homo sapiens
  •        Asn-179
• Lactadherin / Homo sapiens
  •        Asn-238
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-3287
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-249
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-241
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Mucin-2 / Homo sapiens
  •        Undefined site
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-50
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-505
• Neurocan core protein / Homo sapiens
  •        Asn-122
• Nicastrin / Homo sapiens
  •        Asn-417
  •        Asn-506
  •        Asn-612
• Nodal modulator 1 / Homo sapiens
  •        Asn-218
• Nodal modulator 2 / Homo sapiens
  •        Asn-218
• Nodal modulator 3 / Homo sapiens
  •        Asn-218
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
  •        Asn-294
• Peroxidasin homolog / Homo sapiens
  •        Asn-731
• Phosphatidylserine synthase 2 / Homo sapiens
  •        Asn-181
• Phospholipase B-like 1 / Homo sapiens
  •        Asn-411
• Phospholipase D3 / Homo sapiens
  •        Asn-284
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-90
  •        Asn-499
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-686
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
  •        Asn-63
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-272
  •        Asn-608
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-140
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Seipin / Homo sapiens
  •        Asn-88
• Serum paraoxonase/arylesterase 2 / Homo sapiens
  •        Asn-323
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-878
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• TM2 domain-containing protein 3 / Homo sapiens
  •        Asn-140
• Torsin-1A-interacting protein 2 / Homo sapiens
  •        Asn-286
• Transforming growth factor beta-1 / Homo sapiens
  •        Asn-82
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-88
  •        Asn-104
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane protein 87A / Homo sapiens
  •        Asn-62
• Transmembrane protein 9 / Homo sapiens
  •        Asn-47
• Vitronectin / Homo sapiens
  •        Asn-169
• Wolframin / Homo sapiens
  •        Asn-661
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Milk / Bos taurus
  •        Undefined site
• ATPase family AAA domain-containing protein 1 / Mus musculus
  •        Asn-316
• Attractin / Mus musculus
  •        Asn-263
• Beta-hexosaminidase subunit beta / Mus musculus
  •        Asn-306
• Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
  •        Asn-389
• Brevican core protein / Mus musculus
  •        Asn-129
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-44
• Cadherin-11 / Mus musculus
  •        Asn-540
• Calsyntenin-2 / Mus musculus
  •        Asn-720
• Calsyntenin-3 / Mus musculus
  •        Asn-507
• Carboxypeptidase M / Mus musculus
  •        Asn-363
• Cathepsin B / Mus musculus
  •        Asn-192
• Cation-independent mannose-6-phosphate receptor / Mus musculus
  •        Asn-1423
• Cell cycle control protein 50A / Mus musculus
  •        Asn-297
• Cerebellin-3 / Mus musculus
  •        Asn-82
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
  •        Asn-241
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
  •        Asn-101
• Contactin-1 / Mus musculus
  •        Asn-258
  •        Asn-338
• Contactin-associated protein 1 / Mus musculus
  •        Asn-277
  •        Asn-1148
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
  •        Asn-474
  •        Asn-752
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
  •        Asn-300
• Ectonucleoside triphosphate diphosphohydrolase 3 / Mus musculus
  •        Asn-81
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
  •        Asn-524
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
  •        Asn-101
  •        Asn-292
• Endoplasmic reticulum aminopeptidase 1 / Mus musculus
  •        Asn-403
• Endoplasmic reticulum metallopeptidase 1 / Mus musculus
  •        Asn-724
• Endoplasmic reticulum-Golgi intermediate compartment protein 3 / Mus musculus
  •        Asn-266
• Endoplasmin / Mus musculus
  •        Asn-62
  •        Asn-217
• Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus
  •        Asn-715
• ER membrane protein complex subunit 10 / Mus musculus
  •        Asn-182
• Extracellular sulfatase Sulf-2 / Mus musculus
  •        Asn-112
  •        Asn-566
• Glutamate carboxypeptidase 2 / Mus musculus
  •        Asn-478
• Glutamate receptor 2 / Mus musculus
  •        Asn-256
• Glutamate receptor 3 / Mus musculus
  •        Asn-260
• Glutamate receptor 4 / Mus musculus
  •        Asn-258
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus
  •        Asn-368
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-163
• Isoform 2 of Integrin alpha-3 / Mus musculus
  •        Asn-606
• Isoform 2 of Protein O-mannosyl-transferase 2 / Mus musculus
  •        Asn-330
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-136
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
  •        Asn-2502
• Laminin subunit alpha-5 / Mus musculus
  •        Asn-3261
• Leucyl-cystinyl aminopeptidase / Mus musculus
  •        Asn-525
• Low-density lipoprotein receptor-related protein 1B / Mus musculus
  •        Asn-3682
• Low-density lipoprotein receptor-related protein 8 / Mus musculus
  •        Asn-805
• Monoacylglycerol lipase ABHD12 / Mus musculus
  •        Asn-123
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus
  •        Asn-236
• N-acetylgalactosamine-6-sulfatase / Mus musculus
  •        Asn-421
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-875
• Neural cell adhesion molecule L1-like protein / Mus musculus
  •        Asn-476
• Neurofascin / Mus musculus
  •        Asn-305
  •        Asn-409
  •        Asn-483
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-77
  •        Asn-427
  •        Asn-501
• Neuroplastin / Mus musculus
  •        Asn-228
• Neuroserpin / Mus musculus
  •        Asn-321
• Neutral cholesterol ester hydrolase 1 / Mus musculus
  •        Asn-270
• Nicastrin / Mus musculus
  •        Asn-54
  •        Asn-128
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus
  •        Asn-286
• Phospholipase D3 / Mus musculus
  •        Asn-282
• Plexin-A4 / Mus musculus
  •        Asn-1006
  •        Asn-1179
• Plexin-C1 / Mus musculus
  •        Asn-877
• Pro-opiomelanocortin / Mus musculus
  •        Asn-152
• Probable G-protein coupled receptor 158 / Mus musculus
  •        Asn-215
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-137
  •        Asn-1646
• Prosaposin / Mus musculus
  •        Asn-459
• Protein canopy homolog 3 / Mus musculus
  •        Asn-153
• Protein CREG2 / Mus musculus
  •        Asn-164
• Protein FAM234A / Mus musculus
  •        Asn-144
• Protein NOV homolog / Mus musculus
  •        Asn-277
• Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
  •        Asn-337
• Protocadherin Fat 1 / Mus musculus
  •        Asn-41
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Semaphorin-7A / Mus musculus
  •        Asn-256
• Serotransferrin / Mus musculus
  •        Asn-513
• Serum paraoxonase/arylesterase 2 / Mus musculus
  •        Asn-323
• Sodium channel subunit beta-4 / Mus musculus
  •        Asn-113
• Sodium/hydrogen exchanger 1 / Mus musculus
  •        Asn-76
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
  •        Asn-193
• Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
  •        Asn-124
• Sortilin-related receptor / Mus musculus
  •        Asn-1458
• SUN domain-containing ossification factor / Mus musculus
  •        Asn-201
• Synaptotagmin-1 / Mus musculus
  •        Asn-24
• Tenascin-r / Mus musculus
  •        Asn-470
• Teneurin-1 / Mus musculus
  •        Asn-1669
• Teneurin-2 / Mus musculus
  •        Asn-1983
• Thioredoxin domain-containing protein 15 / Mus musculus
  •        Asn-149
• Translocon-associated protein subunit beta / Mus musculus
  •        Asn-104
• Tumor suppressor candidate 3 / Mus musculus
  •        Asn-83
• VIP36-like protein / Mus musculus
  •        Asn-180
• Uncharacterized protein from Aorta / Sus scrofa
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Ovotransferrin / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Uncharacterized protein / Dirofilaria immitus
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site
• Recombinant Spike glycoprotein (HEK293) - RBD domain / SARS coronavirus CUHK-W1
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-282
  •        Asn-615
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-717
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-343

Mass spectrometry observed peptide

• VSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSK (40aa)
  •    P46096    Asn-24     Synaptotagmin-1 / Mus musculus
• DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
  •    P53634    Asn-29     Dipeptidyl peptidase 1 / Homo sapiens
• LEPTPPIQFTHFQYNVTVHENSAAK (25aa)
  •    F2Z4A3    Asn-41     Protocadherin Fat 1 / Mus musculus
• ADVGGEAAGTAINHSHMLLQR (21aa)
  •    Q9DB72    Asn-44     BTB/POZ domain-containing protein 17 / Mus musculus
• LPEICTQCPGSVQNLSK (17aa)
  •    Q6UW56    Asn-44     All-trans retinoic acid-induced differentiation factor / Homo sapiens
• IYNQNVSQK (9aa)
  •    Q9P0T7    Asn-47     Transmembrane protein 9 / Homo sapiens
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q05186    Asn-47     Reticulocalbin-1 / Mus musculus
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
  •    P05556    Asn-50     Integrin beta-1 / Homo sapiens
• EIFVANGTQGK (11aa)
  •    O95297    Asn-50     Myelin protein zero-like protein 1 / Homo sapiens
• WFSAGLASNSSWLREK (16aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53     Reticulocalbin-1 / Homo sapiens
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• LLNATHQIGCQSSISGDTGVIHVVEKEEDLK (31aa)
  •    P57716    Asn-54     Nicastrin / Mus musculus
• SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
  •    P04062    Asn-58     Glucosylceramidase / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGSRTDDEVVQREEEAIQLDGLNASQIR (28aa)
  •    P08113    Asn-62     Endoplasmin / Mus musculus
• NTTIFLK (7aa)
  •    Q8NBN3    Asn-62     Transmembrane protein 87A / Homo sapiens
• SAEFFNYTVR (10aa)
  •    O60568    Asn-63     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
• SNAPIVNVTIYYEAICGGCR (20aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SIGDVTTAPSEPLHRPDDHNLTNLIIEHGGKPSR (34aa)
  •    Q61165    Asn-76     Sodium/hydrogen exchanger 1 / Mus musculus
• SIGDVTTAPSEPLHRPDDHNLTNLIIEHGGKPSRK (35aa)
  •    Q61165    Asn-76     Sodium/hydrogen exchanger 1 / Mus musculus
• NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK (31aa)
  •    Q810U4    Asn-77     Neuronal cell adhesion molecule / Mus musculus
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• TTVYVYQWPAEKENNTGVVSQTFR (24aa)
  •    Q8BFW6    Asn-81     Ectonucleoside triphosphate diphosphohydrolase 3 / Mus musculus
• AFITNF (6aa)
  •    Q86UX2    Asn-97     Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
  •    Q06033    Asn-91     Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
  •    Q14624    Asn-81     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• IASPPSQGEVPPGPIPEAVIAIYNSTR (27aa)
  •    P01137    Asn-82     Transforming growth factor beta-1 / Homo sapiens
• SHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDR (33aa)
  •    Q9JHG0    Asn-82     Cerebellin-3 / Mus musculus
• APPRNYSMIVMFTALQPQR (19aa)
  •    Q8BTV1    Asn-83     Tumor suppressor candidate 3 / Mus musculus
• TVITPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• NCSAAPQPEPAAGLASYPELR (21aa)
  •    O75718    Asn-87     Cartilage-associated protein / Homo sapiens
• TDCDSSTTSICSFPVANVSITK (22aa)
  •    Q96G97    Asn-88     Seipin / Homo sapiens
• IAPASNVSHTVVIRPIK (17aa)
  •    P43308    Asn-88     Translocon-associated protein subunit beta / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• NNGTLYAYIFLHHAGILPWQDGK (23aa)
  •    Q8BXA5    Asn-101     Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
• TYPNHYTLVTGLFAENHGIVANDMFDPILNK (31aa)
  •    Q9EQG7    Asn-101     Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104     Translocon-associated protein subunit beta / Homo sapiens
• AGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQR (38aa)
  •    Q9CPW5    Asn-104     Translocon-associated protein subunit beta / Mus musculus
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• YVHNHNTYTNNENCSSPSWQAQHESR (26aa)
  •    Q8CFG0    Asn-112     Extracellular sulfatase Sulf-2 / Mus musculus
• TNNISILLSDLEFSDTGR (18aa)
  •    Q7M729    Asn-113     Sodium channel subunit beta-4 / Mus musculus
• ANATLLLGPLR (11aa)
  •    O14594    Asn-122     Neurocan core protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KPQDQGLNHTCNYYLQPEDDVTIGVWHTIPSVWWK (35aa)
  •    Q99LR1    Asn-123     Monoacylglycerol lipase ABHD12 / Mus musculus
• LVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYR (37aa)
  •    P97370    Asn-124     Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
• IAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCK (43aa)
  •    P57716    Asn-128     Nicastrin / Mus musculus
• VALPAYPASLTDVSLVLSELRPNDSGVYR (29aa)
  •    Q61361    Asn-129     Brevican core protein / Mus musculus
• VQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQR (38aa)
  •    O08532-4    Asn-136     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• EDFASNEVVYYNAKDDLDPERNESEPGSQR (30aa)
  •    O08532-4    Asn-136     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136     Translocon-associated protein subunit alpha / Homo sapiens
• MGCQHHCVPTPSGPTCYCNSSFQLQADGK (29aa)
  •    Q91ZX7    Asn-137     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• SVTSNETITVSPEYVGSR (18aa)
  •    P48723    Asn-137     Heat shock 70 kDa protein 13 / Homo sapiens
• FCWQLPETDYECTNSTSCMTVSCPR (25aa)
  •    Q9BRN9    Asn-140     TM2 domain-containing protein 3 / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• GPLANPIWNVTGFTGR (16aa)
  •    Q15262    Asn-140     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• SCADEGFSTPCAFVVAVSGANGSVLWERPVAQDVALVK (38aa)
  •    Q8C0Z1    Asn-144     Protein FAM234A / Mus musculus
• ENLFGLQGAGGFQDREEEYYAEPGVTEAEPVATEDANSTDSLKSPK (46aa)
  •    Q6P6J9    Asn-149     Thioredoxin domain-containing protein 15 / Mus musculus
• VYPNVAENESAEAFPLEFK (19aa)
  •    P01193    Asn-152     Pro-opiomelanocortin / Mus musculus
• VVMDIPYELWNETSAEVADLKK (22aa)
  •    Q9DAU1    Asn-153     Protein canopy homolog 3 / Mus musculus
• AGPNGTIFVADAYK (14aa)
  •    Q9HDC9    Asn-160     Adipocyte plasma membrane-associated protein / Homo sapiens
• GNPVSFVALSTCHGLHGMFYDGNHTYLIEPEENEK (35aa)
  •    Q9R1V6-16    Asn-163     Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
• IQGLPFGSCLAISDGPVHNSTGIPFFYMTAK (31aa)
  •    Q8BGC9    Asn-164     Protein CREG2 / Mus musculus
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IVDVNITSEGK (11aa)
  •    Q9HD45    Asn-174     Transmembrane 9 superfamily member 3 / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• MNGSEIQYK (9aa)
  •    P15260    Asn-179     Interferon-gamma receptor alpha chain / Homo sapiens
• VFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVR (35aa)
  •    P59481    Asn-180     VIP36-like protein / Mus musculus
• DYGGNCIIYDPDNETDPFHNIWDK (24aa)
  •    Q9BVG9    Asn-181     Phosphatidylserine synthase 2 / Homo sapiens
• GSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIER (35aa)
  •    Q3TAS6    Asn-182     ER membrane protein complex subunit 10 / Mus musculus
• GHEVEDVDIEIFNTSVQIQPPTTAPGPETAAFIER (35aa)
  •    Q5UCC4    Asn-182     ER membrane protein complex subunit 10 / Homo sapiens
• KGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPR (42aa)
  •    P10605    Asn-192     Cathepsin B / Mus musculus
• GLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPR (41aa)
  •    P10605    Asn-192     Cathepsin B / Mus musculus
• VLGFKPKPPKNESLETYPLMMK (22aa)
  •    P14094    Asn-193     Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196     Prenylcysteine oxidase 1 / Homo sapiens
• NMSFVNDLTVTQDGR (15aa)
  •    Q9HDC9    Asn-196     Adipocyte plasma membrane-associated protein / Homo sapiens
• SGTLSIAKPGEVEQPEADCDAGEAPDADAPVEQPAFVSPPESLVGQHIENVSSSHGK (57aa)
  •    Q8C341    Asn-201     SUN domain-containing ossification factor / Mus musculus
• LKGEAEYQEIRNPNGTVTVISR (22aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• NPCTSEQNCTSPFSYK (16aa)
  •    P05556    Asn-212     Integrin beta-1 / Homo sapiens
• ILLQDLSSSAHHLANATLETEWFHGLR (27aa)
  •    Q8C419    Asn-215     Probable G-protein coupled receptor 158 / Mus musculus
• HNNDTQHIWESDSNEFSVIADPR (23aa)
  •    P14625    Asn-217     Endoplasmin / Homo sapiens
  •    P08113    Asn-217     Endoplasmin / Mus musculus
• AASPLIVAGYNVSGSVR (17aa)
  •    Q5JPE7    Asn-218     Nodal modulator 2 / Homo sapiens
  •    Q15155    Asn-218     Nodal modulator 1 / Homo sapiens
  •    P69849    Asn-218     Nodal modulator 3 / Homo sapiens
• AEDSGEYHCVYHFVSAPKANATIEVK (26aa)
  •    P97300    Asn-228     Neuroplastin / Mus musculus
• FLTDVERNETALYHVEAFK (19aa)
  •    Q9Z2L6    Asn-236     Multiple inositol polyphosphate phosphatase 1 / Mus musculus
• NNSIPDK (7aa)
  •    Q08431    Asn-238     Lactadherin / Homo sapiens
• MGLQLNLTYER (11aa)
  •    P11279    Asn-241     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• RAEDYGPVEVISHWHPNITINIVDDHTPWVK (31aa)
  •    Q8VBZ3    Asn-241     Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
• CNMINGTDGDSFHPIITK (18aa)
  •    Q14108    Asn-249     Lysosome membrane protein 2 / Homo sapiens
• IQFGGANVSGFQIVDYDDSLVSK (23aa)
  •    P23819    Asn-256     Glutamate receptor 2 / Mus musculus
• EDNPDKNPEAPLNVSR (16aa)
  •    Q9QUR8    Asn-256     Semaphorin-7A / Mus musculus
• ATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSR (35aa)
  •    Q9QUR8    Asn-256     Semaphorin-7A / Mus musculus
• LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• DIYTMMGQNVTLECFALGNPVPDIR (25aa)
  •    P12960    Asn-258     Contactin-1 / Mus musculus
• FIHGGANVTGFQLVDFNTPMVTK (23aa)
  •    Q9Z2W8    Asn-258     Glutamate receptor 4 / Mus musculus
• VMHGGANITGFQIVNNENPMVQQFIQR (27aa)
  •    Q9Z2W9    Asn-260     Glutamate receptor 3 / Mus musculus
• FPQVNVTK (8aa)
  •    P54802    Asn-261     Alpha-n-acetylglucosaminidase / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• SSNSSSAVECECSENWKGESCDIPHCTDNCGFPHR (35aa)
  •    Q9WU60    Asn-263     Attractin / Mus musculus
• NTSWDNAGFK (10aa)
  •    P78536    Asn-264     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• HLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVK (34aa)
  •    Q9CQE7    Asn-266     Endoplasmic reticulum-Golgi intermediate compartment protein 3 / Mus musculus
• GNYDFVEAMIVNNHTSLDVER (21aa)
  •    Q8BLF1    Asn-270     Neutral cholesterol ester hydrolase 1 / Mus musculus
• GQTAIGFIYASGIGVNSSQAK (21aa)
  •    Q9UBV2    Asn-272     Protein sel-1 homolog 1 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• DANFTLDGYAHHFVLNGDFER (21aa)
  •    O54991    Asn-277     Contactin-associated protein 1 / Mus musculus
• AIHLQFENCTSLYTYKPR (18aa)
  •    Q64299    Asn-277     Protein NOV homolog / Mus musculus
• YNQETPMEICLNGTPALAYLASAPPPLCPSGR (32aa)
  •    Q8IV08    Asn-284     Phospholipase D3 / Homo sapiens
  •    O35405    Asn-282     Phospholipase D3 / Mus musculus
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HINASNPTEPATIIFTAAR (19aa)
  •    Q8NFQ8    Asn-286     Torsin-1A-interacting protein 2 / Homo sapiens
• YHYNGTLLDGTLFDSSYSR (19aa)
  •    Q9Z247    Asn-286     Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus
• EGKFDEVYDALAGAHPNLTVYK (22aa)
  •    Q9EQG7    Asn-292     Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
• YHYNGSIMDGTIFDSSYSR (19aa)
  •    Q96AY3    Asn-294     Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
• DDLHPTLPAGQYFLNITYNYPVHSFDGR (28aa)
  •    Q8VEK0    Asn-297     Cell cycle control protein 50A / Mus musculus
• DEIGNVSTSHLLILDDSVEMEIRPR (25aa)
  •    Q91YQ5    Asn-300     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
• GICNSSDVR (9aa)
  •    O75882    Asn-300     Attractin / Homo sapiens
• TILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPR (38aa)
  •    Q91YQ5    Asn-300     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
• ITNVSEEDSGEYFCLASNK (19aa)
  •    A0A087WPX3    Asn-305     Neurofascin / Mus musculus
• TQVFGPVDPTVNTTYAFFNTFFK (23aa)
  •    P20060    Asn-306     Beta-hexosaminidase subunit beta / Mus musculus
• EYVNSTSEESHDEDEIRPVQQQDLHR (26aa)
  •    Q9D5T0    Asn-316     ATPase family AAA domain-containing protein 1 / Mus musculus
• ALGVTEIFIKDANLTAMSDKK (21aa)
  •    O35684    Asn-321     Neuroserpin / Mus musculus
• IQNILSEKPSVTTVYINNGSVLQGSSVATIYDRK (34aa)
  •    Q62086    Asn-323     Serum paraoxonase/arylesterase 2 / Mus musculus
• IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa)
  •    Q15165    Asn-323     Serum paraoxonase/arylesterase 2 / Homo sapiens
• IQNILSEKPSVTTVYINNGSVLQGSSVATIYDR (33aa)
  •    Q62086    Asn-323     Serum paraoxonase/arylesterase 2 / Mus musculus
• LSGNSLHNASIPEHLAYGSVITVK (24aa)
  •    Q8BGQ4-2    Asn-330     Isoform 2 of Protein O-mannosyl-transferase 2 / Mus musculus
• LVSNASMLVSMHGAQLVTALFLPR (24aa)
  •    Q8BW41    Asn-337     Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
• IYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIR (39aa)
  •    P12960    Asn-338     Contactin-1 / Mus musculus
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• LGEYYLLLLPGSYVINVTVPGHDSYLTK (28aa)
  •    Q80V42    Asn-363     Carboxypeptidase M / Mus musculus
• KLVQVGIYNGTHVIPNDRK (19aa)
  •    P35438    Asn-368     Glutamate receptor ionotropic, NMDA 1 / Mus musculus
• TCIMEASTDFLPGLNFSNCSR (21aa)
  •    Q13444    Asn-389     Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
• QSTINTVDIYPMMCHILGLKPHPNNGTLSHTK (32aa)
  •    Q8BTJ4    Asn-389     Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
• CFNAMEVDALNSSHPVSTPVENPAQIR (27aa)
  •    Q9EQH2    Asn-403     Endoplasmic reticulum aminopeptidase 1 / Mus musculus
• AVYQCNTSNEHGYLLANAFVSVLDVPPR (28aa)
  •    A0A087WPX3    Asn-409     Neurofascin / Mus musculus
• IYNWSGYPIIVQK (13aa)
  •    Q6P4A8    Asn-411     Phospholipase B-like 1 / Homo sapiens
• TCNPETFPSSNESR (14aa)
  •    Q8IWA5    Asn-417     Choline transporter-like protein 2 / Homo sapiens
• RPNQSQPIPPSSIQR (15aa)
  •    Q92542    Asn-417     Nicastrin / Homo sapiens
• DSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSR (38aa)
  •    P50895    Asn-419     Basal cell adhesion molecule / Homo sapiens
• AHLWTWTNSWEEFTQGTDFCPGQNVSGVTTHTQEEHTELPLIFHLGR (47aa)
  •    Q571E4    Asn-421     N-acetylgalactosamine-6-sulfatase / Mus musculus
• KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
  •    Q810U4    Asn-427     Neuronal cell adhesion molecule / Mus musculus
• MLNLTNLIPADPPGLR (16aa)
  •    Q9Y5L3    Asn-443     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• KLVLYLEHNLEKNSTKEEILAALEK (25aa)
  •    Q61207    Asn-459     Prosaposin / Mus musculus
• NNEGGVIAQLPSDVTSFNQTGLKPGEEYIVNVVALK (36aa)
  •    Q8BYI9    Asn-470     Tenascin-r / Mus musculus
• QCLSCDLVENCTYVSASFSHNMDFFLLK (28aa)
  •    Q9Z218    Asn-474     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• ATVVWEVADETHPLEGDRYHTHENGTLEIYR (31aa)
  •    P70232    Asn-476     Neural cell adhesion molecule L1-like protein / Mus musculus
• VDCTPLMYSLVYNLTK (16aa)
  •    O35409    Asn-478     Glutamate carboxypeptidase 2 / Mus musculus
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• NGQGSNLDGGNYHVYENGSLEIK (23aa)
  •    A0A087WPX3    Asn-483     Neurofascin / Mus musculus
• WNNTGCQALPSQDEGPSK (18aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501     Neuronal cell adhesion molecule / Mus musculus
• NVTIMANLK (9aa)
  •    P32004    Asn-505     Neural cell adhesion molecule L1 / Homo sapiens
• AIYEIAGGTNFSDTVQADPQTVTR (24aa)
  •    Q92542    Asn-506     Nicastrin / Homo sapiens
• KGGENSTDTASGDPLLIHHYFHGYLAGFSVR (31aa)
  •    Q99JH7    Asn-507     Calsyntenin-3 / Mus musculus
• INHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLK (33aa)
  •    Q921I1    Asn-513     Serotransferrin / Mus musculus
• TKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLR (38aa)
  •    Q9R1E6    Asn-524     Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
• KDSLNSSHPISSSVQSSEQIEEMFDSLSYFK (31aa)
  •    Q8C129    Asn-525     Leucyl-cystinyl aminopeptidase / Mus musculus
• FIFSLPPEIMHNPNFTVR (18aa)
  •    P55288    Asn-540     Cadherin-11 / Mus musculus
• TILVDNNTWNNTH (13aa)
  •    P46977    Asn-544     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• GVSYCTGNSSECPPPGNAEDDTVCLDLGK (29aa)
  •    P78536    Asn-551     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• NLSKPHWPGAPEDQDDKDGGSFSGTGGLPDYSAPNPIK (38aa)
  •    Q8CFG0    Asn-566     Extracellular sulfatase Sulf-2 / Mus musculus
• TNITIVCKPGDIESAPVIR (19aa)
  •    P11717    Asn-581     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• ENGTDTVQEEEESPAEGSK (19aa)
  •    Q9Y4L1    Asn-596     Hypoxia up-regulated protein 1 / Homo sapiens
• ENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPK (48aa)
  •    Q9Y4L1    Asn-596     Hypoxia up-regulated protein 1 / Homo sapiens
• SLDAYPVLNQAQAMENHTEVHFQK (24aa)
  •    Q62470-2    Asn-606     Isoform 2 of Integrin alpha-3 / Mus musculus
• EASIVGENETYPR (13aa)
  •    Q9UBV2    Asn-608     Protein sel-1 homolog 1 / Homo sapiens
• DIYEYSWVQGPIHSNETDR (19aa)
  •    Q92542    Asn-612     Nicastrin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TTIVDNNTWNNSHIAIVGK (19aa)
  •    Q8TCJ2    Asn-623     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
• AMSSNETAAYK (11aa)
  •    Q8TCJ2    Asn-641     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
• SIVVEWTNNTLPLEPCPK (18aa)
  •    Q14118    Asn-661     Dystroglycan / Homo sapiens
• VYNSTITWQQYGAICGPR (18aa)
  •    O76024    Asn-661     Wolframin / Homo sapiens
• KDTCTQECSYFNITK (15aa)
  •    P05556    Asn-669     Integrin beta-1 / Homo sapiens
• YNCSIR (6aa)
  •    Q02809    Asn-686     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
• YFHFFNISLCGHEGRK (16aa)
  •    Q3UZV7    Asn-715     Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus
• IPTNFTISVTTEILPVSMTK (20aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QECLELNHSELHQR (14aa)
  •    Q9ER65    Asn-720     Calsyntenin-2 / Mus musculus
• DSGIWINGFDYTGMSHVTPHIPEINDTIR (29aa)
  •    Q3UVK0    Asn-724     Endoplasmic reticulum metallopeptidase 1 / Mus musculus
• SIGQFISTENATIK (14aa)
  •    O95490    Asn-731     Adhesion G protein-coupled receptor L2 / Homo sapiens
• VNNCSDMCFHQK (12aa)
  •    Q92626    Asn-731     Peroxidasin homolog / Homo sapiens
• GKANYSLQIYPDESHYFHSVALK (23aa)
  •    Q9Z218    Asn-752     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• ANYSLQIYPDESHYFHSVALKQHLSR (26aa)
  •    Q9Z218    Asn-752     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• APGTTIHDPTYQNHSTETPSQTAAAPHSVNVPR (33aa)
  •    Q924X6    Asn-805     Low-density lipoprotein receptor-related protein 8 / Mus musculus
• SHIVVPANTTSAILSGLRPYSSYHVEVQAFNGR (33aa)
  •    P11627    Asn-875     Neural cell adhesion molecule L1 / Mus musculus
• ENDNFNISKDDIDITLFHGENK (22aa)
  •    Q9QZC2    Asn-877     Plexin-C1 / Mus musculus
• ENGSFSGK (8aa)
  •    Q7Z7G0    Asn-878     Target of Nesh-SH3 / Homo sapiens
• FINYNQTVSR (10aa)
  •    Q8N766    Asn-913     ER membrane protein complex subunit 1 / Homo sapiens
• AEPPINASASDQGEK (15aa)
  •    Q9Y4L1    Asn-931     Hypoxia up-regulated protein 1 / Homo sapiens
• RSPSYIICNTTSSEEVLDMK (20aa)
  •    Q80UG2    Asn-1006     Plexin-A4 / Mus musculus
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
• EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (50aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPE (53aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWF (12aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YQLGTSPYVYQLTTRPVTDGQPHSVNITR (29aa)
  •    O54991    Asn-1148     Contactin-associated protein 1 / Mus musculus
• LNYTVLVGEKPCTVTVSDVQLLCESPNLIGR (31aa)
  •    Q80UG2    Asn-1179     Plexin-A4 / Mus musculus
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• MNFTGGDTCHK (11aa)
  •    P11717    Asn-1312     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• SLSPHAGTEPCPPEAAVCLLNGSKPVNLGK (30aa)
  •    Q07113    Asn-1423     Cation-independent mannose-6-phosphate receptor / Mus musculus
• DCADGSDEEACPSLANSTAASTPTQFGQCDRFEFECHQPK (40aa)
  •    O88307    Asn-1458     Sortilin-related receptor / Mus musculus
• AFINGTGVETVVSADLPNAHGLAVDWVSR (29aa)
  •    Q91ZX7    Asn-1646     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• SNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK (37aa)
  •    Q9WTS4    Asn-1669     Teneurin-1 / Mus musculus
• NIYNPPESNASVIFDYSDDGR (21aa)
  •    Q9WTS5    Asn-1983     Teneurin-2 / Mus musculus
• VETGENCTSPAPKEELLPAEETEQDKEHTCETLLMCIVTVLSHGLR (46aa)
  •    P11881-3    Asn-2502     Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• LLLGGLPVSGTFHNFSGCISNVFVQR (26aa)
  •    Q61001    Asn-3261     Laminin subunit alpha-5 / Mus musculus
• VFDLQQNLGSVNVSTGCAPALQAQTPGLGPR (31aa)
  •    O15230    Asn-3287     Laminin subunit alpha-5 / Homo sapiens
• GGSICRDDEFLCNNSLCK (18aa)
  •    Q9JI18    Asn-3682     Low-density lipoprotein receptor-related protein 1B / Mus musculus