Hex:3 HexNAc:6

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mus musculus (House mouse)
• Sus scrofa (Pig)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Dirofilaria immitus (Canine heartworm nematode)
• Trichinella spiralis
• Bothrops moojeni (Brazilian lancehead)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• Adhesion G protein-coupled receptor L2 / Homo sapiens    O95490
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• All-trans retinoic acid-induced differentiation factor / Homo sapiens    Q6UW56
• Alpha-n-acetylglucosaminidase / Homo sapiens    P54802
• Alpha-S1-casein / Homo sapiens    P47710
• Attractin / Homo sapiens    O75882
• Basal cell adhesion molecule / Homo sapiens    P50895
• Cartilage-associated protein / Homo sapiens    O75718
• Cation-independent mannose-6-phosphate receptor / Homo sapiens    P11717
• CD166 antigen / Homo sapiens    Q13740
• Choline transporter-like protein 2 / Homo sapiens    Q8IWA5
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Collagen alpha-2(VI) chain / Homo sapiens    P12110
• Complement c3 / Homo sapiens    P01024
• Dipeptidyl peptidase 1 / Homo sapiens    P53634
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens    Q13444
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens    P78536
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens    P46977
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens    Q8TCJ2
• Dystroglycan / Homo sapiens    Q14118
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens    Q9Y5L3
• Endoplasmin / Homo sapiens    P14625
• ER membrane protein complex subunit 1 / Homo sapiens    Q8N766
• ER membrane protein complex subunit 10 / Homo sapiens    Q5UCC4
• Fibrillin-1 / Homo sapiens    P35555
• Galectin-3-binding protein / Homo sapiens    Q08380
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens    P13284
• Glandular kallikrein 1 / Homo sapiens    P06870
• Glucosylceramidase / Homo sapiens    P04062
• Heat shock 70 kDa protein 13 / Homo sapiens    P48723
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Integrin beta-1 / Homo sapiens    P05556
• Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens    Q06033
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens    Q86UX2
• Interferon gamma / Homo sapiens    P01579
• Interferon-gamma receptor alpha chain / Homo sapiens    P15260
• Lactadherin / Homo sapiens    Q08431
• Laminin subunit alpha-5 / Homo sapiens    O15230
• Laminin subunit beta-1 / Homo sapiens    P07942
• Lysosome membrane protein 2 / Homo sapiens    Q14108
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Mammaglobin-A / Homo sapiens    Q13296
• Mucin-2 / Homo sapiens    Q02817
• Myelin protein zero-like protein 1 / Homo sapiens    O95297
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Neurocan core protein / Homo sapiens    O14594
• Nicastrin / Homo sapiens    Q92542
• Nodal modulator 1 / Homo sapiens    Q15155
• Nodal modulator 2 / Homo sapiens    Q5JPE7
• Nodal modulator 3 / Homo sapiens    P69849
• Olfactomedin-like protein 3 / Homo sapiens    Q9NRN5
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens    Q96AY3
• Peroxidasin homolog / Homo sapiens    Q92626
• Phosphatidylserine synthase 2 / Homo sapiens    Q9BVG9
• Phospholipase B-like 1 / Homo sapiens    Q6P4A8
• Phospholipase D3 / Homo sapiens    Q8IV08
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prenylcysteine oxidase 1 / Homo sapiens    Q9UHG3
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens    Q02809
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens    O60568
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Protein sel-1 homolog 1 / Homo sapiens    Q9UBV2
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens    Q15262
• Reticulocalbin-1 / Homo sapiens    Q15293
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Seipin / Homo sapiens    Q96G97
• Serum paraoxonase/arylesterase 2 / Homo sapiens    Q15165
• Target of Nesh-SH3 / Homo sapiens    Q7Z7G0
• Thrombospondin-1 / Homo sapiens    P07996
• Tissue-type plasminogen activator / Homo sapiens    P00750
• TM2 domain-containing protein 3 / Homo sapiens    Q9BRN9
• Torsin-1A-interacting protein 2 / Homo sapiens    Q8NFQ8
• Transforming growth factor beta-1 / Homo sapiens    P01137
• Translocon-associated protein subunit alpha / Homo sapiens    P43307
• Translocon-associated protein subunit beta / Homo sapiens    P43308
• Transmembrane 9 superfamily member 3 / Homo sapiens    Q9HD45
• Transmembrane protein 87A / Homo sapiens    Q8NBN3
• Transmembrane protein 9 / Homo sapiens    Q9P0T7
• Vitronectin / Homo sapiens    P04004
• Wolframin / Homo sapiens    O76024
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Platelet glycoprotein IV / Bos taurus    P26201
• Thyrotropin-aplha and beta chains / Bos taurus    P01223    P01217
• Uncharacterized protein from Milk / Bos taurus    
• ATPase family AAA domain-containing protein 1 / Mus musculus    Q9D5T0
• Attractin / Mus musculus    Q9WU60
• Beta-hexosaminidase subunit beta / Mus musculus    P20060
• Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus    Q8BTJ4
• Brevican core protein / Mus musculus    Q61361
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cadherin-11 / Mus musculus    P55288
• Calsyntenin-2 / Mus musculus    Q9ER65
• Calsyntenin-3 / Mus musculus    Q99JH7
• Carboxypeptidase M / Mus musculus    Q80V42
• Cathepsin B / Mus musculus    P10605
• Cation-independent mannose-6-phosphate receptor / Mus musculus    Q07113
• Cell cycle control protein 50A / Mus musculus    Q8VEK0
• Cerebellin-3 / Mus musculus    Q9JHG0
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus    Q8VBZ3
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus    Q8BXA5
• Contactin-1 / Mus musculus    P12960
• Contactin-associated protein 1 / Mus musculus    O54991
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus    Q91YQ5
• Ectonucleoside triphosphate diphosphohydrolase 3 / Mus musculus    Q8BFW6
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus    Q9R1E6
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus    Q9EQG7
• Endoplasmic reticulum aminopeptidase 1 / Mus musculus    Q9EQH2
• Endoplasmic reticulum metallopeptidase 1 / Mus musculus    Q3UVK0
• Endoplasmic reticulum-Golgi intermediate compartment protein 3 / Mus musculus    Q9CQE7
• Endoplasmin / Mus musculus    P08113
• Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus    Q3UZV7
• ER membrane protein complex subunit 10 / Mus musculus    Q3TAS6
• Extracellular sulfatase Sulf-2 / Mus musculus    Q8CFG0
• Glutamate carboxypeptidase 2 / Mus musculus    O35409
• Glutamate receptor 2 / Mus musculus    P23819
• Glutamate receptor 3 / Mus musculus    Q9Z2W9
• Glutamate receptor 4 / Mus musculus    Q9Z2W8
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus    P35438
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus    Q9R1V6-16
• Isoform 2 of Integrin alpha-3 / Mus musculus    Q62470-2
• Isoform 2 of Protein O-mannosyl-transferase 2 / Mus musculus    Q8BGQ4-2
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus    O08532-4
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus    P11881-3
• Laminin subunit alpha-5 / Mus musculus    Q61001
• Leucyl-cystinyl aminopeptidase / Mus musculus    Q8C129
• Low-density lipoprotein receptor-related protein 1B / Mus musculus    Q9JI18
• Low-density lipoprotein receptor-related protein 8 / Mus musculus    Q924X6
• Monoacylglycerol lipase ABHD12 / Mus musculus    Q99LR1
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus    Q9Z2L6
• N-acetylgalactosamine-6-sulfatase / Mus musculus    Q571E4
• Nectin-1 / Mus musculus    Q9JKF6
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neural cell adhesion molecule L1-like protein / Mus musculus    P70232
• Neurofascin / Mus musculus    A0A087WPX3
• Neuronal cell adhesion molecule / Mus musculus    Q810U4
• Neuroplastin / Mus musculus    P97300
• Neuroserpin / Mus musculus    O35684
• Neutral cholesterol ester hydrolase 1 / Mus musculus    Q8BLF1
• Nicastrin / Mus musculus    P57716
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus    Q9Z247
• Phospholipase D3 / Mus musculus    O35405
• Plexin-A4 / Mus musculus    Q80UG2
• Plexin-C1 / Mus musculus    Q9QZC2
• Pro-opiomelanocortin / Mus musculus    P01193
• Probable G-protein coupled receptor 158 / Mus musculus    Q8C419
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus    Q91ZX7
• Prosaposin / Mus musculus    Q61207
• Protein canopy homolog 3 / Mus musculus    Q9DAU1
• Protein CREG2 / Mus musculus    Q8BGC9
• Protein FAM234A / Mus musculus    Q8C0Z1
• Protein NOV homolog / Mus musculus    Q64299
• Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus    Q8BW41
• Protocadherin Fat 1 / Mus musculus    F2Z4A3
• Reticulocalbin-1 / Mus musculus    Q05186
• Semaphorin-7A / Mus musculus    Q9QUR8
• Serotransferrin / Mus musculus    Q921I1
• Serum paraoxonase/arylesterase 2 / Mus musculus    Q62086
• Sodium channel subunit beta-4 / Mus musculus    Q7M729
• Sodium/hydrogen exchanger 1 / Mus musculus    Q61165
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus    P14094
• Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus    P97370
• Sortilin-related receptor / Mus musculus    O88307
• SUN domain-containing ossification factor / Mus musculus    Q8C341
• Synaptotagmin-1 / Mus musculus    P46096
• Tenascin-r / Mus musculus    Q8BYI9
• Teneurin-1 / Mus musculus    Q9WTS4
• Teneurin-2 / Mus musculus    Q9WTS5
• Thioredoxin domain-containing protein 15 / Mus musculus    Q6P6J9
• Translocon-associated protein subunit beta / Mus musculus    Q9CPW5
• Tumor suppressor candidate 3 / Mus musculus    Q8BTV1
• VIP36-like protein / Mus musculus    P59481
• Uncharacterized protein from Aorta / Sus scrofa    
• Ovalbumin / Gallus gallus    P01012
• Ovomucoid / Gallus gallus    P01005
• Ovotransferrin / Gallus gallus    P02789
• Riboflavin-binding protein / Gallus gallus    P02752
• Uncharacterized protein / Gallus gallus    
• Acetylcholine receptor protein / Torpedo californica    P02710    P02714    P02718    P02712
• Uncharacterized protein / Dirofilaria immitus    
• Tsl-1 antigens / Trichinella spiralis    
• Batroxobin / Bothrops moojeni    
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Aorta (UBERON_0000947)   MYP30 (CVCL_Z591)   Endothelial Cell (CL_0000115)  
• Blood Serum (UBERON_0001977)  
• Brain (UBERON_0000955)  
• Colonic Mucosa (UBERON_0000317)  
• Electric Organ (UBERON_0006869)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Milk (UBERON_0001913)   Plasma Membrane (GO_0005886)  
• Ovary (UBERON_0000992)   IM4/V/IV (CVCL_VT67)  
• Ovary (UBERON_0000992)   IM4/V/IV-G1 (CVCL_VT68)  
• Ovary (UBERON_0000992)   IM4/V/IV-G2 (CVCL_VT69)  
• Ovary (UBERON_0000992)   IM4/V/IV-G3 (CVCL_VT70)  
• Ovary (UBERON_0000992)   IM4/V/IV-G4 (CVCL_VT71)  
• Ovary (UBERON_0000992)   IM4/V/IV-G5 (CVCL_VT72)  
• Pituitary Gland (UBERON_0000007)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Spleen (UBERON_0002106)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Egg Cell  
• Egg Cell   Egg White  

Reported structure

• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-3)[GalNAc(?1-?)GlcNAc(?1-?)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)[GlcNAc(?1-4)]Man(a1-3)[GlcNAc(?1-2)[GlcNAc(?1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-4)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-?)[GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ GalNAc(b1-4)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ 2 x HexNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-4)GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9423
• N-Linked / Complex / Structure 10018
• O-Linked / Core 3 / GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-3)[GalNAc(a1-3)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-3)GalNAc

Composition

• Hex:3 HexNAc:6 (avg mass : 1723.6125 )

Disease

• Cancer, breast (DOID:1612)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diverticulosis (DOID:7475)
• Gaucher Disease (DOID:1926)
• Melanoma (DOID:1909)
• Prostate cancer (DOID:10283)

Reference

• Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
• The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing (2001 - Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Down-regulation of the alpha-Gal epitope expression in N-glycans of swine endothelial cells by transfection with the N-acetylglucosaminyltransferase III gene. Modulation of the biosynthesis of terminal structures by a bisecting GlcNAc (2001 - Koyoto, Ikeda, Miyagawa, Ihara, Koma, Honke, Shirakura, Taniguchi) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins. (2000 - Harvey D, Wing D, Kuster B, Wilson I) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• 1H NMR characterization of a hen ovalbumin tyrosinamide N-linked oligosaccharide library. (1995 - Corradi Da Silva M, Stubbs H, Tamura T, Rice K) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Derivatization and purification of bisecting tyrosinamide-oligosaccharides from ovotransferrin. (1994 - Corradi da Silva M, Tamura T, Rice K) / Status : Reviewed
• Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Most bovine milk fat globule membrane glycoproteins contain asparagine-linked sugar chains with GalNAc beta 1-->4GlcNAc groups. (1993 - Sato T, Furukawa K, Greenwalt D, Kobata A) / Status : Reviewed
• Structural study of the sugar chains of CD36 purified from bovine mammary epithelial cells: occurrence of novel hybrid-type sugar chains containing the Neu5Ac alpha 2-->6GalNAc beta 1-->4GlcNAc and the Man alpha 1-->2Man alpha 1-->3Man alpha 1-->6Man groups. (1993 - Nakata N, Furukawa K, Greenwalt D, Sato T, Kobata A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
• Structural studies of the sugar chains of hen ovomucoid. Evidence indicating that they are formed mainly by the alternate biosynthetic pathway of asparagine-linked sugar chains. (1983 - Yamashita K, Kamerling JP, Kobata A) / Status : Reviewed

Reported glycosite

• Adhesion G protein-coupled receptor L2 / Homo sapiens
  •        Asn-731
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
  •        Asn-196
• All-trans retinoic acid-induced differentiation factor / Homo sapiens
  •        Asn-44
• Alpha-n-acetylglucosaminidase / Homo sapiens
  •        Asn-261
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Attractin / Homo sapiens
  •        Asn-300
• Basal cell adhesion molecule / Homo sapiens
  •        Asn-419
• Cartilage-associated protein / Homo sapiens
  •        Asn-87
• Cation-independent mannose-6-phosphate receptor / Homo sapiens
  •        Asn-581
  •        Asn-1312
• CD166 antigen / Homo sapiens
  •        Asn-480
• Choline transporter-like protein 2 / Homo sapiens
  •        Asn-417
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-2528
• Collagen alpha-2(VI) chain / Homo sapiens
  •        Asn-785
• Complement c3 / Homo sapiens
  •        Asn-85
• Dipeptidyl peptidase 1 / Homo sapiens
  •        Asn-29
  •        Asn-276
• Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
  •        Asn-389
• Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
  •        Asn-264
  •        Asn-551
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
  •        Asn-544
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
  •        Asn-623
  •        Asn-641
• Dystroglycan / Homo sapiens
  •        Asn-661
• Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
  •        Asn-443
• Endoplasmin / Homo sapiens
  •        Asn-217
• ER membrane protein complex subunit 1 / Homo sapiens
  •        Asn-913
• ER membrane protein complex subunit 10 / Homo sapiens
  •        Asn-182
• Fibrillin-1 / Homo sapiens
  •        Asn-1067
• Galectin-3-binding protein / Homo sapiens
  •        Asn-551
• Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
  •        Asn-63
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Glucosylceramidase / Homo sapiens
  •        Asn-58
• Heat shock 70 kDa protein 13 / Homo sapiens
  •        Asn-137
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-596
  •        Asn-931
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Integrin beta-1 / Homo sapiens
  •        Asn-50
  •        Asn-212
  •        Asn-669
• Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
  •        Asn-91
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-81
• Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
  •        Asn-97
• Interferon gamma / Homo sapiens
  •        Undefined site
• Interferon-gamma receptor alpha chain / Homo sapiens
  •        Asn-179
• Lactadherin / Homo sapiens
  •        Asn-238
• Laminin subunit alpha-5 / Homo sapiens
  •        Asn-3287
• Laminin subunit beta-1 / Homo sapiens
  •        Asn-1279
• Lysosome membrane protein 2 / Homo sapiens
  •        Asn-249
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-241
  •        Asn-261
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
• Mammaglobin-A / Homo sapiens
  •        Asn-53
• Mucin-2 / Homo sapiens
  •        Undefined site
• Myelin protein zero-like protein 1 / Homo sapiens
  •        Asn-50
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-505
• Neurocan core protein / Homo sapiens
  •        Asn-122
• Nicastrin / Homo sapiens
  •        Asn-417
  •        Asn-506
  •        Asn-612
• Nodal modulator 1 / Homo sapiens
  •        Asn-218
• Nodal modulator 2 / Homo sapiens
  •        Asn-218
• Nodal modulator 3 / Homo sapiens
  •        Asn-218
• Olfactomedin-like protein 3 / Homo sapiens
  •        Asn-177
• Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
  •        Asn-294
• Peroxidasin homolog / Homo sapiens
  •        Asn-731
• Phosphatidylserine synthase 2 / Homo sapiens
  •        Asn-181
• Phospholipase B-like 1 / Homo sapiens
  •        Asn-411
• Phospholipase D3 / Homo sapiens
  •        Asn-284
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-90
  •        Asn-499
• Prenylcysteine oxidase 1 / Homo sapiens
  •        Asn-196
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
  •        Asn-686
• Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
  •        Asn-63
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Protein sel-1 homolog 1 / Homo sapiens
  •        Asn-272
  •        Asn-608
• Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
  •        Asn-140
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Seipin / Homo sapiens
  •        Asn-88
• Serum paraoxonase/arylesterase 2 / Homo sapiens
  •        Asn-323
• Target of Nesh-SH3 / Homo sapiens
  •        Asn-878
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
  •        Asn-1067
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• TM2 domain-containing protein 3 / Homo sapiens
  •        Asn-140
• Torsin-1A-interacting protein 2 / Homo sapiens
  •        Asn-286
• Transforming growth factor beta-1 / Homo sapiens
  •        Asn-82
• Translocon-associated protein subunit alpha / Homo sapiens
  •        Asn-136
• Translocon-associated protein subunit beta / Homo sapiens
  •        Asn-88
  •        Asn-104
• Transmembrane 9 superfamily member 3 / Homo sapiens
  •        Asn-174
• Transmembrane protein 87A / Homo sapiens
  •        Asn-62
• Transmembrane protein 9 / Homo sapiens
  •        Asn-47
• Vitronectin / Homo sapiens
  •        Asn-169
• Wolframin / Homo sapiens
  •        Asn-661
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-109
• Platelet glycoprotein IV / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Milk / Bos taurus
  •        Undefined site
• ATPase family AAA domain-containing protein 1 / Mus musculus
  •        Asn-316
• Attractin / Mus musculus
  •        Asn-263
• Beta-hexosaminidase subunit beta / Mus musculus
  •        Asn-306
• Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
  •        Asn-389
• Brevican core protein / Mus musculus
  •        Asn-129
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-44
• Cadherin-11 / Mus musculus
  •        Asn-540
• Calsyntenin-2 / Mus musculus
  •        Asn-720
• Calsyntenin-3 / Mus musculus
  •        Asn-507
• Carboxypeptidase M / Mus musculus
  •        Asn-363
• Cathepsin B / Mus musculus
  •        Asn-192
• Cation-independent mannose-6-phosphate receptor / Mus musculus
  •        Asn-1423
• Cell cycle control protein 50A / Mus musculus
  •        Asn-297
• Cerebellin-3 / Mus musculus
  •        Asn-82
• Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
  •        Asn-241
• Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
  •        Asn-101
• Contactin-1 / Mus musculus
  •        Asn-258
  •        Asn-338
• Contactin-associated protein 1 / Mus musculus
  •        Asn-277
  •        Asn-1148
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-258
  •        Asn-474
  •        Asn-752
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
  •        Asn-300
• Ectonucleoside triphosphate diphosphohydrolase 3 / Mus musculus
  •        Asn-81
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
  •        Asn-524
• Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
  •        Asn-101
  •        Asn-292
• Endoplasmic reticulum aminopeptidase 1 / Mus musculus
  •        Asn-403
• Endoplasmic reticulum metallopeptidase 1 / Mus musculus
  •        Asn-724
• Endoplasmic reticulum-Golgi intermediate compartment protein 3 / Mus musculus
  •        Asn-266
• Endoplasmin / Mus musculus
  •        Asn-62
  •        Asn-217
• Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus
  •        Asn-715
• ER membrane protein complex subunit 10 / Mus musculus
  •        Asn-182
• Extracellular sulfatase Sulf-2 / Mus musculus
  •        Asn-112
  •        Asn-566
• Glutamate carboxypeptidase 2 / Mus musculus
  •        Asn-478
• Glutamate receptor 2 / Mus musculus
  •        Asn-256
• Glutamate receptor 3 / Mus musculus
  •        Asn-260
• Glutamate receptor 4 / Mus musculus
  •        Asn-258
• Glutamate receptor ionotropic, NMDA 1 / Mus musculus
  •        Asn-368
• Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
  •        Asn-163
• Isoform 2 of Integrin alpha-3 / Mus musculus
  •        Asn-606
• Isoform 2 of Protein O-mannosyl-transferase 2 / Mus musculus
  •        Asn-330
• Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
  •        Asn-136
• Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
  •        Asn-2502
• Laminin subunit alpha-5 / Mus musculus
  •        Asn-3261
• Leucyl-cystinyl aminopeptidase / Mus musculus
  •        Asn-525
• Low-density lipoprotein receptor-related protein 1B / Mus musculus
  •        Asn-3682
• Low-density lipoprotein receptor-related protein 8 / Mus musculus
  •        Asn-805
• Monoacylglycerol lipase ABHD12 / Mus musculus
  •        Asn-123
• Multiple inositol polyphosphate phosphatase 1 / Mus musculus
  •        Asn-236
• N-acetylgalactosamine-6-sulfatase / Mus musculus
  •        Asn-421
• Nectin-1 / Mus musculus
  •        Asn-202
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-875
• Neural cell adhesion molecule L1-like protein / Mus musculus
  •        Asn-476
• Neurofascin / Mus musculus
  •        Asn-305
  •        Asn-409
  •        Asn-483
• Neuronal cell adhesion molecule / Mus musculus
  •        Asn-77
  •        Asn-427
  •        Asn-501
• Neuroplastin / Mus musculus
  •        Asn-228
• Neuroserpin / Mus musculus
  •        Asn-321
• Neutral cholesterol ester hydrolase 1 / Mus musculus
  •        Asn-270
• Nicastrin / Mus musculus
  •        Asn-54
  •        Asn-128
• Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus
  •        Asn-286
• Phospholipase D3 / Mus musculus
  •        Asn-282
• Plexin-A4 / Mus musculus
  •        Asn-1006
  •        Asn-1179
• Plexin-C1 / Mus musculus
  •        Asn-877
• Pro-opiomelanocortin / Mus musculus
  •        Asn-152
• Probable G-protein coupled receptor 158 / Mus musculus
  •        Asn-215
• Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
  •        Asn-137
  •        Asn-1646
• Prosaposin / Mus musculus
  •        Asn-459
• Protein canopy homolog 3 / Mus musculus
  •        Asn-153
• Protein CREG2 / Mus musculus
  •        Asn-164
• Protein FAM234A / Mus musculus
  •        Asn-144
• Protein NOV homolog / Mus musculus
  •        Asn-277
• Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
  •        Asn-337
• Protocadherin Fat 1 / Mus musculus
  •        Asn-41
• Reticulocalbin-1 / Mus musculus
  •        Asn-47
• Semaphorin-7A / Mus musculus
  •        Asn-256
• Serotransferrin / Mus musculus
  •        Asn-513
• Serum paraoxonase/arylesterase 2 / Mus musculus
  •        Asn-323
• Sodium channel subunit beta-4 / Mus musculus
  •        Asn-113
• Sodium/hydrogen exchanger 1 / Mus musculus
  •        Asn-76
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
  •        Asn-193
• Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
  •        Asn-124
• Sortilin-related receptor / Mus musculus
  •        Asn-1458
• SUN domain-containing ossification factor / Mus musculus
  •        Asn-201
• Synaptotagmin-1 / Mus musculus
  •        Asn-24
• Tenascin-r / Mus musculus
  •        Asn-470
• Teneurin-1 / Mus musculus
  •        Asn-1669
• Teneurin-2 / Mus musculus
  •        Asn-1983
• Thioredoxin domain-containing protein 15 / Mus musculus
  •        Asn-149
• Translocon-associated protein subunit beta / Mus musculus
  •        Asn-104
• Tumor suppressor candidate 3 / Mus musculus
  •        Asn-83
• VIP36-like protein / Mus musculus
  •        Asn-180
• Uncharacterized protein from Aorta / Sus scrofa
  •        Undefined site
• Ovalbumin / Gallus gallus
  •        Undefined site
• Ovomucoid / Gallus gallus
  •        Undefined site
• Ovotransferrin / Gallus gallus
  •        Undefined site
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Uncharacterized protein / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Uncharacterized protein / Dirofilaria immitus
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-282
  •        Asn-615
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-717
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-343

Mass spectrometry observed peptide

• VSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSK (40aa)
  •    P46096    Asn-24     Synaptotagmin-1 / Mus musculus
• DTPANCTYLDLLGTWVFQVGSSGSQR (26aa)
  •    P53634    Asn-29     Dipeptidyl peptidase 1 / Homo sapiens
• LEPTPPIQFTHFQYNVTVHENSAAK (25aa)
  •    F2Z4A3    Asn-41     Protocadherin Fat 1 / Mus musculus
• ADVGGEAAGTAINHSHMLLQR (21aa)
  •    Q9DB72    Asn-44     BTB/POZ domain-containing protein 17 / Mus musculus
• LPEICTQCPGSVQNLSK (17aa)
  •    Q6UW56    Asn-44     All-trans retinoic acid-induced differentiation factor / Homo sapiens
• IYNQNVSQK (9aa)
  •    Q9P0T7    Asn-47     Transmembrane protein 9 / Homo sapiens
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q05186    Asn-47     Reticulocalbin-1 / Mus musculus
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• SCGECIQAGPNCGWCTNSTFIQEGMPTSAR (30aa)
  •    P05556    Asn-50     Integrin beta-1 / Homo sapiens
• EIFVANGTQGK (11aa)
  •    O95297    Asn-50     Myelin protein zero-like protein 1 / Homo sapiens
• WFSAGLASNSSWLREK (16aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53     Reticulocalbin-1 / Homo sapiens
• ELLQEFIDDNATTNAIDELK (20aa)
  •    Q13296    Asn-53     Mammaglobin-A / Homo sapiens
• LLNATHQIGCQSSISGDTGVIHVVEKEEDLK (31aa)
  •    P57716    Asn-54     Nicastrin / Mus musculus
• SFGYSSVVCVCNATYCDSFDPPTFPALGTFSR (32aa)
  •    P04062    Asn-58     Glucosylceramidase / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGSRTDDEVVQREEEAIQLDGLNASQIR (28aa)
  •    P08113    Asn-62     Endoplasmin / Mus musculus
• NTTIFLK (7aa)
  •    Q8NBN3    Asn-62     Transmembrane protein 87A / Homo sapiens
• SAEFFNYTVR (10aa)
  •    O60568    Asn-63     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 / Homo sapiens
• SNAPIVNVTIYYEAICGGCR (20aa)
  •    P13284    Asn-63     Gamma-interferon-inducible lysosomal thiol reductase / Homo sapiens
• KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SIGDVTTAPSEPLHRPDDHNLTNLIIEHGGKPSR (34aa)
  •    Q61165    Asn-76     Sodium/hydrogen exchanger 1 / Mus musculus
• SIGDVTTAPSEPLHRPDDHNLTNLIIEHGGKPSRK (35aa)
  •    Q61165    Asn-76     Sodium/hydrogen exchanger 1 / Mus musculus
• NGTHFDIDKDPLVTMKPGSGTLVINIMSEGK (31aa)
  •    Q810U4    Asn-77     Neuronal cell adhesion molecule / Mus musculus
• SVVAPATDGGLNLTSTFLRK (20aa)
  •    P41222    Asn-78     Prostaglandin-h2 d-isomerase / Homo sapiens
• TTVYVYQWPAEKENNTGVVSQTFR (24aa)
  •    Q8BFW6    Asn-81     Ectonucleoside triphosphate diphosphohydrolase 3 / Mus musculus
• AFITNF (6aa)
  •    Q86UX2    Asn-97     Inter-alpha-trypsin inhibitor heavy chain H5 / Homo sapiens
  •    Q06033    Asn-91     Inter-alpha-trypsin inhibitor heavy chain H3 / Homo sapiens
  •    Q14624    Asn-81     Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
• IASPPSQGEVPPGPIPEAVIAIYNSTR (27aa)
  •    P01137    Asn-82     Transforming growth factor beta-1 / Homo sapiens
• SHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDR (33aa)
  •    Q9JHG0    Asn-82     Cerebellin-3 / Mus musculus
• APPRNYSMIVMFTALQPQR (19aa)
  •    Q8BTV1    Asn-83     Tumor suppressor candidate 3 / Mus musculus
• TVITPATNHMGNVTFTIPANR (21aa)
  •    P01024    Asn-85     Complement c3 / Homo sapiens
• NCSAAPQPEPAAGLASYPELR (21aa)
  •    O75718    Asn-87     Cartilage-associated protein / Homo sapiens
• TDCDSSTTSICSFPVANVSITK (22aa)
  •    Q96G97    Asn-88     Seipin / Homo sapiens
• IAPASNVSHTVVIRPIK (17aa)
  •    P43308    Asn-88     Translocon-associated protein subunit beta / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
  •    P01833    Asn-90     Polymeric immunoglobulin receptor / Homo sapiens
• NNGTLYAYIFLHHAGILPWQDGK (23aa)
  •    Q8BXA5    Asn-101     Cleft lip and palate transmembrane protein 1-like protein / Mus musculus
• TYPNHYTLVTGLFAENHGIVANDMFDPILNK (31aa)
  •    Q9EQG7    Asn-101     Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
• AGYFNFTSATITYIAQEDGPVVIGSTSAPGQGGIIAQR (38aa)
  •    P43308    Asn-104     Translocon-associated protein subunit beta / Homo sapiens
• AGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQR (38aa)
  •    Q9CPW5    Asn-104     Translocon-associated protein subunit beta / Mus musculus
• DIVEYYNDSNGSHVIQGR (18aa)
  •    P25311    Asn-109     Zinc-alpha-2-glycoprotein / Homo sapiens
• YVHNHNTYTNNENCSSPSWQAQHESR (26aa)
  •    Q8CFG0    Asn-112     Extracellular sulfatase Sulf-2 / Mus musculus
• TNNISILLSDLEFSDTGR (18aa)
  •    Q7M729    Asn-113     Sodium channel subunit beta-4 / Mus musculus
• ANATLLLGPLR (11aa)
  •    O14594    Asn-122     Neurocan core protein / Homo sapiens
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KPQDQGLNHTCNYYLQPEDDVTIGVWHTIPSVWWK (35aa)
  •    Q99LR1    Asn-123     Monoacylglycerol lipase ABHD12 / Mus musculus
• LVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPDYR (37aa)
  •    P97370    Asn-124     Sodium/potassium-transporting ATPase subunit beta-3 / Mus musculus
• IAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCK (43aa)
  •    P57716    Asn-128     Nicastrin / Mus musculus
• VALPAYPASLTDVSLVLSELRPNDSGVYR (29aa)
  •    Q61361    Asn-129     Brevican core protein / Mus musculus
• VQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQR (38aa)
  •    O08532-4    Asn-136     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• EDFASNEVVYYNAKDDLDPERNESEPGSQR (30aa)
  •    O08532-4    Asn-136     Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
• YPQDYQFYIQNFTAIPINTVVPPQR (25aa)
  •    P43307    Asn-136     Translocon-associated protein subunit alpha / Homo sapiens
• MGCQHHCVPTPSGPTCYCNSSFQLQADGK (29aa)
  •    Q91ZX7    Asn-137     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• SVTSNETITVSPEYVGSR (18aa)
  •    P48723    Asn-137     Heat shock 70 kDa protein 13 / Homo sapiens
• FCWQLPETDYECTNSTSCMTVSCPR (25aa)
  •    Q9BRN9    Asn-140     TM2 domain-containing protein 3 / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• GPLANPIWNVTGFTGR (16aa)
  •    Q15262    Asn-140     Receptor-type tyrosine-protein phosphatase kappa / Homo sapiens
• SCADEGFSTPCAFVVAVSGANGSVLWERPVAQDVALVK (38aa)
  •    Q8C0Z1    Asn-144     Protein FAM234A / Mus musculus
• ENLFGLQGAGGFQDREEEYYAEPGVTEAEPVATEDANSTDSLKSPK (46aa)
  •    Q6P6J9    Asn-149     Thioredoxin domain-containing protein 15 / Mus musculus
• VYPNVAENESAEAFPLEFK (19aa)
  •    P01193    Asn-152     Pro-opiomelanocortin / Mus musculus
• VVMDIPYELWNETSAEVADLKK (22aa)
  •    Q9DAU1    Asn-153     Protein canopy homolog 3 / Mus musculus
• AGPNGTIFVADAYK (14aa)
  •    Q9HDC9    Asn-160     Adipocyte plasma membrane-associated protein / Homo sapiens
• GNPVSFVALSTCHGLHGMFYDGNHTYLIEPEENEK (35aa)
  •    Q9R1V6-16    Asn-163     Isoform 14 of Disintegrin and metalloproteinase domain-containing protein 22 / Mus musculus
• IQGLPFGSCLAISDGPVHNSTGIPFFYMTAK (31aa)
  •    Q8BGC9    Asn-164     Protein CREG2 / Mus musculus
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGSLFAFR (8aa)
  •    P04004    Asn-169     Vitronectin / Homo sapiens
• IVDVNITSEGK (11aa)
  •    Q9HD45    Asn-174     Transmembrane 9 superfamily member 3 / Homo sapiens
• IYVIDGTQNDTAFVFPR (17aa)
  •    Q9NRN5    Asn-177     Olfactomedin-like protein 3 / Homo sapiens
• MNGSEIQYK (9aa)
  •    P15260    Asn-179     Interferon-gamma receptor alpha chain / Homo sapiens
• VFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVR (35aa)
  •    P59481    Asn-180     VIP36-like protein / Mus musculus
• DYGGNCIIYDPDNETDPFHNIWDK (24aa)
  •    Q9BVG9    Asn-181     Phosphatidylserine synthase 2 / Homo sapiens
• GSEVEDEDLELFNTSVQLRPPSTAPGPETAAFIER (35aa)
  •    Q3TAS6    Asn-182     ER membrane protein complex subunit 10 / Mus musculus
• GHEVEDVDIEIFNTSVQIQPPTTAPGPETAAFIER (35aa)
  •    Q5UCC4    Asn-182     ER membrane protein complex subunit 10 / Homo sapiens
• KGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPR (42aa)
  •    P10605    Asn-192     Cathepsin B / Mus musculus
• GLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPR (41aa)
  •    P10605    Asn-192     Cathepsin B / Mus musculus
• VLGFKPKPPKNESLETYPLMMK (22aa)
  •    P14094    Asn-193     Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
• IIHAIGGDDFIGMINR (16aa)
  •    Q9UHG3    Asn-196     Prenylcysteine oxidase 1 / Homo sapiens
• NMSFVNDLTVTQDGR (15aa)
  •    Q9HDC9    Asn-196     Adipocyte plasma membrane-associated protein / Homo sapiens
• SGTLSIAKPGEVEQPEADCDAGEAPDADAPVEQPAFVSPPESLVGQHIENVSSSHGK (57aa)
  •    Q8C341    Asn-201     SUN domain-containing ossification factor / Mus musculus
• LKGEAEYQEIRNPNGTVTVISR (22aa)
  •    Q9JKF6    Asn-202     Nectin-1 / Mus musculus
• NPCTSEQNCTSPFSYK (16aa)
  •    P05556    Asn-212     Integrin beta-1 / Homo sapiens
• ILLQDLSSSAHHLANATLETEWFHGLR (27aa)
  •    Q8C419    Asn-215     Probable G-protein coupled receptor 158 / Mus musculus
• HNNDTQHIWESDSNEFSVIADPR (23aa)
  •    P08113    Asn-217     Endoplasmin / Mus musculus
  •    P14625    Asn-217     Endoplasmin / Homo sapiens
• AASPLIVAGYNVSGSVR (17aa)
  •    Q5JPE7    Asn-218     Nodal modulator 2 / Homo sapiens
  •    Q15155    Asn-218     Nodal modulator 1 / Homo sapiens
  •    P69849    Asn-218     Nodal modulator 3 / Homo sapiens
• AEDSGEYHCVYHFVSAPKANATIEVK (26aa)
  •    P97300    Asn-228     Neuroplastin / Mus musculus
• FLTDVERNETALYHVEAFK (19aa)
  •    Q9Z2L6    Asn-236     Multiple inositol polyphosphate phosphatase 1 / Mus musculus
• NNSIPDK (7aa)
  •    Q08431    Asn-238     Lactadherin / Homo sapiens
• MGLQLNLTYER (11aa)
  •    P11279    Asn-241     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• RAEDYGPVEVISHWHPNITINIVDDHTPWVK (31aa)
  •    Q8VBZ3    Asn-241     Cleft lip and palate transmembrane protein 1 homolog / Mus musculus
• CNMINGTDGDSFHPIITK (18aa)
  •    Q14108    Asn-249     Lysosome membrane protein 2 / Homo sapiens
• IQFGGANVSGFQIVDYDDSLVSK (23aa)
  •    P23819    Asn-256     Glutamate receptor 2 / Mus musculus
• EDNPDKNPEAPLNVSR (16aa)
  •    Q9QUR8    Asn-256     Semaphorin-7A / Mus musculus
• ATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSR (35aa)
  •    Q9QUR8    Asn-256     Semaphorin-7A / Mus musculus
• LAYATINDSRVPLMELPTYTGSVYPTVKPYHYPK (34aa)
  •    Q9Z218    Asn-258     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• DIYTMMGQNVTLECFALGNPVPDIR (25aa)
  •    P12960    Asn-258     Contactin-1 / Mus musculus
• FIHGGANVTGFQLVDFNTPMVTK (23aa)
  •    Q9Z2W8    Asn-258     Glutamate receptor 4 / Mus musculus
• VMHGGANITGFQIVNNENPMVQQFIQR (27aa)
  •    Q9Z2W9    Asn-260     Glutamate receptor 3 / Mus musculus
• FPQVNVTK (8aa)
  •    P54802    Asn-261     Alpha-n-acetylglucosaminidase / Homo sapiens
• IININPNK (8aa)
  •    P11279    Asn-261     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• SSNSSSAVECECSENWKGESCDIPHCTDNCGFPHR (35aa)
  •    Q9WU60    Asn-263     Attractin / Mus musculus
• NTSWDNAGFK (10aa)
  •    P78536    Asn-264     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• HLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVK (34aa)
  •    Q9CQE7    Asn-266     Endoplasmic reticulum-Golgi intermediate compartment protein 3 / Mus musculus
• GNYDFVEAMIVNNHTSLDVER (21aa)
  •    Q8BLF1    Asn-270     Neutral cholesterol ester hydrolase 1 / Mus musculus
• GQTAIGFIYASGIGVNSSQAK (21aa)
  •    Q9UBV2    Asn-272     Protein sel-1 homolog 1 / Homo sapiens
• IITNNSQTPIISPQEVVSCSQYAQGCEGGFPYIIAGK (37aa)
  •    P53634    Asn-276     Dipeptidyl peptidase 1 / Homo sapiens
• DANFTLDGYAHHFVLNGDFER (21aa)
  •    O54991    Asn-277     Contactin-associated protein 1 / Mus musculus
• AIHLQFENCTSLYTYKPR (18aa)
  •    Q64299    Asn-277     Protein NOV homolog / Mus musculus
• YNQETPMEICLNGTPALAYLASAPPPLCPSGR (32aa)
  •    Q8IV08    Asn-284     Phospholipase D3 / Homo sapiens
  •    O35405    Asn-282     Phospholipase D3 / Mus musculus
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• HINASNPTEPATIIFTAAR (19aa)
  •    Q8NFQ8    Asn-286     Torsin-1A-interacting protein 2 / Homo sapiens
• YHYNGTLLDGTLFDSSYSR (19aa)
  •    Q9Z247    Asn-286     Peptidyl-prolyl cis-trans isomerase FKBP9 / Mus musculus
• EGKFDEVYDALAGAHPNLTVYK (22aa)
  •    Q9EQG7    Asn-292     Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 / Mus musculus
• YHYNGSIMDGTIFDSSYSR (19aa)
  •    Q96AY3    Asn-294     Peptidyl-prolyl cis-trans isomerase FKBP10 / Homo sapiens
• DDLHPTLPAGQYFLNITYNYPVHSFDGR (28aa)
  •    Q8VEK0    Asn-297     Cell cycle control protein 50A / Mus musculus
• DEIGNVSTSHLLILDDSVEMEIRPR (25aa)
  •    Q91YQ5    Asn-300     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
• GICNSSDVR (9aa)
  •    O75882    Asn-300     Attractin / Homo sapiens
• TILPAAAQDVYYRDEIGNVSTSHLLILDDSVEMEIRPR (38aa)
  •    Q91YQ5    Asn-300     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 / Mus musculus
• ITNVSEEDSGEYFCLASNK (19aa)
  •    A0A087WPX3    Asn-305     Neurofascin / Mus musculus
• TQVFGPVDPTVNTTYAFFNTFFK (23aa)
  •    P20060    Asn-306     Beta-hexosaminidase subunit beta / Mus musculus
• EYVNSTSEESHDEDEIRPVQQQDLHR (26aa)
  •    Q9D5T0    Asn-316     ATPase family AAA domain-containing protein 1 / Mus musculus
• ALGVTEIFIKDANLTAMSDKK (21aa)
  •    O35684    Asn-321     Neuroserpin / Mus musculus
• IQNILSEKPSVTTVYINNGSVLQGSSVATIYDRK (34aa)
  •    Q62086    Asn-323     Serum paraoxonase/arylesterase 2 / Mus musculus
• IQNIISEKPTVTTVYANNGSVIQGSSVASVYDGK (34aa)
  •    Q15165    Asn-323     Serum paraoxonase/arylesterase 2 / Homo sapiens
• IQNILSEKPSVTTVYINNGSVLQGSSVATIYDR (33aa)
  •    Q62086    Asn-323     Serum paraoxonase/arylesterase 2 / Mus musculus
• LSGNSLHNASIPEHLAYGSVITVK (24aa)
  •    Q8BGQ4-2    Asn-330     Isoform 2 of Protein O-mannosyl-transferase 2 / Mus musculus
• LVSNASMLVSMHGAQLVTALFLPR (24aa)
  •    Q8BW41    Asn-337     Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 / Mus musculus
• IYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIR (39aa)
  •    P12960    Asn-338     Contactin-1 / Mus musculus
• RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
  •    P01876    Asn-340     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• GEVFNATR (8aa)
  •    P0DTC2    Asn-343     Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• KVSCPIMPCSNATVPDGECCPR (22aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360     Thrombospondin-1 / Homo sapiens
• LGEYYLLLLPGSYVINVTVPGHDSYLTK (28aa)
  •    Q80V42    Asn-363     Carboxypeptidase M / Mus musculus
• KLVQVGIYNGTHVIPNDRK (19aa)
  •    P35438    Asn-368     Glutamate receptor ionotropic, NMDA 1 / Mus musculus
• TCIMEASTDFLPGLNFSNCSR (21aa)
  •    Q13444    Asn-389     Disintegrin and metalloproteinase domain-containing protein 15 / Homo sapiens
• QSTINTVDIYPMMCHILGLKPHPNNGTLSHTK (32aa)
  •    Q8BTJ4    Asn-389     Bis(5'-adenosyl)-triphosphatase enpp4 / Mus musculus
• CFNAMEVDALNSSHPVSTPVENPAQIR (27aa)
  •    Q9EQH2    Asn-403     Endoplasmic reticulum aminopeptidase 1 / Mus musculus
• AVYQCNTSNEHGYLLANAFVSVLDVPPR (28aa)
  •    A0A087WPX3    Asn-409     Neurofascin / Mus musculus
• IYNWSGYPIIVQK (13aa)
  •    Q6P4A8    Asn-411     Phospholipase B-like 1 / Homo sapiens
• TCNPETFPSSNESR (14aa)
  •    Q8IWA5    Asn-417     Choline transporter-like protein 2 / Homo sapiens
• RPNQSQPIPPSSIQR (15aa)
  •    Q92542    Asn-417     Nicastrin / Homo sapiens
• DSTPLGDGPMLSLSSITFDSNGTYVCEASLPTVPVLSR (38aa)
  •    P50895    Asn-419     Basal cell adhesion molecule / Homo sapiens
• AHLWTWTNSWEEFTQGTDFCPGQNVSGVTTHTQEEHTELPLIFHLGR (47aa)
  •    Q571E4    Asn-421     N-acetylgalactosamine-6-sulfatase / Mus musculus
• KIDGDTIIFSNVQESSSAVYQCNASNK (27aa)
  •    Q810U4    Asn-427     Neuronal cell adhesion molecule / Mus musculus
• MLNLTNLIPADPPGLR (16aa)
  •    Q9Y5L3    Asn-443     Ectonucleoside triphosphate diphosphohydrolase 2 / Homo sapiens
• KLVLYLEHNLEKNSTKEEILAALEK (25aa)
  •    Q61207    Asn-459     Prosaposin / Mus musculus
• NNEGGVIAQLPSDVTSFNQTGLKPGEEYIVNVVALK (36aa)
  •    Q8BYI9    Asn-470     Tenascin-r / Mus musculus
• QCLSCDLVENCTYVSASFSHNMDFFLLK (28aa)
  •    Q9Z218    Asn-474     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• ATVVWEVADETHPLEGDRYHTHENGTLEIYR (31aa)
  •    P70232    Asn-476     Neural cell adhesion molecule L1-like protein / Mus musculus
• VDCTPLMYSLVYNLTK (16aa)
  •    O35409    Asn-478     Glutamate carboxypeptidase 2 / Mus musculus
• IIISPEENVTITCTAENQIER (21aa)
  •    Q13740    Asn-480     CD166 antigen / Homo sapiens
• NGQGSNLDGGNYHVYENGSLEIK (23aa)
  •    A0A087WPX3    Asn-483     Neurofascin / Mus musculus
• WNNTGCQALPSQDEGPSK (18aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• GSALHEDIYVLHDNGTLEIPVAQK (24aa)
  •    Q810U4    Asn-501     Neuronal cell adhesion molecule / Mus musculus
• NVTIMANLK (9aa)
  •    P32004    Asn-505     Neural cell adhesion molecule L1 / Homo sapiens
• AIYEIAGGTNFSDTVQADPQTVTR (24aa)
  •    Q92542    Asn-506     Nicastrin / Homo sapiens
• KGGENSTDTASGDPLLIHHYFHGYLAGFSVR (31aa)
  •    Q99JH7    Asn-507     Calsyntenin-3 / Mus musculus
• INHCKFDEFFSQGCAPGYEKNSTLCDLCIGPLK (33aa)
  •    Q921I1    Asn-513     Serotransferrin / Mus musculus
• TKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLR (38aa)
  •    Q9R1E6    Asn-524     Ectonucleotide pyrophosphatase/phosphodiesterase family member 2 / Mus musculus
• KDSLNSSHPISSSVQSSEQIEEMFDSLSYFK (31aa)
  •    Q8C129    Asn-525     Leucyl-cystinyl aminopeptidase / Mus musculus
• FIFSLPPEIMHNPNFTVR (18aa)
  •    P55288    Asn-540     Cadherin-11 / Mus musculus
• TILVDNNTWNNTH (13aa)
  •    P46977    Asn-544     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A / Homo sapiens
• AAIPSAIDTNSSK (13aa)
  •    Q08380    Asn-551     Galectin-3-binding protein / Homo sapiens
• GVSYCTGNSSECPPPGNAEDDTVCLDLGK (29aa)
  •    P78536    Asn-551     Disintegrin and metalloproteinase domain-containing protein 17 / Homo sapiens
• NLSKPHWPGAPEDQDDKDGGSFSGTGGLPDYSAPNPIK (38aa)
  •    Q8CFG0    Asn-566     Extracellular sulfatase Sulf-2 / Mus musculus
• TNITIVCKPGDIESAPVIR (19aa)
  •    P11717    Asn-581     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• ENGTDTVQEEEESPAEGSK (19aa)
  •    Q9Y4L1    Asn-596     Hypoxia up-regulated protein 1 / Homo sapiens
• ENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPVEDGSQPPPPEPK (48aa)
  •    Q9Y4L1    Asn-596     Hypoxia up-regulated protein 1 / Homo sapiens
• SLDAYPVLNQAQAMENHTEVHFQK (24aa)
  •    Q62470-2    Asn-606     Isoform 2 of Integrin alpha-3 / Mus musculus
• EASIVGENETYPR (13aa)
  •    Q9UBV2    Asn-608     Protein sel-1 homolog 1 / Homo sapiens
• DIYEYSWVQGPIHSNETDR (19aa)
  •    Q92542    Asn-612     Nicastrin / Homo sapiens
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• TTIVDNNTWNNSHIAIVGK (19aa)
  •    Q8TCJ2    Asn-623     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
• AMSSNETAAYK (11aa)
  •    Q8TCJ2    Asn-641     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B / Homo sapiens
• SIVVEWTNNTLPLEPCPK (18aa)
  •    Q14118    Asn-661     Dystroglycan / Homo sapiens
• VYNSTITWQQYGAICGPR (18aa)
  •    O76024    Asn-661     Wolframin / Homo sapiens
• KDTCTQECSYFNITK (15aa)
  •    P05556    Asn-669     Integrin beta-1 / Homo sapiens
• YNCSIR (6aa)
  •    Q02809    Asn-686     Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1 / Homo sapiens
• YFHFFNISLCGHEGRK (16aa)
  •    Q3UZV7    Asn-715     Endosome/lysosome-associated apoptosis and autophagy regulator family member 2 / Mus musculus
• IPTNFTISVTTEILPVSMTK (20aa)
  •    P0DTC2    Asn-717     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• QECLELNHSELHQR (14aa)
  •    Q9ER65    Asn-720     Calsyntenin-2 / Mus musculus
• DSGIWINGFDYTGMSHVTPHIPEINDTIR (29aa)
  •    Q3UVK0    Asn-724     Endoplasmic reticulum metallopeptidase 1 / Mus musculus
• SIGQFISTENATIK (14aa)
  •    O95490    Asn-731     Adhesion G protein-coupled receptor L2 / Homo sapiens
• VNNCSDMCFHQK (12aa)
  •    Q92626    Asn-731     Peroxidasin homolog / Homo sapiens
• GKANYSLQIYPDESHYFHSVALK (23aa)
  •    Q9Z218    Asn-752     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• ANYSLQIYPDESHYFHSVALKQHLSR (26aa)
  •    Q9Z218    Asn-752     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• NMTLFSDLVAEK (12aa)
  •    P12110    Asn-785     Collagen alpha-2(VI) chain / Homo sapiens
• APGTTIHDPTYQNHSTETPSQTAAAPHSVNVPR (33aa)
  •    Q924X6    Asn-805     Low-density lipoprotein receptor-related protein 8 / Mus musculus
• SHIVVPANTTSAILSGLRPYSSYHVEVQAFNGR (33aa)
  •    P11627    Asn-875     Neural cell adhesion molecule L1 / Mus musculus
• ENDNFNISKDDIDITLFHGENK (22aa)
  •    Q9QZC2    Asn-877     Plexin-C1 / Mus musculus
• ENGSFSGK (8aa)
  •    Q7Z7G0    Asn-878     Target of Nesh-SH3 / Homo sapiens
• FINYNQTVSR (10aa)
  •    Q8N766    Asn-913     ER membrane protein complex subunit 1 / Homo sapiens
• AEPPINASASDQGEK (15aa)
  •    Q9Y4L1    Asn-931     Hypoxia up-regulated protein 1 / Homo sapiens
• RSPSYIICNTTSSEEVLDMK (20aa)
  •    Q80UG2    Asn-1006     Plexin-A4 / Mus musculus
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• CDSGFALDSEERNCTDIDECR (21aa)
  •    P35555    Asn-1067     Fibrillin-1 / Homo sapiens
• EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPL (50aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPE (53aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWF (12aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• GVFVSNGTHWFVTQR (15aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• YQLGTSPYVYQLTTRPVTDGQPHSVNITR (29aa)
  •    O54991    Asn-1148     Contactin-associated protein 1 / Mus musculus
• LNYTVLVGEKPCTVTVSDVQLLCESPNLIGR (31aa)
  •    Q80UG2    Asn-1179     Plexin-A4 / Mus musculus
• LSDTTSQSNSTAK (13aa)
  •    P07942    Asn-1279     Laminin subunit beta-1 / Homo sapiens
• MNFTGGDTCHK (11aa)
  •    P11717    Asn-1312     Cation-independent mannose-6-phosphate receptor / Homo sapiens
• SLSPHAGTEPCPPEAAVCLLNGSKPVNLGK (30aa)
  •    Q07113    Asn-1423     Cation-independent mannose-6-phosphate receptor / Mus musculus
• DCADGSDEEACPSLANSTAASTPTQFGQCDRFEFECHQPK (40aa)
  •    O88307    Asn-1458     Sortilin-related receptor / Mus musculus
• AFINGTGVETVVSADLPNAHGLAVDWVSR (29aa)
  •    Q91ZX7    Asn-1646     Prolow-density lipoprotein receptor-related protein 1 / Mus musculus
• SNENGWTTVYEYDPEGHLTNATFPTGEVSSFHSDLEK (37aa)
  •    Q9WTS4    Asn-1669     Teneurin-1 / Mus musculus
• NIYNPPESNASVIFDYSDDGR (21aa)
  •    Q9WTS5    Asn-1983     Teneurin-2 / Mus musculus
• VETGENCTSPAPKEELLPAEETEQDKEHTCETLLMCIVTVLSHGLR (46aa)
  •    P11881-3    Asn-2502     Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1 / Mus musculus
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• LLLGGLPVSGTFHNFSGCISNVFVQR (26aa)
  •    Q61001    Asn-3261     Laminin subunit alpha-5 / Mus musculus
• VFDLQQNLGSVNVSTGCAPALQAQTPGLGPR (31aa)
  •    O15230    Asn-3287     Laminin subunit alpha-5 / Homo sapiens
• GGSICRDDEFLCNNSLCK (18aa)
  •    Q9JI18    Asn-3682     Low-density lipoprotein receptor-related protein 1B / Mus musculus