taxonomy (6)
protein (101)
source (28)
structure (26)
composition (1)
disease (15)
reference (44)
site (134)
peptide (105)
- Homo sapiens (Human)
- Mus musculus (House mouse)
- Gallus gallus (Chicken)
- Torpedo californica (Pacific electric ray)
- Drosophila melanogaster (Fruit fly)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- ADAM DEC1 / Homo sapiens O15204
- Alpha-1-antitrypsin / Homo sapiens P01009
- Alpha-2-HS-glycoprotein / Homo sapiens P02765
- Alpha-2-macroglobulin / Homo sapiens P01023
- Alpha-fetoprotein / Homo sapiens P02771
- Alpha-mannosidase 2 / Homo sapiens Q16706
- Alpha-S1-casein / Homo sapiens P47710
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Apolipoprotein B-100 / Homo sapiens P04114
- Apolipoprotein D / Homo sapiens P05090
- Apolipoprotein M / Homo sapiens O95445
- Asporin / Homo sapiens Q9BXN1
- Beta-2-glycoprotein 1 / Homo sapiens P02749
- Biglycan / Homo sapiens P21810
- Cadherin-2 / Homo sapiens P19022
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Ceruloplasmin / Homo sapiens P00450
- Coagulation factor V / Homo sapiens P12259
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Complement factor h / Homo sapiens P08603
- Corticosteroid-binding globulin / Homo sapiens P08185
- Decorin / Homo sapiens P07585
- Desmoglein-2 / Homo sapiens Q14126
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Epididymis-specific alpha-mannosidase / Homo sapiens Q9Y2E5
- Fibrillin-1 / Homo sapiens P35555
- Fibrinogen beta chain / Homo sapiens P02675
- Fibrinogen gamma chain / Homo sapiens P02679
- Fibronectin / Homo sapiens P02751
- Glycodelin-a / Homo sapiens P09466
- Glycophorin-A / Homo sapiens P02724
- Haptoglobin / Homo sapiens P00738
- Hemopexin / Homo sapiens P02790
- Hepatitis a virus cellular receptor 2 / Homo sapiens Q8TDQ0
- Hepatocyte growth factor receptor / Homo sapiens P08581
- High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens P12314-2
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01860 P01857
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens P01880
- Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens P01880
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Integrin alpha-5 / Homo sapiens P08648
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens P12318-1
- Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens P31994-3
- Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens P08637
- Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens O75015
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens P13473
- Matrix metalloproteinase-9 / Homo sapiens P14780
- Myelin protein P0 / Homo sapiens P25189
- Periostin / Homo sapiens Q15063
- Plexin-B2 / Homo sapiens O15031
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolactin-inducible protein / Homo sapiens P12273
- Prominin-1 / Homo sapiens O43490
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Prothrombin / Homo sapiens P00734
- Reelin / Homo sapiens P78509
- Reticulocalbin-3 / Homo sapiens Q96D15
- RNA polymerase II elongation factor ELL2 / Homo sapiens O00472
- Serotransferrin / Homo sapiens P02787
- Serum paraoxonase/arylesterase 1 / Homo sapiens P27169
- Tenascin / Homo sapiens P24821
- Tenascin-N / Homo sapiens Q9UQP3
- Thrombospondin-1 / Homo sapiens P07996
- Transmembrane glycoprotein NMB / Homo sapiens Q14956
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein KIAA0232 / Homo sapiens Q92628
- Unspecified mucin / Homo sapiens
- Von willebrand factor / Homo sapiens P04275
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- CD166 antigen / Mus musculus Q61490
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Glutamate receptor 3 / Mus musculus Q9Z2W9
- Laminin subunit alpha-2 / Mus musculus Q60675
- Laminin subunit gamma-1 / Mus musculus P02468
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Riboflavin-binding protein / Gallus gallus P02752
- Acetylcholine receptor protein / Torpedo californica P02714 P02718 P02712 P02710
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Amniotic Fluid (UBERON_0000173)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Cerebrospinal Fluid (UBERON_0001359)
- Colon (UBERON_0001155)
- Electric Organ (UBERON_0006869)
- Embryo (UBERON_0000922)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Liver (UBERON_0002107)
- Mammary Gland (UBERON_0001911)
- Milk (UBERON_0001913)
- Seminal Fluid (UBERON_0006530)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- C10 (CVCL_5245)
- FreeStyle 293-F (CVCL_D603)
- HCT 116 (CVCL_0291)
- HEK293 (CVCL_0045)
- LS411N (CVCL_1385)
- Egg Cell Yolk (GO_0060417)
- Erythrocyte (CL_0000232) Plasma Membrane (GO_0005886)
- Neutrophil (CL_0000775)
- Low-Density Lipoprotein Particle (GO_0034362)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / Structure 231
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9431
- N-Linked / Complex / Structure 9845
- N-Linked / Complex / Structure 10696
- N-Linked / Complex / Structure 10729
- N-Linked / Complex / Structure 10915
- N-Linked / Complex / Structure 10975
- N-Linked / Complex / Structure 11120
- N-Linked / Complex / Structure 11155
- N-Linked / Complex / Structure 11401
- N-Linked / Complex / Structure 11606
- N-Linked / Hybrid / Structure 9621
- N-Linked / Hybrid / Structure 9670
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Gal(b1-?)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9467
- O-Linked / Core 2 / Structure 10620
- O-Linked / Core 2 / Structure 11102
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc
Reported structure
- Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )
Composition
- Cancer, breast (DOID:1612)
- Cecum adenocarcinoma (DOID:3039)
- Colon adenocarcinoma (DOID:234)
- Colon carcinoma (DOID:1520)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Esophageal cancer (DOID:5041)
- Gastritis (DOID:4029)
- Hypercholesterolemia, Familial (DOID:13810)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Prostate cancer (DOID:10283)
- Prostate Disease (DOID:47)
- Schizophrenia (DOID:5419)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
- Colorectal cancer cell lines show striking diversity of their O-glycome reflecting the cellular differentiation phenotype (2021 - Katarina Madunić, Tao Zhang, Oleg A Mayboroda, Stephanie Holst, Kathrin Stavenhagen, Chunsheng Jin, Niclas G Karlsson, Guinevere S M Lageveen-Kammeijer, Manfred Wuhrer) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions. (2014 - Hayes JM, Frostell A, Cosgrave EF, Struwe WB, Potter O, Davey GP, Karlsson R, Anneren C, Rudd PM) / Status : Unreviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Identification of N-glycosylation changes in the CSF and serum in patients with schizophrenia (2010 - Stanta JL, Saldova R, Struwe WB, Byrne JC, Leweke FM, Rothermund M, Rahmoune H, Levin Y, Guest PC, Bahn S, Rudd PM) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
- O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
- Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
- Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
- A carbohydrate structural variant of MM glycoprotein (glycophorin A). (1983 - Adamany A, Blumenfeld O, Sabo B, McCreary J) / Status : Reviewed
Reference
- ADAM DEC1 / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-fetoprotein / Homo sapiens
- Alpha-mannosidase 2 / Homo sapiens
- Alpha-S1-casein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein M / Homo sapiens
- Asporin / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Cadherin-2 / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Ceruloplasmin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Complement factor h / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibrinogen gamma chain / Homo sapiens
- Fibronectin / Homo sapiens
- Glycodelin-a / Homo sapiens
-
Glycophorin-A / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Hepatitis a virus cellular receptor 2 / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
-
High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
- Asn-144
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Integrin alpha-5 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
- Myelin protein P0 / Homo sapiens
- Periostin / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prominin-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Prothrombin / Homo sapiens
- Reelin / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- RNA polymerase II elongation factor ELL2 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-N / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
- Uncharacterized protein KIAA0232 / Homo sapiens
-
Unspecified mucin / Homo sapiens
- Undefined site
- Von willebrand factor / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- CD166 antigen / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Glutamate receptor 3 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- YVNMSNHHR (9aa)
- RQSGVNATLPEENQPVVFNHVYNIKL (26aa)
- HENNTKDNSIQHEFSLTR (18aa)
- WQMNFTVR (8aa)
- WFSAGLASNSSWLR (14aa)
- YETTNK (6aa)
- FSNVTWF (7aa)
- CIQANYSIMENGK (13aa)
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- NK (2aa)
- RENISDPTSPLRT (13aa)
- FHAIHVSGTNGTKRF (15aa)
- DSVINLSESVEDGPK (15aa)
- DLQSLEDILHQVENK (15aa)
- DLQSLEDILHQVENKT (16aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- TFYWDFYTNR (10aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- DTGEINVTSIIDR (13aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- TELFSSSCPGGIMLNETGQGYQR (23aa)
- EHEGAIYPDNTTDFQR (16aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYK (23aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- DFTAAFPR (8aa)
- VCQDCPLLAPLNDTR (15aa)
- VYKPSAGNNSLYR (13aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- TKPREEQYNSTYR (13aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- EHAVFTSNQEEQDPANHTCGVK (22aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- SWPAVGNCSSALR (13aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- KNLFLNHSENATAKD (15aa)
- VVLHPNYSQVDIGLIK (16aa)
- KDNTTVTR (8aa)
- HANWTLTPLK (10aa)
- VMHGGANITGFQIVNNENPMVQQFIQR (27aa)
- YIGNATAIFFIPDEGK (16aa)
- YLGNATAIFFLPDEGK (16aa)
- EALENMNSTLK (11aa)
- LNSSTIK (7aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- ITDIENGSIANIPR (14aa)
- VIYQNHNK (8aa)
- IIQVVYIHSNNITK (14aa)
- ALHALNVTWR (10aa)
- VQPFNVTQGK (10aa)
- NLSLNIHGK (9aa)
- GTAGNAIMDGASQIMGENR (19aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- SINTTNVMGTSLTVR (15aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- AIPQPQNVTSIIGCTH (16aa)
- IIISPEENVTLTCTAENQLER (21aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- LNNSSPNSSGGVK (13aa)
- VFGSQNITTVK (11aa)
- SCSLEGNPVACINLSFCLNASGK (23aa)
- SCVAVTSAQPQNMSRR (16aa)
- SCVAVTSAQPQNMSR (15aa)
- RHEEGHMINCTCFGQGR (17aa)
- EVNDTLLVNELK (12aa)
- TCSPWSHSEETRSDNETLNIQFEESTQFNAEDINYVVPR (39aa)
- ANYSLQIYPDESHYFHSVALK (21aa)
- ELHHLQEQNVSNAFLDK (17aa)
- FGGFNFS (7aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGR (32aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
- IPCSQPPQIEHGTINSSR (18aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- LHNLTTGTPAR (11aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- VEAAQNLTLPGSLR (14aa)
- RFNSSYLQGTNQITGRY (17aa)
- FNSSYLQGTNQITGR (15aa)
- NYYADNQTCDGELLFNMTK (19aa)
- NLQVYNATSNSLTVK (15aa)
- MIEAYNITEK (10aa)
- MEACMLNGTVIGPGK (15aa)
- TAGFCGNPSFHLYWPNK (17aa)
- FVEGSHNSTVSLTTK (15aa)
- YDFNSSMLYSTAK (13aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- HEK293 (CVCL_0045)
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
- Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
- Alpha-2-macroglobulin / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Haptoglobin / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Electric Organ (UBERON_0006869)
-
Acetylcholine receptor protein / Torpedo californica
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Ascitic fluid (UBERON_0007795)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Liver (UBERON_0002107)
- HEK293 (CVCL_0045)
- Egg Cell Yolk (GO_0060417)
- Yolk (GO_0060417)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Multiple myeloma (DOID:9538)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Strategic glycan elution map for the production of human-type N-linked oligosaccharides: the case of hen egg yolk and white. (2009 - Sumiyoshi W, Nakakita S, Miyanishi N, Hirabayashi J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Riboflavin-binding protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
- Alpha-fetoprotein / Homo sapiens
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Amniotic Fluid (UBERON_0000173)
- Glycodelin-a / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Diabetes Mellitus, Non-insulin dependent (DOID:9352)
- Hypercholesterolemia, Familial (DOID:13810)
-
Apolipoprotein B-100 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Milk (UBERON_0001913)
- Alpha-S1-casein / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Haptoglobin / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Lactotransferrin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Tenascin / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- RQSGVNATLPEENQPVVFNHVYNIKL (26aa)
- KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
- KDTRNESTQNCVVAEPEKM (19aa)
- RENISDPTSPLRT (13aa)
- RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
- KDIVEYYNDSNGSHVLQGRF (20aa)
- RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
- KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
- KNLFLNHSENATAKD (15aa)
- KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
- RTAGWNIPMGLLFNQTGSCKF (21aa)
- KYWCKWNNTGCQALPSQDEGPSKA (24aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- RFNSSYLQGTNQITGRY (17aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Urine (UBERON_0001088)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Blood Plasma (UBERON_0001969)
- Multiple myeloma (DOID:9538)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Seminal Fluid (UBERON_0006530)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- AVCGGVLVHPQWVLTAAHCIRNK (23aa)
- NKSVLLGR (8aa)
- TKPREEQYNSTYR (13aa)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Colon (UBERON_0001155)
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Blood Plasma (UBERON_0001969)
- Coagulation factor V / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1770.6228)
- HEK293 (CVCL_0045)
-
High affinity immunoglobulin gamma Fc receptor I (FcγRIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-a (FcγRIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor II-b (FcγRIIb ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-A (FcγRIIIa ) / Homo sapiens
- Undefined site
-
Low affinity immunoglobulin gamma Fc region receptor III-B (FcγRIIIb ) / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1770.6228)
- Schizophrenia (DOID:5419)
-
- N-Linked / Hybrid
(avg mass : 1770.6228)
- Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1770.6228)
- Embryo (UBERON_0000922)
-
- O-Linked / Core 2
(avg mass : 1770.6228)
- Milk (UBERON_0001913)
-
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1770.6228)
-
Glycophorin-A / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1770.6228)
- Neutrophil (CL_0000775)
-
Matrix metalloproteinase-9 / Homo sapiens
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1770.6228)
- Urine (UBERON_0001088)
- Hepatitis a virus cellular receptor 2 / Homo sapiens
- DFTAAFPR (8aa)
-
- O-Linked / Core 2
(avg mass : 1770.6228)
- Bone Marrow (UBERON_0002371)
-
- O-Linked / Core 2
(avg mass : 1770.6228)
- C10 (CVCL_5245)
- HCT 116 (CVCL_0291)
-
- O-Linked / Undefined core
(avg mass : 1770.6228)
- Milk (UBERON_0001913)
-
Unspecified mucin / Homo sapiens
- Undefined site
-
- Hex:4 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1770.6228)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Umbilical Vein (UBERON_0002066) Endothelial Cell of Umbilical Vein (CL_0002618)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / Structure 231
- N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
- N-Linked / Complex / Structure 9431
- N-Linked / Complex / Structure 9845
- N-Linked / Complex / Structure 10696
- N-Linked / Complex / Structure 10729
- N-Linked / Complex / Structure 10915
- N-Linked / Complex / Structure 10975
- N-Linked / Complex / Structure 11120
- N-Linked / Complex / Structure 11155
- N-Linked / Complex / Structure 11401
- N-Linked / Complex / Structure 11606
- N-Linked / Hybrid / Structure 9621
- N-Linked / Hybrid / Structure 9670
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Gastritis (DOID:4029)
- Prostate cancer (DOID:10283)
- Community evaluation of glycoproteomics informatics solutions reveals high-performance search strategies for serum glycopeptide analysis (2021 - Rebeca Kawahara, Anastasia Chernykh, Kathirvel Alagesan, Marshall Bern, Weiqian Cao, Robert J. Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet, Mingqi Liu, Yehia Mechref, Bo Meng, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas E. Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Y. Vakhrushev, Christina M. Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Hui Zhang, Yong Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Göran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, Morten Thaysen-Andersen) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- ADAM DEC1 / Homo sapiens
- Alpha-1-antitrypsin / Homo sapiens
- Alpha-2-HS-glycoprotein / Homo sapiens
- Alpha-2-macroglobulin / Homo sapiens
- Alpha-mannosidase 2 / Homo sapiens
- Apolipoprotein B-100 / Homo sapiens
- Apolipoprotein D / Homo sapiens
- Apolipoprotein M / Homo sapiens
- Asporin / Homo sapiens
- Beta-2-glycoprotein 1 / Homo sapiens
- Biglycan / Homo sapiens
- Cadherin-2 / Homo sapiens
- Ceruloplasmin / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Complement factor h / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Epididymis-specific alpha-mannosidase / Homo sapiens
- Fibrillin-1 / Homo sapiens
- Fibrinogen beta chain / Homo sapiens
- Fibrinogen gamma chain / Homo sapiens
- Fibronectin / Homo sapiens
- Haptoglobin / Homo sapiens
- Hemopexin / Homo sapiens
- Hepatocyte growth factor receptor / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Integrin alpha-5 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Lysosome-associated membrane glycoprotein 2 / Homo sapiens
- Myelin protein P0 / Homo sapiens
- Periostin / Homo sapiens
- Plexin-B2 / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolactin-inducible protein / Homo sapiens
- Prominin-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prothrombin / Homo sapiens
- Reelin / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- RNA polymerase II elongation factor ELL2 / Homo sapiens
- Serotransferrin / Homo sapiens
- Serum paraoxonase/arylesterase 1 / Homo sapiens
- Tenascin / Homo sapiens
- Tenascin-N / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Transmembrane glycoprotein NMB / Homo sapiens
- Uncharacterized protein KIAA0232 / Homo sapiens
- Von willebrand factor / Homo sapiens
- CD166 antigen / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Glutamate receptor 3 / Mus musculus
- Laminin subunit alpha-2 / Mus musculus
- Laminin subunit gamma-1 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- YVNMSNHHR (9aa)
- HENNTKDNSIQHEFSLTR (18aa)
- WQMNFTVR (8aa)
- WFSAGLASNSSWLR (14aa)
- YETTNK (6aa)
- FSNVTWF (7aa)
- CIQANYSIMENGK (13aa)
- FHAIHVSGTNGTKRF (15aa)
- DSVINLSESVEDGPK (15aa)
- DLQSLEDILHQVENK (15aa)
- DLQSLEDILHQVENKT (16aa)
- ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
- TFYWDFYTNR (10aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- DTGEINVTSIIDR (13aa)
- DGSIVIHNLDYSDNGTFTCDVK (22aa)
- TELFSSSCPGGIMLNETGQGYQR (23aa)
- EHEGAIYPDNTTDFQR (16aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- NATYGHYAPGEEFHDVEDAETYK (23aa)
- YPHKPEINSTTHPGADLQENFCR (23aa)
- PALEDLLLGSEANLTCTLTGLR (22aa)
- LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
- VCQDCPLLAPLNDTR (15aa)
- VYKPSAGNNSLYR (13aa)
- AALAAFNAQNNGSNFQLEEISR (22aa)
- MVSHHNLTTGATLINEQWLLTTAK (24aa)
- EHAVFTSNQEEQDPANHTCGVK (22aa)
- QIGLYPVLVIDSSGYVNPNYTGR (23aa)
- SWPAVGNCSSALR (13aa)
- GLTFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- VVLHPNYSQVDIGLIK (16aa)
- KDNTTVTR (8aa)
- HANWTLTPLK (10aa)
- VMHGGANITGFQIVNNENPMVQQFIQR (27aa)
- YIGNATAIFFIPDEGK (16aa)
- YLGNATAIFFLPDEGK (16aa)
- EALENMNSTLK (11aa)
- LNSSTIK (7aa)
- DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
- ITDIENGSIANIPR (14aa)
- VIYQNHNK (8aa)
- IIQVVYIHSNNITK (14aa)
- ALHALNVTWR (10aa)
- VQPFNVTQGK (10aa)
- NLSLNIHGK (9aa)
- GTAGNAIMDGASQIMGENR (19aa)
- ENLTAPGSDSAVFFEQGTTR (20aa)
- SINTTNVMGTSLTVR (15aa)
- GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
- CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
- AIPQPQNVTSIIGCTH (16aa)
- IIISPEENVTLTCTAENQLER (21aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- LNNSSPNSSGGVK (13aa)
- VFGSQNITTVK (11aa)
- SCSLEGNPVACINLSFCLNASGK (23aa)
- SCVAVTSAQPQNMSRR (16aa)
- SCVAVTSAQPQNMSR (15aa)
- RHEEGHMINCTCFGQGR (17aa)
- EVNDTLLVNELK (12aa)
- TCSPWSHSEETRSDNETLNIQFEESTQFNAEDINYVVPR (39aa)
- ANYSLQIYPDESHYFHSVALK (21aa)
- ELHHLQEQNVSNAFLDK (17aa)
- FGGFNFS (7aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGR (32aa)
- SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
- IPCSQPPQIEHGTINSSR (18aa)
- VVNSTTGPGEHIR (13aa)
- VPAQEKNF (8aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- EGVFVSNGTHWFVTQR (16aa)
- VNSSLHSQISR (11aa)
- LHNLTTGTPAR (11aa)
- ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
- VEAAQNLTLPGSLR (14aa)
- FNSSYLQGTNQITGR (15aa)
- NYYADNQTCDGELLFNMTK (19aa)
- NLQVYNATSNSLTVK (15aa)
- MIEAYNITEK (10aa)
- MEACMLNGTVIGPGK (15aa)
- TAGFCGNPSFHLYWPNK (17aa)
- FVEGSHNSTVSLTTK (15aa)
- YDFNSSMLYSTAK (13aa)
-
- Hex:4 HexNAc:4 NeuAc:1 / O-Linked
(avg mass : 1770.6228)
- LS411N (CVCL_1385)
- O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Gal(b1-?)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
- O-Linked / Core 2 / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
- O-Linked / Core 2 / Structure 9467
- O-Linked / Core 2 / Structure 10620
- O-Linked / Core 2 / Structure 11102
- O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc
- Cecum adenocarcinoma (DOID:3039)
Source
Suggested structure
Disease
Reported glycosite
- Hex:4 HexNAc:4 NeuAc:1 / O-Linked
(avg mass : 1770.6228)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:4 HexNAc:4 NeuAc:1 / N-Linked
(avg mass : 1770.6228)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 1770.6228)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1770.6228)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- O-Linked / Core 2
(avg mass : 1770.6228)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1770.6228)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1770.6228)
Source
Reported glycosite
- O-Linked / Core 2
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1770.6228)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1770.6228)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1770.6228)