Hex:4 HexNAc:4 NeuAc:1

Taxonomy

• Homo sapiens (Human)
• Mus musculus (House mouse)
• Gallus gallus (Chicken)
• Torpedo californica (Pacific electric ray)
• Drosophila melanogaster (Fruit fly)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• ADAM DEC1 / Homo sapiens    O15204
• Alpha-1-antitrypsin / Homo sapiens    P01009
• Alpha-2-HS-glycoprotein / Homo sapiens    P02765
• Alpha-2-macroglobulin / Homo sapiens    P01023
• Alpha-fetoprotein / Homo sapiens    P02771
• Alpha-mannosidase 2 / Homo sapiens    Q16706
• Alpha-S1-casein / Homo sapiens    P47710
• Angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Apolipoprotein B-100 / Homo sapiens    P04114
• Apolipoprotein D / Homo sapiens    P05090
• Apolipoprotein M / Homo sapiens    O95445
• Asporin / Homo sapiens    Q9BXN1
• Beta-2-glycoprotein 1 / Homo sapiens    P02749
• Biglycan / Homo sapiens    P21810
• Cadherin-2 / Homo sapiens    P19022
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens    P06731
• Ceruloplasmin / Homo sapiens    P00450
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Complement factor h / Homo sapiens    P08603
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Epididymis-specific alpha-mannosidase / Homo sapiens    Q9Y2E5
• Fibrillin-1 / Homo sapiens    P35555
• Fibrinogen beta chain / Homo sapiens    P02675
• Fibrinogen gamma chain / Homo sapiens    P02679
• Fibronectin / Homo sapiens    P02751
• Glycodelin-a / Homo sapiens    P09466
• Glycophorin-A / Homo sapiens    P02724
• Haptoglobin / Homo sapiens    P00738
• Hemopexin / Homo sapiens    P02790
• Hepatitis a virus cellular receptor 2 / Homo sapiens    Q8TDQ0
• Hepatocyte growth factor receptor / Homo sapiens    P08581
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin alpha (non secretory) / Homo sapiens    P01876    P01877
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens    P0DOX2
• Immunoglobulin gamma / Homo sapiens    P01861    P01857    P01860    P01859
• Immunoglobulin gamma-1 heavy chain / Homo sapiens    P0DOX5
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens    P01877
• Immunoglobulin heavy constant delta / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens    P01880
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens    P01880
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Immunoglobulin J chain / Homo sapiens    P01591
• Integrin alpha-5 / Homo sapiens    P08648
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Lactotransferrin / Homo sapiens    P02788
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens    P13473
• Matrix metalloproteinase-9 / Homo sapiens    P14780
• Myelin protein P0 / Homo sapiens    P25189
• Periostin / Homo sapiens    Q15063
• Plexin-B2 / Homo sapiens    O15031
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolactin-inducible protein / Homo sapiens    P12273
• Prominin-1 / Homo sapiens    O43490
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Prothrombin / Homo sapiens    P00734
• Reelin / Homo sapiens    P78509
• Reticulocalbin-3 / Homo sapiens    Q96D15
• RNA polymerase II elongation factor ELL2 / Homo sapiens    O00472
• Serotransferrin / Homo sapiens    P02787
• Serum paraoxonase/arylesterase 1 / Homo sapiens    P27169
• Tenascin / Homo sapiens    P24821
• Tenascin-N / Homo sapiens    Q9UQP3
• Thrombospondin-1 / Homo sapiens    P07996
• Transmembrane glycoprotein NMB / Homo sapiens    Q14956
• Uncharacterized protein from Blood Serum / Homo sapiens    
• Uncharacterized protein KIAA0232 / Homo sapiens    Q92628
• Unspecified mucin / Homo sapiens    
• Von willebrand factor / Homo sapiens    P04275
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• CD166 antigen / Mus musculus    Q61490
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Glutamate receptor 3 / Mus musculus    Q9Z2W9
• Laminin subunit alpha-2 / Mus musculus    Q60675
• Laminin subunit gamma-1 / Mus musculus    P02468
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Riboflavin-binding protein / Gallus gallus    P02752
• Acetylcholine receptor protein / Torpedo californica    P02712    P02718    P02710    P02714
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Amniotic Fluid (UBERON_0000173)  
• Ascitic fluid (UBERON_0007795)  
• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Electric Organ (UBERON_0006869)  
• Embryo (UBERON_0000922)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Liver (UBERON_0002107)  
• Mammary Gland (UBERON_0001911)  
• Milk (UBERON_0001913)  
• Seminal Fluid (UBERON_0006530)  
• Umbilical Vein (UBERON_0002066)   Endothelial Cell of Umbilical Vein (CL_0002618)  
• Urine (UBERON_0001088)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Erythrocyte (CL_0000232)   Plasma Membrane (GO_0005886)  
• Neutrophil (CL_0000775)  
• Low-Density Lipoprotein Particle (GO_0034362)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / Structure 231
• N-Linked / Complex / Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc+"+ NeuAc"
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-6)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / NeuAc(a2-?)Gal(b1-?)GlcNAc(b1-?)Man(a1-?)[GlcNAc(b1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)GlcNAc
• N-Linked / Complex / Structure 9431
• N-Linked / Complex / Structure 9845
• N-Linked / Complex / Structure 10696
• N-Linked / Complex / Structure 10729
• N-Linked / Complex / Structure 10915
• N-Linked / Hybrid / Structure 9621
• N-Linked / Hybrid / Structure 9670
• O-Linked / Core 2 / Gal(b1-3)GlcNAc(b1-3)[Gal(b1-4)GlcNAc(b1-6)]Gal(b1-4)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Gal(b1-?)GlcNAc(?1-?)[Gal(b1-?)GlcNAc(?1-?)]Gal(b1-?)GlcNAc(b1-6)[NeuAc(a2-3)Gal(b1-3)]GalNAc
• O-Linked / Core 2 / NeuAc(a2-6)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-?)Gal(b1-4)GlcNAc(b1-6)[Gal(b1-3)]GalNAc
• O-Linked / Core 2 / Structure 9467
• O-Linked / Core 2 / Structure 10620
• O-Linked / Undefined core / Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)Gal(?1-?)GlcNAc(?1-?)[NeuAc(?2-?)Gal(?1-?)]GalNAc

Composition

• Hex:4 HexNAc:4 NeuAc:1 (avg mass : 1770.6228 )

Disease

• Cancer, breast (DOID:1612)
• Colon adenocarcinoma (DOID:234)
• Control/Healthy
• COVID-19 (DOID:0080600)
• Diabetes Mellitus, Non-insulin dependent (DOID:9352)
• Esophageal cancer (DOID:5041)
• Gastritis (DOID:4029)
• Hypercholesterolemia, Familial (DOID:13810)
• Mixed phenotype acute leukemia (DOID:9953)
• Myeloma, Multiple (DOID:9538)
• Prostate cancer (DOID:10283)
• Prostate Disease (DOID:47)

Reference

• High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
• B-cell precursor acute lymphoblastic leukemia with MLL rearrangement shows extensive glycomic-related changes (2021 - Oliveira T) / Status : Reviewed
• Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
• Profiling the proteoforms of urinary prostate-specific antigen by capillary electrophoresis – mass spectrometry (2021 - Alan B. Moran, Elena Domínguez-Vega, Jan Nouta, Tamas Pongracz, Theo M. de Reijke, Manfred Wuhrer, Guinevere S.M. Lageveen-Kammeijer) / Status : Reviewed
• Community Evaluation of Glycoproteomics Informatics Solutions Reveals High-Performance Search Strategies for Glycopeptide Analysis (2021 - Rebeca Kawahara, Kathirvel Alagesan, Marshall Bern, Meng Bo, Weiqian Cao, Robert J Chalkley, Kai Cheng, Matthew S. Choo, Nathan Edwards, Radoslav Goldman, Marcus Hoffmann, Yingwei Hu, Yifan Huang, Jin Young Kim, Doron Kletter, Benoit Liquet-Weiland, Mingqi Liu, Yehia Mechref, Sriram Neelamegham, Terry Nguyen-Khuong, Jonas Nilsson, Adam Pap, Gun Wook Park, Benjamin L. Parker, Cassandra L. Pegg, Josef M. Penninger, Toan K. Phung, Markus Pioch, Erdmann Rapp, Enes Sakalli, Miloslav Sanda, Benjamin L. Schulz, Nichollas Scott, Georgy Sofronov, Johannes Stadlmann, Sergey Vakhrushev, Christina Woo, Hung-Yi Wu, Pengyuan Yang, Wantao Ying, Zhang Yong, Hui Zhang, Jingfu Zhao, Joseph Zaia, Stuart M. Haslam, Giuseppe Palmisano, Jong Shin Yoo, Goran Larson, Kai-Hooi Khoo, Katalin F. Medzihradszky, Daniel Kolarich, Nicolle H. Packer, and Morten Thaysen-Andersen) / Status : Reviewed
• Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Novel O-linked sialoglycan structures in human urinary glycoproteins (2020 - Adam Pap, Ervin Tasnadi, Katalin F. Medzihradszky, Zsuzsanna Darula ) / Status : Reviewed
• Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Large-scale intact glycopeptide identification by Mascot database search (2018 - Ravi Chand Bollineni, Christian Jeffrey Koehler, Randi Elin Gislefoss, Jan Haug Anonsen, Bernd Thiede) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
• The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
• Computational framework for identification of intact glycopeptides in complex samples (2014 - Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H.) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Glycoproteomic analysis of the secretome of human endothelial cells (2013 - Yin X, Bern M, Xing Q, Ho J, Viner R, Mayr M.) / Status : Reviewed
• Exploring site-specific N-glycosylation microheterogeneity of haptoglobin using glycopeptide CID tandem mass spectra and glycan database search (2013 - Chandler KB1, Pompach P, Goldman R, Edwards N.) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
• Characterization of human apolipoprotein B100 oligosaccharides in LDL subfractions derived from normal and hyperlipidemic plasma: deficiency of alpha-N-acetylneuraminyllactosyl-ceramide in light and small dense LDL particles. (2001 - Garner B, Harvey DJ, Royle L, Frischmann M, Nigon F, Chapman MJ, Rudd PM) / Status : Reviewed
• O-glycan analysis of natural human neutrophil gelatinase B using a combination of normal phase-HPLC and online tandem mass spectrometry: implications for the domain organization of the enzyme. (2000 - Mattu T, Royle L, Langridge J, Wormald M, Van den Steen P, Van Damme J, Opdenakker G, Harvey D, Dwek R, Rudd P) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities. (1995 - Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G) / Status : Reviewed
• Structures of sugar chains of hen egg yolk riboflavin-binding protein. (1993 - Tarutani M, Norioka N, Mega T, Hase S, Ikenaka T) / Status : Reviewed
• Characterization of E-PHA-reactive alpha-fetoprotein isoforms by two-dimensional lectin affinity electrophoresis. (1993 - Taketa K, Fujii Y, Taga H) / Status : Reviewed
• Detailed structural analysis of asparagine-linked oligosaccharides of the nicotinic acetylcholine receptor from Torpedo californica. (1992 - Shoji H, Takahashi N, Nomoto H, Ishikawa M, Shimada I, Arata Y, Hayashi K) / Status : Reviewed
• Structures of acidic O-linked polylactosaminoglycans on human skim milk mucins. (1990 - Hanisch F, Peter-Katalinic J, Egge H, Dabrowski U, Uhlenbruck G) / Status : Reviewed
• Primary structure of twenty three neutral and monosialylated oligosaccharides O-glycosidically linked to the human secretory immunoglobulin A hinge region determined by a combination of permethylation analysis and 400-MHz 1H-NMR spectroscopy. (1989 - Pierce-Cretel A, Decottignies J, Wieruszeski J, Strecker G, Montreuil J, Spik G) / Status : Reviewed
• A carbohydrate structural variant of MM glycoprotein (glycophorin A). (1983 - Adamany A, Blumenfeld O, Sabo B, McCreary J) / Status : Reviewed

Reported glycosite

• ADAM DEC1 / Homo sapiens
  •        Asn-184
• Alpha-1-antitrypsin / Homo sapiens
  •        Asn-271
• Alpha-2-HS-glycoprotein / Homo sapiens
  •        Asn-156
  •        Asn-176
• Alpha-2-macroglobulin / Homo sapiens
  •        Asn-410
  •        Asn-869
• Alpha-fetoprotein / Homo sapiens
  •        Asn-251
• Alpha-mannosidase 2 / Homo sapiens
  •        Asn-78
• Alpha-S1-casein / Homo sapiens
  •        Asn-69
• Angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
• Apolipoprotein B-100 / Homo sapiens
  •        Undefined site
  •        Asn-1523
  •        Asn-3411
  •        Asn-3465
• Apolipoprotein D / Homo sapiens
  •        Asn-65
  •        Asn-98
• Apolipoprotein M / Homo sapiens
  •        Asn-135
• Asporin / Homo sapiens
  •        Asn-282
• Beta-2-glycoprotein 1 / Homo sapiens
  •        Asn-162
• Biglycan / Homo sapiens
  •        Asn-311
• Cadherin-2 / Homo sapiens
  •        Asn-273
• Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
  •        Undefined site
• Ceruloplasmin / Homo sapiens
  •        Asn-138
  •        Asn-397
  •        Asn-762
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
  •        Asn-2528
• Complement factor h / Homo sapiens
  •        Asn-882
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-31
• Decorin / Homo sapiens
  •        Asn-211
• Desmoglein-2 / Homo sapiens
  •        Asn-112
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Epididymis-specific alpha-mannosidase / Homo sapiens
  •        Asn-336
• Fibrillin-1 / Homo sapiens
  •        Asn-1713
• Fibrinogen beta chain / Homo sapiens
  •        Asn-394
• Fibrinogen gamma chain / Homo sapiens
  •        Asn-78
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-542
  •        Asn-1236
• Glycodelin-a / Homo sapiens
  •        Asn-46
• Glycophorin-A / Homo sapiens
  •        Undefined site
• Haptoglobin / Homo sapiens
  •        Asn-184
  •        Asn-211
  •        Asn-241
• Hemopexin / Homo sapiens
  •        Asn-187
  •        Asn-453
• Hepatitis a virus cellular receptor 2 / Homo sapiens
  •        Thr-145
• Hepatocyte growth factor receptor / Homo sapiens
  •        Asn-405
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-515
• Immunoglobulin alpha (non secretory) / Homo sapiens
  •        Undefined site
• Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin gamma-1 heavy chain / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Undefined site
  •        Asn-144
• Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Undefined site
  •        Asn-47
  •        Asn-131
• Immunoglobulin heavy constant alpha 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant delta - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Undefined site
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Undefined site
  •        Asn-176
• Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Asn-227
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Undefined site
  •        Asn-46
  •        Asn-209
  •        Asn-440
• Immunoglobulin J chain / Homo sapiens
  •        Asn-71
• Integrin alpha-5 / Homo sapiens
  •        Asn-518
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Lactotransferrin / Homo sapiens
  •        Asn-497
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
• Lysosome-associated membrane glycoprotein 2 / Homo sapiens
  •        Asn-49
  •        Asn-58
  •        Asn-275
  •        Asn-356
• Matrix metalloproteinase-9 / Homo sapiens
  •        Undefined site
• Myelin protein P0 / Homo sapiens
  •        Asn-122
• Periostin / Homo sapiens
  •        Asn-599
• Plexin-B2 / Homo sapiens
  •        Asn-528
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-83
  •        Asn-186
  •        Asn-499
• Prolactin-inducible protein / Homo sapiens
  •        Asn-105
• Prominin-1 / Homo sapiens
  •        Asn-274
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Prothrombin / Homo sapiens
  •        Asn-143
• Reelin / Homo sapiens
  •        Asn-3088
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• RNA polymerase II elongation factor ELL2 / Homo sapiens
  •        Asn-500
• Serotransferrin / Homo sapiens
  •        Asn-432
• Serum paraoxonase/arylesterase 1 / Homo sapiens
  •        Asn-253
• Tenascin / Homo sapiens
  •        Asn-38
  •        Asn-1392
• Tenascin-N / Homo sapiens
  •        Asn-1149
• Thrombospondin-1 / Homo sapiens
  •        Asn-1067
• Transmembrane glycoprotein NMB / Homo sapiens
  •        Asn-275
• Uncharacterized protein from Blood Serum / Homo sapiens
  •        Undefined site
• Uncharacterized protein KIAA0232 / Homo sapiens
  •        Asn-724
• Unspecified mucin / Homo sapiens
  •        Undefined site
• Von willebrand factor / Homo sapiens
  •        Asn-2585
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-112
• CD166 antigen / Mus musculus
  •        Asn-480
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-752
• Glutamate receptor 3 / Mus musculus
  •        Asn-260
• Laminin subunit alpha-2 / Mus musculus
  •        Asn-359
• Laminin subunit gamma-1 / Mus musculus
  •        Asn-1105
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-293
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-42
• Riboflavin-binding protein / Gallus gallus
  •        Undefined site
• Acetylcholine receptor protein / Torpedo californica
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-61
  •        Asn-74
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-1098

Mass spectrometry observed peptide

• YVNMSNHHR (9aa)
  •    P08185    Asn-31     Corticosteroid-binding globulin / Homo sapiens
• RQSGVNATLPEENQPVVFNHVYNIKL (26aa)
  •    P24821    Asn-38     Tenascin / Homo sapiens
• HENNTKDNSIQHEFSLTR (18aa)
  •    P01831    Asn-42     Thy-1 membrane glycoprotein / Mus musculus
• WQMNFTVR (8aa)
  •    P13473    Asn-49     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51     Prostaglandin-h2 d-isomerase / Homo sapiens
• YETTNK (6aa)
  •    P13473    Asn-58     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• CIQANYSIMENGK (13aa)
  •    P05090    Asn-65     Apolipoprotein D / Homo sapiens
• KQTDEIKDTRNESTQNCVVAEPEKM (25aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• KDTRNESTQNCVVAEPEKM (19aa)
  •    P47710    Asn-69     Alpha-S1-casein / Homo sapiens
• NK (2aa)
  •    P07288    Asn-69     Prostate-specific antigen (psa-1) / Homo sapiens
• RENISDPTSPLRT (13aa)
  •    P01591    Asn-71     Immunoglobulin J chain / Homo sapiens
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• DSVINLSESVEDGPK (15aa)
  •    Q16706    Asn-78     Alpha-mannosidase 2 / Homo sapiens
• DLQSLEDILHQVENK (15aa)
  •    P02679    Asn-78     Fibrinogen gamma chain / Homo sapiens
• DLQSLEDILHQVENKT (16aa)
  •    P02679    Asn-78     Fibrinogen gamma chain / Homo sapiens
• RANLTNFPENGTFVVNIAQLSQDDSGRY (28aa)
  •    P01833    Asn-83     Polymeric immunoglobulin receptor / Homo sapiens
• ADGTVNQIEGEATPVNITEPAKIEVK (26aa)
  •    P05090    Asn-98     Apolipoprotein D / Homo sapiens
• TFYWDFYTNR (10aa)
  •    P12273    Asn-105     Prolactin-inducible protein / Homo sapiens
• SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
  •    P04844    Asn-106     Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
• DTGEINVTSIIDR (13aa)
  •    Q14126    Asn-112     Desmoglein-2 / Homo sapiens
• KDIVEYYNDSNGSHVLQGRF (20aa)
  •    P25311    Asn-112     Zinc-alpha-2-glycoprotein / Homo sapiens
• DGSIVIHNLDYSDNGTFTCDVK (22aa)
  •    P25189    Asn-122     Myelin protein P0 / Homo sapiens
• TELFSSSCPGGIMLNETGQGYQR (23aa)
  •    O95445    Asn-135     Apolipoprotein M / Homo sapiens
• EHEGAIYPDNTTDFQR (16aa)
  •    P00450    Asn-138     Ceruloplasmin / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• NATYGHYAPGEEFHDVEDAETYK (23aa)
  •    Q96D15    Asn-140     Reticulocalbin-3 / Homo sapiens
• YPHKPEINSTTHPGADLQENFCR (23aa)
  •    P00734    Asn-143     Prothrombin / Homo sapiens
• PALEDLLLGSEANLTCTLTGLR (22aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• RLSLHRPALEDLLLGSEANLTCTLTGLRD (29aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
• LSLHRPALEDLLLGSEANLTCTLTGLR (27aa)
  •    P01876    Asn-144     Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •    P01877    Asn-131     Immunoglobulin heavy constant alpha 2 / Homo sapiens
• DFTAAFPR (8aa)
  •    Q8TDQ0    Thr-145     Hepatitis a virus cellular receptor 2 / Homo sapiens
• VCQDCPLLAPLNDTR (15aa)
  •    P02765    Asn-156     Alpha-2-HS-glycoprotein / Homo sapiens
• VYKPSAGNNSLYR (13aa)
  •    P02749    Asn-162     Beta-2-glycoprotein 1 / Homo sapiens
• AALAAFNAQNNGSNFQLEEISR (22aa)
  •    P02765    Asn-176     Alpha-2-HS-glycoprotein / Homo sapiens
• MVSHHNLTTGATLINEQWLLTTAK (24aa)
  •    P00738    Asn-184     Haptoglobin / Homo sapiens
• EHAVFTSNQEEQDPANHTCGVK (22aa)
  •    O15204    Asn-184     ADAM DEC1 / Homo sapiens
• KQIGLYPVLVIDSSGYVNPNYTGRI (25aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• QIGLYPVLVIDSSGYVNPNYTGR (23aa)
  •    P01833    Asn-186     Polymeric immunoglobulin receptor / Homo sapiens
• SWPAVGNCSSALR (13aa)
  •    P02790    Asn-187     Hemopexin / Homo sapiens
• GLTFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209     Immunoglobulin heavy constant mu / Homo sapiens
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211     Decorin / Homo sapiens
• KNLFLNHSENATAKD (15aa)
  •    P00738    Asn-211     Haptoglobin / Homo sapiens
• VVLHPNYSQVDIGLIK (16aa)
  •    P00738    Asn-241     Haptoglobin / Homo sapiens
• KDNTTVTR (8aa)
  •    P11279    Asn-249     Lysosome-associated membrane glycoprotein 1 / Homo sapiens
• HANWTLTPLK (10aa)
  •    P27169    Asn-253     Serum paraoxonase/arylesterase 1 / Homo sapiens
• VMHGGANITGFQIVNNENPMVQQFIQR (27aa)
  •    Q9Z2W9    Asn-260     Glutamate receptor 3 / Mus musculus
• YIGNATAIFFIPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• YLGNATAIFFLPDEGK (16aa)
  •    P01009    Asn-271     Alpha-1-antitrypsin / Homo sapiens
• EALENMNSTLK (11aa)
  •    O43490    Asn-274     Prominin-1 / Homo sapiens
• LNSSTIK (7aa)
  •    P13473    Asn-275     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• DLPIMFDVLIHDPSHFLNYSTINYK (25aa)
  •    Q14956    Asn-275     Transmembrane glycoprotein NMB / Homo sapiens
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282     Asporin / Homo sapiens
• VIYQNHNK (8aa)
  •    P11627    Asn-293     Neural cell adhesion molecule L1 / Mus musculus
• IIQVVYIHSNNITK (14aa)
  •    P21810    Asn-311     Biglycan / Homo sapiens
• ALHALNVTWR (10aa)
  •    Q9Y2E5    Asn-336     Epididymis-specific alpha-mannosidase / Homo sapiens
• VQPFNVTQGK (10aa)
  •    P13473    Asn-356     Lysosome-associated membrane glycoprotein 2 / Homo sapiens
• NLSLNIHGK (9aa)
  •    Q60675    Asn-359     Laminin subunit alpha-2 / Mus musculus
• GTAGNAIMDGASQIMGENR (19aa)
  •    P02675    Asn-394     Fibrinogen beta chain / Homo sapiens
• ENLTAPGSDSAVFFEQGTTR (20aa)
  •    P00450    Asn-397     Ceruloplasmin / Homo sapiens
• SINTTNVMGTSLTVR (15aa)
  •    P01023    Asn-410     Alpha-2-macroglobulin / Homo sapiens
• GGNSNGAICHFPFIYNNHNYTDCTSEGRR (29aa)
  •    P02751    Asn-430     Fibronectin / Homo sapiens
• CGLVPVLAENYNKSDNCEDTPEAGYFAVAVVK (32aa)
  •    P02787    Asn-432     Serotransferrin / Homo sapiens
  •    VAR_058199   448:I→V   dbSNP:rs2692696
• AIPQPQNVTSIIGCTH (16aa)
  •    P02790    Asn-453     Hemopexin / Homo sapiens
• IIISPEENVTLTCTAENQLER (21aa)
  •    Q61490    Asn-480     CD166 antigen / Mus musculus
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• RTAGWNIPMGLLFNQTGSCKF (21aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KSCHTAVDRTAGWNIPMGLLFNQTGSCKF (29aa)
  •    P02788    Asn-497     Lactotransferrin / Homo sapiens
• KYWCKWNNTGCQALPSQDEGPSKA (24aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• KWNNTGCQALPSQDEGPSKA (20aa)
  •    P01833    Asn-499     Polymeric immunoglobulin receptor / Homo sapiens
• LNNSSPNSSGGVK (13aa)
  •    O00472    Asn-500     RNA polymerase II elongation factor ELL2 / Homo sapiens
• VFGSQNITTVK (11aa)
  •    Q9Y4L1    Asn-515     Hypoxia up-regulated protein 1 / Homo sapiens
• SCSLEGNPVACINLSFCLNASGK (23aa)
  •    P08648    Asn-518     Integrin alpha-5 / Homo sapiens
• SCVAVTSAQPQNMSRR (16aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• SCVAVTSAQPQNMSR (15aa)
  •    O15031    Asn-528     Plexin-B2 / Homo sapiens
• RHEEGHMINCTCFGQGR (17aa)
  •    P02751    Asn-542     Fibronectin / Homo sapiens
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599     Periostin / Homo sapiens
• TCSPWSHSEETRSDNETLNIQFEESTQFNAEDINYVVPR (39aa)
  •    Q92628    Asn-724     Uncharacterized protein KIAA0232 / Homo sapiens
• ANYSLQIYPDESHYFHSVALK (21aa)
  •    Q9Z218    Asn-752     Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
• ELHHLQEQNVSNAFLDK (17aa)
  •    P00450    Asn-762     Ceruloplasmin / Homo sapiens
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGR (32aa)
  •    P01023    Asn-869     Alpha-2-macroglobulin / Homo sapiens
• SLGNVNFTVSAEALESQELCGTEVPSVPEHGRK (33aa)
  •    P01023    Asn-869     Alpha-2-macroglobulin / Homo sapiens
• IPCSQPPQIEHGTINSSR (18aa)
  •    P08603    Asn-882     Complement factor h / Homo sapiens
• VVNSTTGPGEHIR (13aa)
  •    P07996    Asn-1067     Thrombospondin-1 / Homo sapiens
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• EGVFVSNGTHWFVTQR (16aa)
  •    P0DTC2    Asn-1098     Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
• VNSSLHSQISR (11aa)
  •    P02468    Asn-1105     Laminin subunit gamma-1 / Mus musculus
• LHNLTTGTPAR (11aa)
  •    Q9UQP3    Asn-1149     Tenascin-N / Homo sapiens
• ITTTPTNGQQGNSIEEVVHADQSSCTFDNISPGIEYNVSVYTVK (44aa)
  •    P02751    Asn-1236     Fibronectin / Homo sapiens
• VEAAQNLTLPGSLR (14aa)
  •    P24821    Asn-1392     Tenascin / Homo sapiens
• RFNSSYLQGTNQITGRY (17aa)
  •    P04114    Asn-1523     Apolipoprotein B-100 / Homo sapiens
• FNSSYLQGTNQITGR (15aa)
  •    P04114    Asn-1523     Apolipoprotein B-100 / Homo sapiens
• NYYADNQTCDGELLFNMTK (19aa)
  •    P35555    Asn-1713     Fibrillin-1 / Homo sapiens
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763     Collagen alpha-1(XII) chain / Homo sapiens
• MIEAYNITEK (10aa)
  •    Q99715    Asn-2528     Collagen alpha-1(XII) chain / Homo sapiens
• MEACMLNGTVIGPGK (15aa)
  •    P04275    Asn-2585     Von willebrand factor / Homo sapiens
• TAGFCGNPSFHLYWPNK (17aa)
  •    P78509    Asn-3088     Reelin / Homo sapiens
• FVEGSHNSTVSLTTK (15aa)
  •    P04114    Asn-3411     Apolipoprotein B-100 / Homo sapiens
• YDFNSSMLYSTAK (13aa)
  •    P04114    Asn-3465     Apolipoprotein B-100 / Homo sapiens