taxonomy (10)
protein (44)
source (21)
structure (9)
composition (1)
disease (10)
reference (32)
site (64)
peptide (49)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Rattus norvegicus (Norway rat)
- Ambystoma mexicanum (Axolotl)
- Styela plicata (Sea squirt)
- Gallus gallus (Chicken)
- Drosophila melanogaster (Fruit fly)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Erythropoietin / Homo sapiens P01588
- Glycoprotein ln / Homo sapiens
- Glycoprotein rg / Homo sapiens
- Low-density lipoprotein receptor / Homo sapiens P01130
- Mucin-2 / Homo sapiens Q02817
- Osteopontin / Homo sapiens P10451
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prosaposin / Homo sapiens P07602
- Proteoglycan 4 (lubricin) / Homo sapiens Q92954
- Uncharacterized protein from Fluid / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Unspecified mucin / Homo sapiens
- Mucin / Bos taurus
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Cadherin-13 / Mus musculus Q9WTR5
- Contactin-associated protein-like 4 / Mus musculus Q99P47
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Embigin / Mus musculus P21995
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurocan core protein / Mus musculus P55066
- Neurofascin / Mus musculus A0A087WPX3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuroplastin / Mus musculus P97300
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Plexin-A4 / Mus musculus Q80UG2
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Teneurin-2 / Mus musculus Q9WTS5
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Mucin / Ambystoma mexicanum
- H-antigen / Styela plicata
- Ovalbumin / Gallus gallus P01012
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Body Fluid (UBERON_0006314)
- Brain (UBERON_0000955)
- Colonic Mucosa (UBERON_0000317)
- Embryo (UBERON_0000922)
- Intestinal Mucosa
- Large Intestine (UBERON_0000059)
- Liver (UBERON_0002107)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Skin of Body (UBERON_0002097) Fibroblast (CL_0000057)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- Synovial Fluid (UBERON_0001090)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- Egg Cell Egg White
- Egg Cell Jelly Coat
Source
- N-Linked / No-core / GlcNAc(b1-4)GlcNAc
- O-Linked / Core 10 / GalNAc(b1-3)GalNAc
- O-Linked / Core 3 / GlcNAc(b1-3)GalNAc
- O-Linked / Core 5 / GalNAc(a1-3)GalNAc
- O-Linked / Core 6 / GlcNAc(b1-6)GalNAc
- O-Linked / Core 7 / GalNAc(a1-6)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-?)GalNAc
- O-Linked / Undefined core / Structure 9619
Reported structure
- HexNAc:2 (avg mass : 424.4053 )
Composition
- Arthritis, Rheumatoid (DOID:7148)
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, Ovarian (Cystic) (DOID:2394)
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Diverticulosis (DOID:7475)
- Osteoarthritis (DOID:8398)
- Ovarian cyst (DOID:5119)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- The diversity of O-linked glycans expressed during Drosophila melanogaster development reflects stage- and tissue-specific requirements for cell signaling. (2008 - Kazuhiro Aoki, Mindy Porterfield, Samuel S Lee, Brian Dong, Khoi Nguyen, Katherine H McGlamry, Michael Tiemeyer) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Oligosaccharides of human bronchial glycoproteins. Neutral di- and trisaccharides isolated from a patient suffering from chronic bronchitis. (1980 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Reinhold V) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
Reference
- Erythropoietin / Homo sapiens
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
-
Mucin-2 / Homo sapiens
- Undefined site
- Osteopontin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Embigin / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Plexin-A4 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Teneurin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
H-antigen / Styela plicata
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- HENNTKDNSIQHEFSLTR (18aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- WKLNK (5aa)
- SNVSVEENVILEKPSHVELK (20aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- NLTIVDSGLK (10aa)
- FLEPYNDSIQAQK (13aa)
- ANATLLLGPLR (11aa)
- HINFTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SEFRVYSSANNCTFE (15aa)
- VNFTCK (6aa)
- RPDIQYPDATDEDITSHMESEELNGAYK (28aa)
- VLGFKPKPPKNESLETYPLMMK (22aa)
- RNESHLIDFR (10aa)
- FNHTQTIQQK (10aa)
- ANATIEVK (8aa)
- QNITYLLK (8aa)
- HMNETSHTQGSLR (13aa)
- LAYATINDSR (10aa)
- NGTITDAVDCALDPLSE (17aa)
- QVNFTVDEHRR (11aa)
- VIYQNHNK (8aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGEVFNATR (18aa)
- GIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR (36aa)
- NHSLAFVGTK (10aa)
- VILYNR (6aa)
- KWNNTGCQALPSQDEGPSKA (20aa)
- LEDFNYNNQTITDQIYR (17aa)
- YIDKGNR (7aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- INNTHALVSLLQNLNK (16aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- FHINK (5aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- KNFTTAPAICHDGK (14aa)
- GVFVSNGTHWFVTQR (15aa)
- NFTTAPAICHDGK (13aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- EGVFVSNGTHWFVTQR (16aa)
- VAKNLNESLIDLQE (14aa)
- NVTSILELR (9aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core
(avg mass : 424.4053)
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Polymeric immunoglobulin receptor / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- KWNNTGCQALPSQDEGPSKA (20aa)
-
- O-Linked / Core 10
(avg mass : 424.4053)
-
Mucin / Bos taurus
- Undefined site
-
- O-Linked / Core 3
(avg mass : 424.4053)
- Colonic Mucosa (UBERON_0000317)
- Intestinal Mucosa
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Submandibular Gland (UBERON_0001736)
- Egg Cell Jelly Coat
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- Diverticulosis (DOID:7475)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Oligosaccharides of human bronchial glycoproteins. Neutral di- and trisaccharides isolated from a patient suffering from chronic bronchitis. (1980 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Reinhold V) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Mucin-2 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
- O-Linked / Core 5
(avg mass : 424.4053)
- Brain (UBERON_0000955)
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992)
- Submandibular Gland (UBERON_0001736)
- Ovarian cyst (DOID:5119)
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
- O-Linked / Core 6
(avg mass : 424.4053)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
- O-Linked / Core 7
(avg mass : 424.4053)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
-
Mucin / Bos taurus
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 424.4053)
- Body Fluid (UBERON_0006314)
- Large Intestine (UBERON_0000059)
- Small Intestine (UBERON_0002108)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
H-antigen / Styela plicata
- Undefined site
-
- O-Linked / Undefined core
(avg mass : 424.4053)
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Erythropoietin / Homo sapiens
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
- O-Linked / Undefined core
(avg mass : 424.4053)
Released - Embryo (UBERON_0000922)
-
- HexNAc:2 / N-Linked
(avg mass : 424.4053)
- N-Linked / No-core / GlcNAc(b1-4)GlcNAc
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Embigin / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Plexin-A4 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Teneurin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- HENNTKDNSIQHEFSLTR (18aa)
- WKLNK (5aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SNVSVEENVILEKPSHVELK (20aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- NLTIVDSGLK (10aa)
- FLEPYNDSIQAQK (13aa)
- ANATLLLGPLR (11aa)
- HINFTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SEFRVYSSANNCTFE (15aa)
- VNFTCK (6aa)
- VLGFKPKPPKNESLETYPLMMK (22aa)
- RNESHLIDFR (10aa)
- FNHTQTIQQK (10aa)
- ANATIEVK (8aa)
- QNITYLLK (8aa)
- HMNETSHTQGSLR (13aa)
- LAYATINDSR (10aa)
- NGTITDAVDCALDPLSE (17aa)
- QVNFTVDEHRR (11aa)
- VIYQNHNK (8aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGEVFNATR (18aa)
- GIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR (36aa)
- NHSLAFVGTK (10aa)
- VILYNR (6aa)
- LEDFNYNNQTITDQIYR (17aa)
- YIDKGNR (7aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- INNTHALVSLLQNLNK (16aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- FHINK (5aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- KNFTTAPAICHDGK (14aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- GVFVSNGTHWFVTQR (15aa)
- EGVFVSNGTHWFVTQR (16aa)
- NFTTAPAICHDGK (13aa)
- VAKNLNESLIDLQE (14aa)
- NVTSILELR (9aa)
-
- HexNAc:2 / O-Linked
(avg mass : 424.4053)
- Urine (UBERON_0001088)
- O-Linked / Core 10 / GalNAc(b1-3)GalNAc
- O-Linked / Core 3 / GlcNAc(b1-3)GalNAc
- O-Linked / Core 5 / GalNAc(a1-3)GalNAc
- O-Linked / Core 6 / GlcNAc(b1-6)GalNAc
- O-Linked / Core 7 / GalNAc(a1-6)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-?)GalNAc
- O-Linked / Undefined core / Structure 9619
- Prostate cancer (DOID:10283)
- Osteopontin / Homo sapiens
- RPDIQYPDATDEDITSHMESEELNGAYK (28aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
- HexNAc:2 / O-Linked
(avg mass : 424.4053)
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- HexNAc:2 / N-Linked
(avg mass : 424.4053)
Source
Reported glycosite
- O-Linked / Undefined core
(avg mass : 424.4053)
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 424.4053)
Source
Reference
Reported glycosite
- O-Linked / Undefined core
(avg mass : 424.4053)
Reference
Reported glycosite
- O-Linked / Core 7
(avg mass : 424.4053)
Disease
Reference
Reported glycosite
- O-Linked / Core 6
(avg mass : 424.4053)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 5
(avg mass : 424.4053)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 424.4053)
Reported glycosite
- O-Linked / Core 10
(avg mass : 424.4053)
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / No-core
(avg mass : 424.4053)