taxonomy (9)
protein (43)
source (19)
structure (8)
composition (1)
disease (10)
reference (30)
site (63)
peptide (48)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Rattus norvegicus (Norway rat)
- Ambystoma mexicanum (Axolotl)
- Styela plicata (Sea squirt)
- Gallus gallus (Chicken)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- Erythropoietin / Homo sapiens P01588
- Glycoprotein ln / Homo sapiens
- Glycoprotein rg / Homo sapiens
- Low-density lipoprotein receptor / Homo sapiens P01130
- Mucin-2 / Homo sapiens Q02817
- Osteopontin / Homo sapiens P10451
- Prosaposin / Homo sapiens P07602
- Proteoglycan 4 (lubricin) / Homo sapiens Q92954
- Uncharacterized protein from Fluid / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Unspecified mucin / Homo sapiens
- Mucin / Bos taurus
- BDNF/NT-3 growth factors receptor / Mus musculus P15209
- Cadherin-13 / Mus musculus Q9WTR5
- Contactin-associated protein-like 4 / Mus musculus Q99P47
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Embigin / Mus musculus P21995
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus Q9WV18
- Gamma-glutamyltransferase 7 / Mus musculus Q99JP7
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus O08532-4
- Leukocyte surface antigen CD47 / Mus musculus Q61735
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neurocan core protein / Mus musculus P55066
- Neurofascin / Mus musculus Q810U3
- Neuronal cell adhesion molecule / Mus musculus Q810U4
- Neuroplastin / Mus musculus P97300
- Oligodendrocyte-myelin glycoprotein / Mus musculus Q63912
- Plexin-A4 / Mus musculus Q80UG2
- Roundabout homolog 2 / Mus musculus Q7TPD3
- Signal-regulatory protein alpha / Mus musculus P97797
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus P14231
- Teneurin-2 / Mus musculus Q9WTS5
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Mucin / Rattus norvegicus
- Mucin-2 glycopeptide a / Rattus norvegicus Q62635
- Mucin-2 glycopeptide b / Rattus norvegicus Q62635
- Mucin / Ambystoma mexicanum
- H-antigen / Styela plicata
- Ovalbumin / Gallus gallus P01012
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Body Fluid (UBERON_0006314)
- Brain (UBERON_0000955)
- Colonic Mucosa (UBERON_0000317)
- Intestinal Mucosa
- Large Intestine (UBERON_0000059)
- Liver (UBERON_0002107)
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Skin of Body (UBERON_0002097) Fibroblast (CL_0000057)
- Small Intestine (UBERON_0002108)
- Submandibular Gland (UBERON_0001736)
- Synovial Fluid (UBERON_0001090)
- Urine (UBERON_0001088)
- BTI-Tn-5B1-4 (CVCL_C190)
- HEK293 (CVCL_0045)
- Egg Cell Egg White
- Egg Cell Jelly Coat
Source
- N-Linked / No-core / GlcNAc(b1-4)GlcNAc
- O-Linked / Core 10 / GalNAc(b1-3)GalNAc
- O-Linked / Core 3 / GlcNAc(b1-3)GalNAc
- O-Linked / Core 5 / GalNAc(a1-3)GalNAc
- O-Linked / Core 6 / GlcNAc(b1-6)GalNAc
- O-Linked / Core 7 / GalNAc(a1-6)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-3)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-?)GalNAc
Reported structure
- HexNAc:2 (avg mass : 424.4053 )
Composition
- Arthritis, Rheumatoid (DOID:7148)
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, Ovarian (Cystic) (DOID:2394)
- COVID-19 (DOID:0080600)
- Cystic Fibrosis (DOID:1485)
- Diverticulosis (DOID:7475)
- Osteoarthritis (DOID:8398)
- Ovarian cyst (DOID:5119)
- Prostate cancer (DOID:10283)
Disease
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
- Oligosaccharides of human bronchial glycoproteins. Neutral di- and trisaccharides isolated from a patient suffering from chronic bronchitis. (1980 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Reinhold V) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
Reference
- Erythropoietin / Homo sapiens
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
-
Mucin-2 / Homo sapiens
- Undefined site
- Osteopontin / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Embigin / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Plexin-A4 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Teneurin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
H-antigen / Styela plicata
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- HENNTKDNSIQHEFSLTR (18aa)
- WKLNK (5aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- SNVSVEENVILEKPSHVELK (20aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- NLTIVDSGLK (10aa)
- ANATIEVK (8aa)
- FLEPYNDSIQAQK (13aa)
- ANATLLLGPLR (11aa)
- HINFTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIK (16aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SEFRVYSSANNCTFE (15aa)
- VNFTCK (6aa)
- RPDIQYPDATDEDITSHMESEELNGAYK (28aa)
- VLGFKPKPPKNESLETYPLMMK (22aa)
- RNESHLIDFR (10aa)
- FNHTQTIQQK (10aa)
- QNITYLLK (8aa)
- HMNETSHTQGSLR (13aa)
- LAYATINDSR (10aa)
- NGTITDAVDCALDPLSE (17aa)
- QVNFTVDEHRR (11aa)
- VIYQNHNK (8aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGEVFNATR (18aa)
- GIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR (36aa)
- NHSLAFVGTK (10aa)
- VILYNR (6aa)
- LEDFNYNNQTITDQIYR (17aa)
- YIDKGNR (7aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- INNTHALVSLLQNLNK (16aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- FHINK (5aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- KNFTTAPAICHDGK (14aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- EGVFVSNGTHWFVTQR (16aa)
- EGVFVSNGTHWFVTQR (16aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- VAKNLNESLIDLQE (14aa)
- NVTSILELR (9aa)
Mass spectrometry observed peptide
-
- N-Linked / No-core (avg mass : 424.4053)
- Liver (UBERON_0002107)
- Egg Cell Egg White
- Characteristics of asparagine-linked sugar chains of sphingolipid activator protein 1 purified from normal human liver and GM1 gangliosidosis (type 1) liver. (1990 - Yamashita K, Inui K, Totani K, Kochibe N, Furukawa M, Okada S) / Status : Reviewed
- Preparation and characterisation of fragment glycoasparagines from ovalbumin glycopeptides: reference compounds for structural and biochemical studies of the oligo-mannose and hybrid types of carbohydrate chains of glycoproteins. (1982 - Nomoto H, Endo T, Inoue Y) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Ovalbumin / Gallus gallus
- Undefined site
-
- O-Linked / Core 10 (avg mass : 424.4053)
-
Mucin / Bos taurus
- Undefined site
-
- O-Linked / Core 3 (avg mass : 424.4053)
- Colonic Mucosa (UBERON_0000317)
- Intestinal Mucosa
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992)
- Pulmonary Mucosa
- Saliva (UBERON_0001836)
- Submandibular Gland (UBERON_0001736)
- Egg Cell Jelly Coat
- Bronchiectasis, due to Kartagener's Syndrome
- Bronchitis, Chronic (DOID:6132)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Cystic Fibrosis (DOID:1485)
- Diverticulosis (DOID:7475)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- The broad diversity of neutral and sialylated oligosaccharides derived from human salivary mucins. (1992 - Klein A, Carnoy C, Wieruszeski J, Strecker G, Strang A, van Halbeek H, Roussel P, Lamblin G) / Status : Reviewed
- Primary structure of neutral and acidic oligosaccharide-alditols derived from the jelly coat of the Mexican axolotl. Occurence of oliogsaccharides with fucosyl(alpha 1-3)fucosyl(alpha 1-4)-3-deoxy-D-glycero-D-galacto-nonulosonic acid and galactosyl(alpha 1-4)[fucosyl(alpha 1-2)]galactosyl(beta 1-4)- (1992 - Strecker G, Wieruszeski J, Michalski J, Alonso C, Leroy Y, Boilly B, Montreuil J) / Status : Reviewed
- Structural characterization of neutral oligosaccharides with blood-group A and H activity isolated from bovine submaxillary mucin. (1991 - Savage A, D'Arcy S, Donoghue C) / Status : Reviewed
- Primary structure of neutral oligosaccharides derived from respiratory-mucus glycoproteins of a patient suffering from bronchiectasis, determined by combination of 500-MHz 1H-NMR spectroscopy and quantitative sugar analysis. 2. Structure of 19 oligosaccharides having the GlcNAc beta(1----3)GalNAc-ol (1988 - Breg J, Van Halbeek H, Vliegenthart J, Klein A, Lamblin G, Roussel P) / Status : Reviewed
- Carbohydrate structures of bovine submaxillary mucin. (1986 - Tsuji T, Osawa T) / Status : Reviewed
- Oligosaccharide structures of isolated human colonic mucin species. (1985 - Podolsky D) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- The combination of normal-phase and reverse-phase high-pressure liquid chromatography with NMR for the isolation and characterization of oligosaccharide alditols from ovarian cyst mucins. (1984 - Dua V, Dube V, Bush C) / Status : Reviewed
- Isolation and characterisation of neutral oligosaccharides from human bronchial glycoproteins. (1982 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Van Halbeek H, Dorland L, Vliegenthart J) / Status : Reviewed
- Primary-structure determination of fourteen neutral oligosaccharides derived from bronchial-mucus glycoproteins of patients suffering from cystic fibrosis, employing 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Hull W, Lamblin G, Lhermitte M, Boersma A, Roussel P) / Status : Reviewed
- Oligosaccharides of human bronchial glycoproteins. Neutral di- and trisaccharides isolated from a patient suffering from chronic bronchitis. (1980 - Lamblin G, Lhermitte M, Boersma A, Roussel P, Reinhold V) / Status : Reviewed
- Structure of some oligosaccharides derived from rat-intestinal glycoproteins. (1978 - Carlsson H, Sundblad G, Hammarstrm S, Lnngren J) / Status : Reviewed
-
Glycoprotein ln / Homo sapiens
- Undefined site
-
Mucin-2 / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Unspecified mucin / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Mucin / Rattus norvegicus
- Undefined site
-
Mucin / Ambystoma mexicanum
- Undefined site
-
- O-Linked / Core 5 (avg mass : 424.4053)
- Brain (UBERON_0000955)
- Meconium (UBERON_0007109)
- Ovary (UBERON_0000992)
- Submandibular Gland (UBERON_0001736)
- Ovarian cyst (DOID:5119)
- High prevalence of 2-mono- and 2,6-di-substituted manol-terminating sequences among O-glycans released from brain glycopeptides by reductive alkaline hydrolysis. (1999 - Chai W, Yuen C, Kogelberg H, Carruthers R, Margolis R, Feizi T, Lawson A) / Status : Reviewed
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Structural analysis of the O-glycosidically linked core-region oligosaccharides of human meconium glycoproteins which express oncofoetal antigens. (1985 - Hounsell EF, Lawson AM, Feeney J, Gooi HC, Pickering NJ, Stoll MS, Lui SC, Feizi T) / Status : Reviewed
- Immunochemical studies on blood groups. Structures and immunochemical properties of oligosaccharides from two fractions of blood group substance from human ovarian cyst fluid differing in B, I, and i activities and reactivity toward concanavalin A. (1976 - Maisonrouge-McAuliffe F, Kabat E) / Status : Reviewed
-
Uncharacterized protein from Fluid / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
Brain non dialyzable glycopeptide / Oryctolagus cuniculus
- Undefined site
-
- O-Linked / Core 6 (avg mass : 424.4053)
- Cancer, Ovarian (Cystic) (DOID:2394)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Typing of core and backbone domains of mucin-type oligosaccharides from human ovarian-cyst glycoproteins by 500-MHz 1H-NMR spectroscopy. (1986 - Mutsaers J, van Halbeek H, Vliegenthart J, Wu A, Kabat E) / Status : Reviewed
- Immunochemical studies on blood groups. Purification and characterization of radioactive 3H-reduced di- to hexasaccharides produced by alkaline beta-elimination-borohydride 3H reduction of Smith degraded blood group A active glycoproteins. (1984 - Wu A, Kabat E, Nilsson B, Zopf D, Gruezo F, Liao J) / Status : Reviewed
-
Glycoprotein rg / Homo sapiens
- Undefined site
-
Mucin / Bos taurus
- Undefined site
-
- O-Linked / Core 7 (avg mass : 424.4053)
- Neutral core oligosaccharides of bovine submaxillary mucin--use of lead tetraacetate in the cold for establishing branch positions. (1998 - Martensson S, Levery S, Fang T, Bendiak B) / Status : Reviewed
- Neutral oligosaccharides of bovine submaxillary mucin. A combined mass spectrometry and 1H-NMR study. (1992 - Chai W, Hounsell E, Cashmore G, Rosankiewicz J, Bauer C, Feeney J, Feizi T, Lawson A) / Status : Reviewed
-
Mucin / Bos taurus
- Undefined site
-
- O-Linked / Undefined core (avg mass : 424.4053)
- Body Fluid (UBERON_0006314)
- Large Intestine (UBERON_0000059)
- Small Intestine (UBERON_0002108)
- The glycosylation of rat intestinal Muc2 mucin varies between rat strains and the small and large intestine. A study of O-linked oligosaccharides by a mass spectrometric approach. (1997 - Karlsson N, Herrmann A, Karlsson H, Johansson M, Carlstedt I, Hansson G) / Status : Reviewed
- Characterization of two different glycosylated domains from the insoluble mucin complex of rat small intestine. (1993 - Carlstedt I, Herrmann A, Karlsson H, Sheehan J, Fransson L, Hansson G) / Status : Reviewed
- Sugar sequences of allergenically active oligosaccharide alcohols isolated from a large-molecular-size sea squirt antigen termed H-antigen. (1989 - Ohta M, Shigeta S, Ono K, Takao T, Shimonishi Y, Oka S) / Status : Reviewed
-
Mucin-2 glycopeptide a / Rattus norvegicus
- Undefined site
-
Mucin-2 glycopeptide b / Rattus norvegicus
- Undefined site
-
H-antigen / Styela plicata
- Undefined site
-
- O-Linked / Undefined core (avg mass : 424.4053)
- The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, identified by site-specific glycopeptide analysis (2014 - Ali L, Flowers SA, Jin C, Bennet EP, Ekwall AK, Karlsson NG) / Status : Reviewed
- Determination of site-specific glycan heterogeneity on glycoproteins (2012 - Kolarich D1, Jensen PH, Altmann F, Packer NH.) / Status : Reviewed
- Biosynthesis of N- and O-linked oligosaccharides of the low density lipoprotein receptor. (1983 - Cummings R, Kornfeld S, Schneider W, Hobgood K, Tolleshaug H, Brown M, Goldstein J) / Status : Reviewed
- Erythropoietin / Homo sapiens
-
Low-density lipoprotein receptor / Homo sapiens
- Undefined site
- Proteoglycan 4 (lubricin) / Homo sapiens
-
- HexNAc:2 / N-Linked (avg mass : 424.4053)
- N-Linked / No-core / GlcNAc(b1-4)GlcNAc
- COVID-19 (DOID:0080600)
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- BDNF/NT-3 growth factors receptor / Mus musculus
- Cadherin-13 / Mus musculus
- Contactin-associated protein-like 4 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Embigin / Mus musculus
- Gamma-aminobutyric acid type B receptor subunit 1 / Mus musculus
- Gamma-glutamyltransferase 7 / Mus musculus
- Isoform 2D of Voltage-dependent calcium channel subunit alpha-2/delta-1 / Mus musculus
- Leukocyte surface antigen CD47 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neurocan core protein / Mus musculus
- Neurofascin / Mus musculus
- Neuronal cell adhesion molecule / Mus musculus
- Neuroplastin / Mus musculus
- Oligodendrocyte-myelin glycoprotein / Mus musculus
- Plexin-A4 / Mus musculus
- Roundabout homolog 2 / Mus musculus
- Signal-regulatory protein alpha / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-2 / Mus musculus
- Teneurin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (BTI-Tn-5B1-4) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- HENNTKDNSIQHEFSLTR (18aa)
- WKLNK (5aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTK (33aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- SSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKR (34aa)
- SNVSVEENVILEKPSHVELK (20aa)
- IRNVSDTTK (9aa)
- IRNVSDTTKR (10aa)
- NLTIVDSGLK (10aa)
- ANATIEVK (8aa)
- FLEPYNDSIQAQK (13aa)
- ANATLLLGPLR (11aa)
- HINFTR (6aa)
- TQSLLIVNNATNVVIK (16aa)
- TQSLLIVNNATNVVIK (16aa)
- RACQFNR (7aa)
- ACQFNR (6aa)
- SEFRVYSSANNCTFE (15aa)
- VNFTCK (6aa)
- VLGFKPKPPKNESLETYPLMMK (22aa)
- RNESHLIDFR (10aa)
- FNHTQTIQQK (10aa)
- QNITYLLK (8aa)
- HMNETSHTQGSLR (13aa)
- LAYATINDSR (10aa)
- NGTITDAVDCALDPLSE (17aa)
- QVNFTVDEHRR (11aa)
- VIYQNHNK (8aa)
- VQPTESIVRFPNITNLCPFGEVFNATR (27aa)
- FPNITNLCPFGEVFNATR (18aa)
- GIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATR (36aa)
- NHSLAFVGTK (10aa)
- VILYNR (6aa)
- LEDFNYNNQTITDQIYR (17aa)
- YIDKGNR (7aa)
- NLSVVILGASDKDLHPNTDPFKFEIHK (27aa)
- ILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWR (51aa)
- INNTHALVSLLQNLNK (16aa)
- AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- NSVAYSNNSIAIPTNFTISVTTE (23aa)
- FHINK (5aa)
- DFGGFNFSQILPDPSKPSKR (20aa)
- KNFTTAPAICHDGK (14aa)
- GYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGK (41aa)
- EGVFVSNGTHWFVTQR (16aa)
- EGVFVSNGTHWFVTQR (16aa)
- NFTTAPAICHDGK (13aa)
- GVFVSNGTHWFVTQR (15aa)
- VAKNLNESLIDLQE (14aa)
- NVTSILELR (9aa)
-
- HexNAc:2 / O-Linked (avg mass : 424.4053)
- Urine (UBERON_0001088)
- O-Linked / Core 3 / GlcNAc(b1-3)GalNAc
- O-Linked / Core 5 / GalNAc(a1-3)GalNAc
- O-Linked / Undefined core / GlcNAc(?1-?)GalNAc
- Prostate cancer (DOID:10283)
- Osteopontin / Homo sapiens
- RPDIQYPDATDEDITSHMESEELNGAYK (28aa)
Source
Suggested structure
Disease
Reported glycosite
Mass spectrometry observed peptide
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
Reference
Reported glycosite
Source
Disease
Reference
Reported glycosite
Disease
Reference
Reported glycosite
Disease
Reference
Reported glycosite
Source
Disease
Reference
Reported glycosite
Source
Disease
Reference
Reported glycosite
Disease
Reported glycosite
Source
Disease
Reference
Reported glycosite
