taxonomy (16)
protein (108)
source (37)
structure (31)
composition (1)
disease (12)
reference (59)
site (146)
peptide (121)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Dasyatis sabina (Atlantic stingray)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
- Drosophila melanogaster (Fruit fly)
- Bothrops moojeni (Brazilian lancehead)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- A-kinase anchor protein 11 / Homo sapiens Q9UKA4
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase D / Homo sapiens O75976
- Ceramide synthase 2 / Homo sapiens Q96G23
- Clusterin / Homo sapiens P10909
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Corticosteroid-binding globulin / Homo sapiens P08185
- Decorin / Homo sapiens P07585
- Desmoglein-2 / Homo sapiens Q14126
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Ephrin type-a receptor 2 / Homo sapiens P29317
- Fibroblast growth factor receptor 2 / Homo sapiens P21802
- Fibronectin / Homo sapiens P02751
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Glandular kallikrein 1 / Homo sapiens P06870
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- Immunoglobulin gamma / Homo sapiens P01857 P01860 P01859 P01861
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens Q14767
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Major prion protein / Homo sapiens P04156
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Mucin-2 / Homo sapiens Q02817
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Reticulocalbin-1 / Homo sapiens Q15293
- Reticulocalbin-3 / Homo sapiens Q96D15
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Solute carrier family 12 member 6 / Homo sapiens Q9UHW9
- Thrombospondin-1 / Homo sapiens P07996
- Thyroglobulin / Homo sapiens P01266
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transmembrane protein 2 / Homo sapiens Q9UHN6
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Corticotropin - lipotropin, npp peptide / Bos taurus P01190
- Immunoglobulin gamma / Bos taurus
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein from Zona Pellucida / Bos taurus
- Zona pellucida sperm-binding protein 2 / Bos taurus Q9BH10
- Major prion protein / Mesocricetus auratus P04273
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-9 / Mus musculus P70407
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus Q8BLQ9-2
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neuronal pentraxin-1 / Mus musculus Q62443
- Noelin / Mus musculus O88998
- Phospholipase D3 / Mus musculus O35405
- Plexin-B1 / Mus musculus Q8CJH3
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Tenascin-r / Mus musculus Q8BYI9
- Tetraspanin-2 / Mus musculus Q922J6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Uncharacterized protein from Brainstem / Mus musculus
- Uncharacterized protein from Cerebellum / Mus musculus
- Uncharacterized protein from Telencephalon / Mus musculus
- Uncharacterized protein from Telencephalon / Mus musculus
- Zona pellucida sperm-binding protein matrix / Mus musculus P10761 P20239 Q62005
- Immunoglobulin gamma / Oryctolagus cuniculus
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries Q712V9
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries Q712V9
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin gamma / Gallus gallus
- Immunoglobulin y / Gallus gallus
- Uncharacterized protein / Gallus gallus
- Relaxin-like protein agf / Dasyatis sabina P81191
- Uncharacterized protein / Dirofilaria immitus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Batroxobin / Bothrops moojeni
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Brainstem (UBERON_0002298)
- Cerebellum (UBERON_0002037)
- Colonic Mucosa (UBERON_0000317)
- Embryo (UBERON_0000922)
- Epithelium of Stomach (UBERON_0001276)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Mammary Gland (UBERON_0001911)
- Marshall's Gland (UBERON_0011149)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Neurohypophysis (UBERON_0002198)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Pituitary Gland (UBERON_0000007)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Spleen (UBERON_0002106)
- Telencephalon (UBERON_0001893)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[HexNAc(b1-4)][Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc"
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / Structure 1900
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-3)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(b1-?)Man(a1-3)[HexNAc(b1-?)Man(a1-6)][HexNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
- N-Linked / Complex / Structure 2802
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / Structure 9460
- N-Linked / Complex / Structure 9566
- N-Linked / Complex / Structure 9792
- N-Linked / Complex / Structure 9951
- N-Linked / Complex / Structure 10064
- N-Linked / Hybrid / Structure 9595
- N-Linked / Hybrid / Structure 9618
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)][HexNAc(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)GalNAc
Reported structure
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
Composition
- Arthritis, Rheumatoid (DOID:7148)
- Cancer, breast (DOID:1612)
- COVID-19 (DOID:0080600)
- Diverticulosis (DOID:7475)
- Gaucher Disease (DOID:1926)
- Melanoma (DOID:1909)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Oral squamous cell carcinoma (DOID:0050866)
- Prostate cancer (DOID:10283)
- Scrapie (DOID:5434)
- Sjogren's Syndrome (DOID:12894)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Identification of a glycosylated relaxin-like molecule from the male Atlantic stingray, Dasyatis sabina. (1997 - Bullesbach E, Schwabe C, Lacy E) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed
Reference
- A-kinase anchor protein 11 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Fibroblast growth factor receptor 2 / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major prion protein / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
-
Mucin-2 / Homo sapiens
- Undefined site
- Neural cell adhesion molecule L1 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
- Solute carrier family 12 member 6 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Transmembrane protein 2 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Major prion protein / Mesocricetus auratus
- Undefined site
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-9 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Noelin / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-B1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
-
Tenascin-r / Mus musculus
- Undefined site
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
-
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
- Relaxin-like protein agf / Dasyatis sabina
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Batroxobin / Bothrops moojeni
- Undefined site
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- YVNMSNHHR (9aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- KNNSDISSTRGFPSVLRGGKY (21aa)
- NNSDISSTR (9aa)
- WFSAGLASNSSWLR (14aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- FSNVTWF (7aa)
- NK (2aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DGVHLGPNNR (10aa)
- HYTNSSQDVTVPCR (14aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- VLTLANFTTK (10aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- DMSDGFISNITIQR (14aa)
- NVETNNSTVLIEGKKIESLR (20aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- YHKNNKSWMESEF (13aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- FKLDWLGNCSGLNDDSYGYR (20aa)
- AGPNGTIFVADAYK (14aa)
- VYSSANNCTFE (11aa)
- TKPREEQFNSTFR (13aa)
- REEQFNSTFRV (11aa)
- EEQFNSTF (8aa)
- EEQFNSTFR (9aa)
- KTKPREEQFNSTFRV (15aa)
- EEQFNSTYR (9aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTYR (13aa)
- EEQYNSTY (8aa)
- KTKPREEQYNSTYRV (15aa)
- INATDADEPNTINSK (15aa)
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
- VNTLEEGKGGPKNDTEER (18aa)
- GENFTETDVK (10aa)
- NFTMNEK (7aa)
- TPLTANITK (9aa)
- NDGMNITVLR (10aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
- EEQYNSTFR (9aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- NGTITDAVDCALDPLSE (17aa)
- VIYQNHNK (8aa)
- FFHVNGSAFLPR (12aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVM (14aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GEVFNATRF (9aa)
- VFNATR (6aa)
- NATRF (5aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- NMTVPSK (7aa)
- DECWCPANSTGK (12aa)
- NYTDCTSEGR (10aa)
- VSINQTEPPK (10aa)
- VFSIHSENGSIFTLKPLDR (19aa)
- IISENKTDEEPGYIKK (16aa)
- LLLPAKNTTHLK (12aa)
- VPGNVTAVIGETIK (14aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- NVTIMANLK (9aa)
- ANEYPNITR (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- GAPGINGTK (9aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- LYQDVNCT (8aa)
- NNSYECDIPI (10aa)
- YSNNSIAIPT (10aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- NVTAQICIDK (10aa)
- NATLAEQAK (9aa)
- AEPPINASASDQGEK (15aa)
- NLSMTITR (8aa)
- VPAQEKNF (8aa)
- KNFTTAPAICHDGK (14aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
- GINAS (5aa)
- NISQDLEK (8aa)
- NLQVYNATSNSLTVK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Melanoma (DOID:1909)
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Melanoma (DOID:1909)
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Neurohypophysis (UBERON_0002198)
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Metalloproteinase inhibitor 1 / Homo sapiens
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Prostate-specific antigen (psa-1) / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
Detected as released in some experiments - Spleen (UBERON_0002106)
- Zona Pellucida (UBERON_0000086)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- Gaucher Disease (DOID:1926)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
Detected as released in some experiments - Embryo (UBERON_0000922)
- Zona Pellucida (UBERON_0000086)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
Detected as released in some experiments - Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Brainstem (UBERON_0002298)
- Cerebellum (UBERON_0002037)
- Glomerular Basement Membrane (UBERON_0005777)
- Meconium (UBERON_0007109)
- Telencephalon (UBERON_0001893)
- Adipocytes (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
- Arthritis, Rheumatoid (DOID:7148)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Scrapie (DOID:5434)
- Sjogren's Syndrome (DOID:12894)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
- Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
-
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Zona Pellucida (UBERON_0000086)
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Zona Pellucida (UBERON_0000086)
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Marshall's Gland (UBERON_0011149)
- Relaxin-like protein agf / Dasyatis sabina
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- KNNSDISSTRGFPSVLRGGKY (21aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- REEQFNSTFRV (11aa)
- KTKPREEQFNSTFRV (15aa)
- KTKPREEQYNSTYRV (15aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Hybrid
(avg mass : 1666.5605)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Hybrid
(avg mass : 1666.5605)
Released - Embryo (UBERON_0000922)
-
- N-Linked / Undefined core
(avg mass : 1666.5605)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- TKPREEQFNSTFR (13aa)
- TKPREEQYNSTYR (13aa)
-
- O-Linked / Core 2
(avg mass : 1666.5605)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1666.5605)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 3
(avg mass : 1666.5605)
- Colonic Mucosa (UBERON_0000317)
- Diverticulosis (DOID:7475)
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
-
Mucin-2 / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[HexNAc(b1-4)][Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc"
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-3)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(b1-?)Man(a1-3)[HexNAc(b1-?)Man(a1-6)][HexNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
- N-Linked / Complex / Structure 1900
- N-Linked / Complex / Structure 2802
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / Structure 9460
- N-Linked / Complex / Structure 9566
- N-Linked / Complex / Structure 9792
- N-Linked / Complex / Structure 9951
- N-Linked / Complex / Structure 10064
- N-Linked / Hybrid / Structure 9595
- N-Linked / Hybrid / Structure 9618
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)][HexNAc(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- A-kinase anchor protein 11 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Fibroblast growth factor receptor 2 / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major prion protein / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Serpin h1 / Homo sapiens
- Solute carrier family 12 member 6 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane protein 2 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-9 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Noelin / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-B1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- YVNMSNHHR (9aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- NNSDISSTR (9aa)
- WFSAGLASNSSWLR (14aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- FSNVTWF (7aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DGVHLGPNNR (10aa)
- HYTNSSQDVTVPCR (14aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- VLTLANFTTK (10aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- DMSDGFISNITIQR (14aa)
- NVETNNSTVLIEGKKIESLR (20aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- YHKNNKSWMESEF (13aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- FKLDWLGNCSGLNDDSYGYR (20aa)
- AGPNGTIFVADAYK (14aa)
- TKPREEQFNSTFR (13aa)
- EEQFNSTF (8aa)
- EEQFNSTFR (9aa)
- EEQFNSTYR (9aa)
- EEQYNSTYR (9aa)
- EEQYNSTY (8aa)
- INATDADEPNTINSK (15aa)
- VNTLEEGKGGPKNDTEER (18aa)
- GENFTETDVK (10aa)
- NFTMNEK (7aa)
- TPLTANITK (9aa)
- NDGMNITVLR (10aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
- EEQYNSTFR (9aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- VIYQNHNK (8aa)
- FFHVNGSAFLPR (12aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVM (14aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- GEVFNATRF (9aa)
- NATRF (5aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- NMTVPSK (7aa)
- DECWCPANSTGK (12aa)
- NYTDCTSEGR (10aa)
- VSINQTEPPK (10aa)
- VFSIHSENGSIFTLKPLDR (19aa)
- IISENKTDEEPGYIKK (16aa)
- LLLPAKNTTHLK (12aa)
- VPGNVTAVIGETIK (14aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- NVTIMANLK (9aa)
- ANEYPNITR (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- GAPGINGTK (9aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- LYQDVNCT (8aa)
- NNSYECDIPI (10aa)
- YSNNSIAIPT (10aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- NVTAQICIDK (10aa)
- NATLAEQAK (9aa)
- AEPPINASASDQGEK (15aa)
- NLSMTITR (8aa)
- VPAQEKNF (8aa)
- KNFTTAPAICHDGK (14aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
- GINAS (5aa)
- NISQDLEK (8aa)
- NLQVYNATSNSLTVK (15aa)
Source
Suggested structure
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 1666.5605)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1666.5605)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
