Hex:3 HexNAc:5 dHex:1

Taxonomy

• Homo sapiens (Human)
• Bos taurus (Bovine)
• Mesocricetus auratus (Golden hamster)
• Mus musculus (House mouse)
• Oryctolagus cuniculus (Rabbit)
• Rattus norvegicus (Norway rat)
• Sus scrofa (Pig)
• Coturnix coturnix japonica (Japanese quail)
• Gallus gallus (Chicken)
• Dasyatis sabina (Atlantic stingray)
• Dirofilaria immitus (Canine heartworm nematode)
• Trichinella spiralis
• Bothrops moojeni (Brazilian lancehead)
• Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)

Protein

• A-kinase anchor protein 11 / Homo sapiens    Q9UKA4
• Adipocyte plasma membrane-associated protein / Homo sapiens    Q9HDC9
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens    P30533
• Asporin / Homo sapiens    Q9BXN1
• Biglycan / Homo sapiens    P21810
• Calumenin / Homo sapiens    O43852
• Calumenin, isoform CRA_a / Homo sapiens
• Carboxypeptidase D / Homo sapiens    O75976
• Ceramide synthase 2 / Homo sapiens    Q96G23
• Clusterin / Homo sapiens    P10909
• Collagen alpha-1(VI) chain / Homo sapiens    P12109
• Collagen alpha-1(XII) chain / Homo sapiens    Q99715
• Corticosteroid-binding globulin / Homo sapiens    P08185
• Decorin / Homo sapiens    P07585
• Desmoglein-2 / Homo sapiens    Q14126
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens    P04844
• Ephrin type-a receptor 2 / Homo sapiens    P29317
• Fibroblast growth factor receptor 2 / Homo sapiens    P21802
• Fibronectin / Homo sapiens    P02751
• Gamma-glutamyl hydrolase / Homo sapiens    Q92820
• Glandular kallikrein 1 / Homo sapiens    P06870
• Hypoxia up-regulated protein 1 / Homo sapiens    Q9Y4L1
• Immunoglobulin gamma / Homo sapiens    P01857    P01860    P01861    P01859
• Immunoglobulin heavy constant alpha 1 / Homo sapiens    P01876
• Immunoglobulin heavy constant alpha 2 / Homo sapiens    P01877
• Immunoglobulin heavy constant gamma 1 / Homo sapiens    P01857
• Immunoglobulin heavy constant gamma 2 / Homo sapiens    P01859
• Immunoglobulin heavy constant gamma 3 / Homo sapiens    P01860
• Immunoglobulin heavy constant gamma 4 / Homo sapiens    P01861
• Immunoglobulin heavy constant mu / Homo sapiens    P01871
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens    Q14624
• Lactotransferrin / Homo sapiens    P02788
• Laminin subunit gamma-1 / Homo sapiens    P11047
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens    Q14767
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens    P11279
• Major prion protein / Homo sapiens    P04156
• Metalloproteinase inhibitor 1 / Homo sapiens    P01033
• Mucin-2 / Homo sapiens    Q02817
• Neural cell adhesion molecule L1 / Homo sapiens    P32004
• Periostin / Homo sapiens    Q15063
• Polymeric immunoglobulin receptor / Homo sapiens    P01833
• Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens    P13674
• Prosaposin / Homo sapiens    P07602
• Prostaglandin-h2 d-isomerase / Homo sapiens    P41222
• Prostate-specific antigen (psa-1) / Homo sapiens    P07288
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens    Q9BYF1
• Reticulocalbin-1 / Homo sapiens    Q15293
• Reticulocalbin-3 / Homo sapiens    Q96D15
• Serotransferrin / Homo sapiens    P02787
• Serpin h1 / Homo sapiens    P50454
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens    O15389
• Solute carrier family 12 member 6 / Homo sapiens    Q9UHW9
• Thrombospondin-1 / Homo sapiens    P07996
• Thyroglobulin / Homo sapiens    P01266
• Tissue-type plasminogen activator / Homo sapiens    P00750
• Transmembrane protein 2 / Homo sapiens    Q9UHN6
• Uncharacterized protein from Meconium / Homo sapiens
• Uncharacterized protein from Serum / Homo sapiens
• Zinc-alpha-2-glycoprotein / Homo sapiens    P25311
• Acetylcholinesterase / Bos taurus    P23795
• Collagen alpha-1(IV) chain / Bos taurus    Q7SIB2
• Collagen alpha-2 (IV) chain / Bos taurus    Q7SIB3
• Corticotropin - lipotropin, npp peptide / Bos taurus    P01190
• Immunoglobulin gamma / Bos taurus
• Thyrotropin-aplha and beta chains / Bos taurus    P01217    P01223
• Uncharacterized protein from Zona Pellucida / Bos taurus
• Zona pellucida sperm-binding protein 2 / Bos taurus    Q9BH10
• Major prion protein / Mesocricetus auratus    P04273
• BTB/POZ domain-containing protein 17 / Mus musculus    Q9DB72
• Cadherin-9 / Mus musculus    P70407
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus    Q9Z218
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus    Q01097
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus    Q8BLQ9-2
• Neural cell adhesion molecule 2 / Mus musculus    O35136
• Neural cell adhesion molecule L1 / Mus musculus    P11627
• Neuronal pentraxin-1 / Mus musculus    Q62443
• Noelin / Mus musculus    O88998
• Phospholipase D3 / Mus musculus    O35405
• Plexin-B1 / Mus musculus    Q8CJH3
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus    P14094
• Tenascin-r / Mus musculus    Q8BYI9
• Tetraspanin-2 / Mus musculus    Q922J6
• Thy-1 membrane glycoprotein / Mus musculus    P01831
• Uncharacterized protein from Brainstem / Mus musculus
• Uncharacterized protein from Cerebellum / Mus musculus
• Uncharacterized protein from Telencephalon / Mus musculus
• Uncharacterized protein from Telencephalon / Mus musculus
• Zona pellucida sperm-binding protein matrix / Mus musculus    P10761    Q62005    P20239
• Immunoglobulin gamma / Oryctolagus cuniculus
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus    P98158
• Major seminal plasma glycoprotein psp-i / Sus scrofa    P35495
• Major seminal plasma glycoprotein psp-ii / Sus scrofa    P35496
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
• Uncharacterized protein from Epithelium of Stomach / Sus scrofa
• Immunoglobulin y / Coturnix coturnix japonica
• Immunoglobulin gamma / Gallus gallus
• Immunoglobulin y / Gallus gallus
• Uncharacterized protein from Fibroblast / Gallus gallus
• Relaxin-like protein agf / Dasyatis sabina    P81191
• Uncharacterized protein from Whole Organism / Dirofilaria immitus
• Tsl-1 antigens / Trichinella spiralis
• Uncharacterized protein from Whole Organism / Trichinella spiralis
• Batroxobin / Bothrops moojeni
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)    P0DTC2

Source

• Blood Plasma (UBERON_0001969)  
• Blood Serum (UBERON_0001977)  
• Bone Marrow (UBERON_0002371)  
• Brain (UBERON_0000955)  
• Brainstem (UBERON_0002298)  
• Cerebellum (UBERON_0002037)  
• Colonic Mucosa (UBERON_0000317)  
• Epithelium of Stomach (UBERON_0001276)  
• Glomerular Basement Membrane (UBERON_0005777)  
• Kidney (UBERON_0002113)   HEK293 (CVCL_0045)  
• Kidney (UBERON_0002113)   HEK293-EBNA (CVCL_6974)  
• Kidney (UBERON_0002113)   HEK293T (CVCL_0063)  
• Mammary Gland (UBERON_0001911)  
• Marshall's Gland (UBERON_0011149)  
• Meconium (UBERON_0007109)  
• Neurohypophysis (UBERON_0002198)  
• Ovary (UBERON_0000992)   CHO (CVCL_0213)  
• Ovary (UBERON_0000992)   CHO E1a (CVCL_VU65)  
• Pituitary Gland (UBERON_0000007)  
• Seminal Fluid (UBERON_0006530)  
• Skin of Body (UBERON_0002097)   HMCB (CVCL_3317)  
• Spleen (UBERON_0002106)  
• Telencephalon (UBERON_0001893)  
• Urine (UBERON_0001088)  
• Venom (UBERON_0007113)  
• Zona Pellucida (UBERON_0000086)  
• FreeStyle 293-F (CVCL_D603)  
• HEK293 (CVCL_0045)  
• Fibroblast (CL_0000057)  
• Cerebrospinal Fluid Secretion (GO_0033326)  
• Microsome (GO_0005792)  
• Yolk (GO_0060417)  

Reported structure

• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
• N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[HexNAc(b1-4)][Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc"
• N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-3)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
• N-Linked / Complex / Structure 1900
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
• N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
• N-Linked / Complex / HexNAc(b1-?)Man(a1-3)[HexNAc(b1-?)Man(a1-6)][HexNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
• N-Linked / Complex / Structure 2802
• N-Linked / Complex / Structure 2888
• N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)][HexNAc(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
• N-Linked / Undefined core / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)GlcNAc + " + 3x HexNAc + Fuc "
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
• O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
• O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)GalNAc

Composition

• Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )

Disease

• Arthritis, Rheumatoid (DOID:7148)
• Cancer, breast (DOID:1612)
• COVID-19 (DOID:0080600)
• Diverticulosis (DOID:7475)
• Gaucher Disease (DOID:1926)
• Melanoma (DOID:1909)
• Myeloma (DOID:0070004)
• Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
• Oral squamous cell carcinoma (DOID:0050866)
• Prostate cancer (DOID:10283)
• Scrapie (DOID:5434)
• Sjogren's Syndrome (DOID:12894)

Reference

• Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
• Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Unreviewed
• Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
• Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
• Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
• Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
• Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
• Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
• Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
• Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
• Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
• Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
• Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
• Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
• Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
• Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
• Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
• Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
• A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
• Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
• Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
• Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
• Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
• Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
• Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
• Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
• Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
• Identification of a glycosylated relaxin-like molecule from the male Atlantic stingray, Dasyatis sabina. (1997 - Bullesbach E, Schwabe C, Lacy E) / Status : Reviewed
• The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
• Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
• 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
• Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
• Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
• First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
• Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
• The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
• Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
• Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
• Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
• Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
• Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
• Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
• Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
• Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
• A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
• Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
• Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
• Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
• Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
• Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
• Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
• Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
• Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed

Reported glycosite

• A-kinase anchor protein 11 / Homo sapiens
  •        Asn-208
• Adipocyte plasma membrane-associated protein / Homo sapiens
  •        Asn-160
• Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
  •        Asn-268
• Asporin / Homo sapiens
  •        Asn-282
• Biglycan / Homo sapiens
  •        Asn-270
• Calumenin / Homo sapiens
  •        Asn-131
• Calumenin, isoform CRA_a / Homo sapiens
  •        Asn-131
• Carboxypeptidase D / Homo sapiens
  •        Asn-522
• Ceramide synthase 2 / Homo sapiens
  •        Asn-19
• Clusterin / Homo sapiens
  •        Asn-103
  •        Asn-354
  •        Asn-374
• Collagen alpha-1(VI) chain / Homo sapiens
  •        Asn-537
  •        Asn-804
• Collagen alpha-1(XII) chain / Homo sapiens
  •        Asn-1763
• Corticosteroid-binding globulin / Homo sapiens
  •        Asn-31
• Decorin / Homo sapiens
  •        Asn-211
  •        Asn-262
• Desmoglein-2 / Homo sapiens
  •        Asn-182
• Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
  •        Asn-106
• Ephrin type-a receptor 2 / Homo sapiens
  •        Asn-435
• Fibroblast growth factor receptor 2 / Homo sapiens
  •        Asn-83
• Fibronectin / Homo sapiens
  •        Asn-430
  •        Asn-528
• Gamma-glutamyl hydrolase / Homo sapiens
  •        Asn-203
• Glandular kallikrein 1 / Homo sapiens
  •        Undefined site
• Hypoxia up-regulated protein 1 / Homo sapiens
  •        Asn-869
  •        Asn-931
• Immunoglobulin gamma / Homo sapiens
  •        Undefined site
• Immunoglobulin heavy constant alpha 1 / Homo sapiens
  •        Asn-340
• Immunoglobulin heavy constant alpha 2 / Homo sapiens
  •        Asn-92
  •        Asn-205
• Immunoglobulin heavy constant gamma 1 / Homo sapiens
  •        Asn-180
• Immunoglobulin heavy constant gamma 2 / Homo sapiens
  •        Asn-176
• Immunoglobulin heavy constant gamma 3 / Homo sapiens
  •        Undefined site
  •        Asn-227
• Immunoglobulin heavy constant gamma 4 / Homo sapiens
  •        Asn-177
• Immunoglobulin heavy constant mu / Homo sapiens
  •        Asn-46
  •        Asn-209
• Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
  •        Asn-517
• Lactotransferrin / Homo sapiens
  •        Asn-156
  •        Asn-497
• Laminin subunit gamma-1 / Homo sapiens
  •        Asn-1241
• Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
  •        Asn-421
• Lysosome-associated membrane glycoprotein 1 / Homo sapiens
  •        Asn-249
• Major prion protein / Homo sapiens
  •        Asn-197
• Metalloproteinase inhibitor 1 / Homo sapiens
  •        Asn-53
  •        Asn-101
• Mucin-2 / Homo sapiens
  •        Undefined site
• Neural cell adhesion molecule L1 / Homo sapiens
  •        Asn-505
• Periostin / Homo sapiens
  •        Asn-599
• Polymeric immunoglobulin receptor / Homo sapiens
  •        Asn-469
• Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
  •        Asn-113
• Prosaposin / Homo sapiens
  •        Undefined site
• Prostaglandin-h2 d-isomerase / Homo sapiens
  •        Asn-51
  •        Asn-78
• Prostate-specific antigen (psa-1) / Homo sapiens
  •        Asn-69
• Recombinant mature angiotensin-converting enzyme 2 / Homo sapiens
  •        Undefined site
  •        Asn-322
  •        Asn-432
  •        Asn-690
• Reticulocalbin-1 / Homo sapiens
  •        Asn-53
• Reticulocalbin-3 / Homo sapiens
  •        Asn-140
• Serotransferrin / Homo sapiens
  •        Undefined site
• Serpin h1 / Homo sapiens
  •        Asn-120
  •        Asn-125
• Sialic acid-binding Ig-like lectin 5 / Homo sapiens
  •        Undefined site
• Solute carrier family 12 member 6 / Homo sapiens
  •        Asn-398
• Thrombospondin-1 / Homo sapiens
  •        Asn-360
• Thyroglobulin / Homo sapiens
  •        Asn-1365
• Tissue-type plasminogen activator / Homo sapiens
  •        Undefined site
• Transmembrane protein 2 / Homo sapiens
  •        Asn-1005
• Uncharacterized protein from Meconium / Homo sapiens
  •        Undefined site
• Uncharacterized protein from Serum / Homo sapiens
  •        Undefined site
• Zinc-alpha-2-glycoprotein / Homo sapiens
  •        Asn-128
• Acetylcholinesterase / Bos taurus
  •        Undefined site
• Collagen alpha-1(IV) chain / Bos taurus
  •        Undefined site
• Collagen alpha-2 (IV) chain / Bos taurus
  •        Undefined site
• Corticotropin - lipotropin, npp peptide / Bos taurus
  •        Asn-91
• Immunoglobulin gamma / Bos taurus
  •        Undefined site
• Thyrotropin-aplha and beta chains / Bos taurus
  •        Undefined site
• Uncharacterized protein from Zona Pellucida / Bos taurus
  •        Undefined site
• Zona pellucida sperm-binding protein 2 / Bos taurus
  •        Undefined site
• Major prion protein / Mesocricetus auratus
  •        Undefined site
• BTB/POZ domain-containing protein 17 / Mus musculus
  •        Asn-307
• Cadherin-9 / Mus musculus
  •        Asn-436
• Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
  •        Asn-113
• Glutamate receptor ionotropic, NMDA 2B / Mus musculus
  •        Asn-444
• Isoform 2 of Cell adhesion molecule 2 / Mus musculus
  •        Asn-220
• Neural cell adhesion molecule 2 / Mus musculus
  •        Asn-445
• Neural cell adhesion molecule L1 / Mus musculus
  •        Asn-246
  •        Asn-293
• Neuronal pentraxin-1 / Mus musculus
  •        Asn-193
• Noelin / Mus musculus
  •        Asn-473
• Phospholipase D3 / Mus musculus
  •        Asn-385
• Plexin-B1 / Mus musculus
  •        Asn-31
• Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
  •        Asn-158
• Tenascin-r / Mus musculus
  •        Undefined site
• Tetraspanin-2 / Mus musculus
  •        Asn-139
• Thy-1 membrane glycoprotein / Mus musculus
  •        Asn-94
• Uncharacterized protein from Brainstem / Mus musculus
  •        Undefined site
• Uncharacterized protein from Cerebellum / Mus musculus
  •        Undefined site
• Uncharacterized protein from Telencephalon / Mus musculus
  •        Undefined site
• Uncharacterized protein from Telencephalon / Mus musculus
  •        Undefined site
• Zona pellucida sperm-binding protein matrix / Mus musculus
  •        Undefined site
• Immunoglobulin gamma / Oryctolagus cuniculus
  •        Undefined site
• Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
  •        Undefined site
• Major seminal plasma glycoprotein psp-i / Sus scrofa
  •        Asn-71
• Major seminal plasma glycoprotein psp-ii / Sus scrofa
  •        Asn-119
• Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
  •        Undefined site
• Uncharacterized protein from Epithelium of Stomach / Sus scrofa
  •        Undefined site
• Immunoglobulin y / Coturnix coturnix japonica
  •        Undefined site
• Immunoglobulin gamma / Gallus gallus
  •        Undefined site
• Immunoglobulin y / Gallus gallus
  •        Undefined site
• Uncharacterized protein from Fibroblast / Gallus gallus
  •        Undefined site
• Relaxin-like protein agf / Dasyatis sabina
  •        Asn-37
• Uncharacterized protein from Whole Organism / Dirofilaria immitus
  •        Undefined site
• Tsl-1 antigens / Trichinella spiralis
  •        Undefined site
• Uncharacterized protein from Whole Organism / Trichinella spiralis
  •        Undefined site
• Batroxobin / Bothrops moojeni
  •        Undefined site
• Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-17
  •        Asn-61
  •        Asn-74
  •        Asn-122
  •        Asn-149
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-343
  •        Asn-602
  •        Asn-615
  •        Asn-657
  •        Asn-709
  •        Asn-801
  •        Asn-1074
  •        Asn-1098
  •        Asn-1135
  •        Asn-1174
• Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
  •        Asn-122
  •        Asn-165
  •        Asn-234
  •        Asn-282
  •        Asn-331
  •        Asn-657
  •        Asn-801
  •        Asn-1074

Mass spectrometry observed peptide

• QCVNLTTR (8aa)
  •    P0DTC2    Asn-17
• IWIPVNITWADIEDRDGR (18aa)
  •    Q96G23    Asn-19
• YVNMSNHHR (9aa)
  •    P08185    Asn-31
• SPLPAAFTANGTHLQHLAR (19aa)
  •    Q8CJH3    Asn-31
• NNSDISSTR (9aa)
  •    P01871    Asn-46
• VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
  •    Q15293    Asn-53
• WFSAGLASNSSWLR (14aa)
  •    P41222    Asn-51
• VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
  •    Q15293    Asn-53
• FSNVTWF (7aa)
  •    P0DTC2    Asn-61
• SVVAPATDGGLNLTSTFLR (19aa)
  •    P41222    Asn-78
• HAIHVSGTNGTKRF (14aa)
  •    P0DTC2    Asn-74
• FHAIHVSGTNGTKRF (15aa)
  •    P0DTC2    Asn-74
• DGVHLGPNNR (10aa)
  •    P21802    Asn-83
• HYTNSSQDVTVPCR (14aa)
  •    P01877    Asn-92
• HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
  •    P01877    Asn-92
• VLTLANFTTK (10aa)
  •    P01831    Asn-94
• ELPGVCNETMMALWEECKPCLK (22aa)
  •    P10909    Asn-103
• SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
  •    P04844    Asn-106
• DMSDGFISNITIQR (14aa)
  •    P13674    Asn-113
• NVETNNSTVLIEGKKIESLR (20aa)
  •    Q9Z218    Asn-113
• SISNSTAR (8aa)
  •    P50454    Asn-120
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIK (16aa)
  •    P0DTC2    Asn-122
• TQSLLIVNNATNVVIKVCE (19aa)
  •    P0DTC2    Asn-122
• FGCEIENNR (9aa)
  •    P25311    Asn-128
• NVTYGTYIDDPDPDDGFNYK (20aa)
• NVTYGTYIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• NATYGYVIDDPDPDDGFNYK (20aa)
  •    O43852    Asn-131
• ARGNGTLITFHSAFQCCGK (19aa)
  •    Q922J6    Asn-139
• NATYGHYAPGEEFHDVEDAETYKK (24aa)
  •    Q96D15    Asn-140
• YHKNNKSWMESEF (13aa)
  •    P0DTC2    Asn-149
• TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
  •    P02788    Asn-156
• FKLDWLGNCSGLNDDSYGYR (20aa)
  •    P14094    Asn-158
• AGPNGTIFVADAYK (14aa)
  •    Q9HDC9    Asn-160
• VYSSANNCTFEYVSQPFLMDLEGK (24aa)
  •    P0DTC2    Asn-165
• VYSSANNCTFE (11aa)
  •    P0DTC2    Asn-165
• TKPREEQFNSTFR (13aa)
  •    P01859    Asn-176
• EEQFNSTF (8aa)
  •    P01859    Asn-176
• EEQFNSTFR (9aa)
  •    P01859    Asn-176
• EEQFNSTYR (9aa)
  •    P01861    Asn-177
• EEQYNSTYR (9aa)
  •    P01857    Asn-180
• TKPREEQYNSTYR (13aa)
  •    P01857    Asn-180
• EEQYNSTY (8aa)
  •    P01857    Asn-180
• INATDADEPNTINSK (15aa)
  •    Q14126    Asn-182
• VNTLEEGKGGPKNDTEER (18aa)
  •    Q62443    Asn-193
• GENFTETDVK (10aa)
  •    P04156    Asn-197
• NFTMNEK (7aa)
  •    Q92820    Asn-203
• TPLTANITK (9aa)
  •    P01877    Asn-205
• NDGMNITVLR (10aa)
  •    Q9UKA4    Asn-208
• GITFQQNASSMCVPDQDTAIR (21aa)
  •    P01871    Asn-209
• IADTNITSIPQGIPPSITEIHIDGNK (26aa)
  •    P07585    Asn-211
• VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
  •    Q8BLQ9-2    Asn-220
• EEQYNSTFR (9aa)
  •    P01860    Asn-227
• GINIT (5aa)
  •    P0DTC2    Asn-234
• DLPQGFSALEPLVDLPIGINITR (23aa)
  •    P0DTC2    Asn-234
• LLFPTNSSSR (10aa)
  •    P11627    Asn-246
• KDNTTVTR (8aa)
  •    P11279    Asn-249
• IGISFNSISAVDNGSIANTPHIR (23aa)
  •    P07585    Asn-262
• VIDLWDLAQSANLTDK (16aa)
  •    P30533    Asn-268
• MIENGSISFIPTIR (14aa)
  •    P21810    Asn-270
• ITDIENGSIANIPR (14aa)
  •    Q9BXN1    Asn-282
• KYNENGTIT (9aa)
  •    P0DTC2    Asn-282
• FLLKYNENGTIT (12aa)
  •    P0DTC2    Asn-282
• YNENGTITDAVDCALDPLSETK (22aa)
  •    P0DTC2    Asn-282
• NGTITDAVDCALDPLSE (17aa)
  •    P0DTC2    Asn-282
• VIYQNHNK (8aa)
  •    P11627    Asn-293
• FFHVNGSAFLPR (12aa)
  •    Q9DB72    Asn-307
• VSVGLPNMTQGF (12aa)
  •    Q9BYF1    Asn-322
• VSVGLPNMTQG (11aa)
  •    Q9BYF1    Asn-322
• NMTQGFWENSMLTDPGNVQK (20aa)
  •    Q9BYF1    Asn-322
• VSVGLPNMTQGFW (13aa)
  •    Q9BYF1    Asn-322
• RFPNIT (6aa)
  •    P0DTC2    Asn-331
• FPNITNLCPFGE (12aa)
  •    P0DTC2    Asn-331
• LAGKPTHVNVSVVMAEVDGTC (21aa)
  •    P01876    Asn-340
• LAGKPTHVNVSVVM (14aa)
  •    P01876    Asn-340
• IAGKPTHVNVSVVMAEVDGTCY (22aa)
  •    P01876    Asn-340
• GEVFNATRF (9aa)
  •    P0DTC2    Asn-343
• NATRF (5aa)
  •    P0DTC2    Asn-343
• MINTSSIIEQINEQFNWVSR (20aa)
  •    P10909    Asn-354
• VSCPIMPCSNATVPDGECCPR (21aa)
  •    P07996    Asn-360
• IANITQGEDQYYIR (14aa)
  •    P10909    Asn-374
• SFLLSLAALHDNHTHSDIQVK (21aa)
  •    O35405    Asn-385
• NMTVPSK (7aa)
  •    Q9UHW9    Asn-398
• DECWCPANSTGK (12aa)
  •    Q14767    Asn-421
• NYTDCTSEGR (10aa)
  •    P02751    Asn-430
• LSPDFQEDNETEINF (15aa)
  •    Q9BYF1    Asn-432
• SIGLLSPDFQEDNETEINF (19aa)
  •    Q9BYF1    Asn-432
• VSINQTEPPK (10aa)
  •    P29317    Asn-435
• VFSIHSENGSIFTLKPLDR (19aa)
  •    P70407    Asn-436
• IISENKTDEEPGYIKK (16aa)
  •    Q01097    Asn-444
• LLLPAKNTTHLK (12aa)
  •    O35136    Asn-445
• VPGNVTAVIGETIK (14aa)
  •    P01833    Asn-469
• ALYAWNNGHQTLYNVTLFHVIR (22aa)
  •    O88998    Asn-473
• TAGWNIPMGIIFNQTGSCK (19aa)
  •    P02788    Asn-497
• NVTIMANLK (9aa)
  •    P32004    Asn-505
• ANEYPNITR (9aa)
  •    O75976    Asn-522
• DQCIVDDITYNVNDTFHK (18aa)
  •    P02751    Asn-528
• GAPGINGTK (9aa)
  •    P12109    Asn-537
• EVNDTLLVNELK (12aa)
  •    Q15063    Asn-599
• GGVSVITPGTNTSNQVAVLY (20aa)
  •    P0DTC2    Asn-602
• LYQDVNCT (8aa)
  •    P0DTC2    Asn-615
• NNSYECDIPI (10aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPR (36aa)
  •    P0DTC2    Asn-657
• AGCLIGAEHVNNSYE (15aa)
  •    P0DTC2    Asn-657
• HVNNSYE (7aa)
  •    P0DTC2    Asn-657
• NVSDIIPR (8aa)
  •    Q9BYF1    Asn-690
• YSNNSIAIPT (10aa)
  •    P0DTC2    Asn-709
• FGGFNFS (7aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSK (24aa)
  •    P0DTC2    Asn-801
• TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
  •    P0DTC2    Asn-801
• NVTAQICIDK (10aa)
  •    P12109    Asn-804
• NATLAEQAK (9aa)
  •    Q9Y4L1    Asn-869
• AEPPINASASDQGEK (15aa)
  •    Q9Y4L1    Asn-931
• NLSMTITR (8aa)
  •    Q9UHN6    Asn-1005
• VPAQEKNF (8aa)
  •    P0DTC2    Asn-1074
• KNFTTAPAICHDGK (14aa)
  •    P0DTC2    Asn-1074
• NGTHWFV (7aa)
  •    P0DTC2    Asn-1098
• NGTHWFVT (8aa)
  •    P0DTC2    Asn-1098
• IGIVNNT (7aa)
  •    P0DTC2    Asn-1135
• GINASVV (7aa)
  •    P0DTC2    Asn-1174
• GINAS (5aa)
  •    P0DTC2    Asn-1174
• NISQDLEK (8aa)
  •    P11047    Asn-1241
• NLQVYNATSNSLTVK (15aa)
  •    Q99715    Asn-1763