GlyConnect

taxonomy (13) protein (103) source (30) structure (23) composition (1) disease (10) reference (48) site (117) peptide (77)

Taxonomy

Protein

Source

Reported structure

Composition

Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )

Disease

Reference

Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
Identification of a glycosylated relaxin-like molecule from the male Atlantic stingray, Dasyatis sabina. (1997 - Bullesbach E, Schwabe C, Lacy E) / Status : Reviewed
The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed

Reported glycosite

A-kinase anchor protein 11 / Homo sapiens
- Asn-208
Adipocyte plasma membrane-associated protein / Homo sapiens
- Asn-160
Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Asn-268
Asporin / Homo sapiens
- Asn-282
Biglycan / Homo sapiens
- Asn-270
Calumenin / Homo sapiens
- Asn-131
Calumenin, isoform CRA_a / Homo sapiens
- Asn-131
Carboxypeptidase D / Homo sapiens
- Asn-522
Ceramide synthase 2 / Homo sapiens
- Asn-19
Clusterin / Homo sapiens
- Asn-103
- Asn-354
- Asn-374
Collagen alpha-1(VI) chain / Homo sapiens
- Asn-537
- Asn-804
Collagen alpha-1(XII) chain / Homo sapiens
- Asn-1763
Corticosteroid-binding globulin / Homo sapiens
- Asn-31
Decorin / Homo sapiens
- Asn-211
- Asn-262
Desmoglein-2 / Homo sapiens
- Asn-182
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Asn-106
Ephrin type-a receptor 2 / Homo sapiens
- Asn-435
Fibroblast growth factor receptor 2 / Homo sapiens
- Asn-83
Fibronectin / Homo sapiens
- Asn-430
- Asn-528
Gamma-glutamyl hydrolase / Homo sapiens
- Asn-203
Glandular kallikrein 1 / Homo sapiens
- Undefined site
Hypoxia up-regulated protein 1 / Homo sapiens
- Asn-869
- Asn-931
Immunoglobulin gamma / Homo sapiens
- Undefined site
Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Asn-340
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Asn-92
- Asn-205
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Asn-180
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Asn-176
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Asn-177
Immunoglobulin heavy constant mu / Homo sapiens
- Asn-46
- Asn-209
Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Asn-517
Lactotransferrin / Homo sapiens
- Asn-156
- Asn-497
Laminin subunit gamma-1 / Homo sapiens
- Asn-1241
Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Asn-421
Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Asn-249
Major prion protein / Homo sapiens
- Asn-197
Metalloproteinase inhibitor 1 / Homo sapiens
- Asn-53
- Asn-101
Mucin - species IV / Homo sapiens
- Undefined site
Mucin - species V / Homo sapiens
- Undefined site
Neural cell adhesion molecule L1 / Homo sapiens
- Asn-505
Periostin / Homo sapiens
- Asn-599
Polymeric immunoglobulin receptor / Homo sapiens
- Asn-469
Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Asn-113
Prosaposin / Homo sapiens
- Undefined site
Prostaglandin-h2 d-isomerase / Homo sapiens
- Asn-51
- Asn-78
Prostate-specific antigen (psa-1) / Homo sapiens
- Asn-69
Reticulocalbin-1 / Homo sapiens
- Asn-53
Reticulocalbin-3 / Homo sapiens
- Asn-140
Serotransferrin / Homo sapiens
- Undefined site
Serpin h1 / Homo sapiens
- Asn-120
- Asn-125
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
Solute carrier family 12 member 6 / Homo sapiens
- Asn-398
Thrombospondin-1 / Homo sapiens
- Asn-360
Thyroglobulin / Homo sapiens
- Asn-1365
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
Transmembrane protein 2 / Homo sapiens
- Asn-1005
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
Uncharacterized protein from Serum / Homo sapiens
- Undefined site
Zinc-alpha-2-glycoprotein / Homo sapiens
- Asn-128
Acetylcholinesterase / Bos taurus
- Undefined site
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
Corticotropin - lipotropin, npp peptide / Bos taurus
- Asn-91
Immunoglobulin gamma / Bos taurus
- Undefined site
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
Major prion protein / Mesocricetus auratus
- Undefined site
BTB/POZ domain-containing protein 17 / Mus musculus
- Asn-307
Cadherin-9 / Mus musculus
- Asn-436
Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Asn-113
Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Asn-444
Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Asn-220
Neural cell adhesion molecule 2 / Mus musculus
- Asn-445
Neural cell adhesion molecule L1 / Mus musculus
- Asn-246
- Asn-293
Neuronal pentraxin-1 / Mus musculus
- Asn-193
Noelin / Mus musculus
- Asn-473
Phospholipase D3 / Mus musculus
- Asn-385
Plexin-B1 / Mus musculus
- Asn-31
Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Asn-158
Tenascin-r / Mus musculus
- Undefined site
Tetraspanin-2 / Mus musculus
- Asn-139
Thy-1 membrane glycoprotein / Mus musculus
- Asn-94
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
Major seminal plasma glycoprotein psp-i / Sus scrofa
- Asn-71
Major seminal plasma glycoprotein psp-ii / Sus scrofa
- Asn-119
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
Immunoglobulin gamma / Gallus gallus
- Undefined site
Immunoglobulin y / Gallus gallus
- Undefined site
Uncharacterized protein from Fibroblast / Gallus gallus
- Undefined site
Relaxin-like protein agf / Dasyatis sabina
- Asn-37
Uncharacterized protein from Whole Organism / Dirofilaria immitus
- Undefined site
Tsl-1 antigens / Trichinella spiralis
- Undefined site
Uncharacterized protein from Whole Organism / Trichinella spiralis
- Undefined site
Batroxobin / Bothrops moojeni
- Undefined site

Mass spectrometry observed peptide

IWIPVNITWADIEDRDGR (18aa)
- Q96G23 Asn-19
YVNMSNHHR (9aa)
- P08185 Asn-31
SPLPAAFTANGTHLQHLAR (19aa)
- Q8CJH3 Asn-31
NNSDISSTR (9aa)
- P01871 Asn-46
VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- Q15293 Asn-53
WFSAGLASNSSWLR (14aa)
- P41222 Asn-51
VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- Q15293 Asn-53
SVVAPATDGGLNLTSTFLR (19aa)
- P41222 Asn-78
DGVHLGPNNR (10aa)
- P21802 Asn-83
HYTNSSQDVTVPCR (14aa)
- P01877 Asn-92
HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- P01877 Asn-92
VLTLANFTTK (10aa)
- P01831 Asn-94
ELPGVCNETMMALWEECKPCLK (22aa)
- P10909 Asn-103
SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- P04844 Asn-106
DMSDGFISNITIQR (14aa)
- P13674 Asn-113
NVETNNSTVLIEGKKIESLR (20aa)
- Q9Z218 Asn-113
SISNSTAR (8aa)
- P50454 Asn-120
FGCEIENNR (9aa)
- P25311 Asn-128
NVTYGTYIDDPDPDDGFNYK (20aa)
NVTYGTYIDDPDPDDGFNYK (20aa)
- O43852 Asn-131
NATYGYVIDDPDPDDGFNYK (20aa)
- O43852 Asn-131
ARGNGTLITFHSAFQCCGK (19aa)
- Q922J6 Asn-139
NATYGHYAPGEEFHDVEDAETYKK (24aa)
- Q96D15 Asn-140
TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- P02788 Asn-156
FKLDWLGNCSGLNDDSYGYR (20aa)
- P14094 Asn-158
AGPNGTIFVADAYK (14aa)
- Q9HDC9 Asn-160
TKPREEQFNSTFR (13aa)
- P01859 Asn-176
EEQFNSTFR (9aa)
- P01859 Asn-176
EEQFNSTF (8aa)
- P01859 Asn-176
EEQFNSTYR (9aa)
- P01861 Asn-177
EEQYNSTYR (9aa)
- P01857 Asn-180
EEQYNSTY (8aa)
- P01857 Asn-180
INATDADEPNTINSK (15aa)
- Q14126 Asn-182
VNTLEEGKGGPKNDTEER (18aa)
- Q62443 Asn-193
GENFTETDVK (10aa)
- P04156 Asn-197
NFTMNEK (7aa)
- Q92820 Asn-203
TPLTANITK (9aa)
- P01877 Asn-205
NDGMNITVLR (10aa)
- Q9UKA4 Asn-208
GITFQQNASSMCVPDQDTAIR (21aa)
- P01871 Asn-209
IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- P07585 Asn-211
VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
- Q8BLQ9-2 Asn-220
EEQYNSTFR (9aa)
- P01860 Asn-227
LLFPTNSSSR (10aa)
- P11627 Asn-246
KDNTTVTR (8aa)
- P11279 Asn-249
IGISFNSISAVDNGSIANTPHIR (23aa)
- P07585 Asn-262
VIDLWDLAQSANLTDK (16aa)
- P30533 Asn-268
MIENGSISFIPTIR (14aa)
- P21810 Asn-270
ITDIENGSIANIPR (14aa)
- Q9BXN1 Asn-282
VIYQNHNK (8aa)
- P11627 Asn-293
FFHVNGSAFLPR (12aa)
- Q9DB72 Asn-307
LAGKPTHVNVSVVMAEVDGTC (21aa)
- P01876 Asn-340
LAGKPTHVNVSVVM (14aa)
- P01876 Asn-340
IAGKPTHVNVSVVMAEVDGTCY (22aa)
- P01876 Asn-340
MINTSSIIEQINEQFNWVSR (20aa)
- P10909 Asn-354
VSCPIMPCSNATVPDGECCPR (21aa)
- P07996 Asn-360
IANITQGEDQYYIR (14aa)
- P10909 Asn-374
SFLLSLAALHDNHTHSDIQVK (21aa)
- O35405 Asn-385
NMTVPSK (7aa)
- Q9UHW9 Asn-398
DECWCPANSTGK (12aa)
- Q14767 Asn-421
NYTDCTSEGR (10aa)
- P02751 Asn-430
VSINQTEPPK (10aa)
- P29317 Asn-435
VFSIHSENGSIFTLKPLDR (19aa)
- P70407 Asn-436
IISENKTDEEPGYIKK (16aa)
- Q01097 Asn-444
LLLPAKNTTHLK (12aa)
- O35136 Asn-445
VPGNVTAVIGETIK (14aa)
- P01833 Asn-469
ALYAWNNGHQTLYNVTLFHVIR (22aa)
- O88998 Asn-473
TAGWNIPMGIIFNQTGSCK (19aa)
- P02788 Asn-497
NVTIMANLK (9aa)
- P32004 Asn-505
ANEYPNITR (9aa)
- O75976 Asn-522
DQCIVDDITYNVNDTFHK (18aa)
- P02751 Asn-528
GAPGINGTK (9aa)
- P12109 Asn-537
EVNDTLLVNELK (12aa)
- Q15063 Asn-599
NVTAQICIDK (10aa)
- P12109 Asn-804
NATLAEQAK (9aa)
- Q9Y4L1 Asn-869
AEPPINASASDQGEK (15aa)
- Q9Y4L1 Asn-931
NLSMTITR (8aa)
- Q9UHN6 Asn-1005
NISQDLEK (8aa)
- P11047 Asn-1241
NLQVYNATSNSLTVK (15aa)
- Q99715 Asn-1763

- O-Linked / Core 3 (avg mass : 1666.5605)
- O-Linked / Core 2 (avg mass : 1666.5605)
- O-Linked / Core 2 (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)
- N-Linked / Complex (avg mass : 1666.5605)

- Hex:3 HexNAc:5 dHex:1 / N-Linked (avg mass : 1666.5605)