taxonomy (18)
protein (134)
source (43)
structure (31)
composition (1)
disease (20)
reference (77)
site (182)
peptide (126)
- Homo sapiens (Human)
- Bos taurus (Bovine)
- Canis lupus familiaris (Dog)
- Felis catus (Cat)
- Mesocricetus auratus (Golden hamster)
- Mus musculus (House mouse)
- Oryctolagus cuniculus (Rabbit)
- Ovis aries (Sheep)
- Rattus norvegicus (Norway rat)
- Sus scrofa (Pig)
- Coturnix coturnix japonica (Japanese quail)
- Gallus gallus (Chicken)
- Dasyatis sabina (Atlantic stingray)
- Dirofilaria immitus (Canine heartworm nematode)
- Trichinella spiralis
- Drosophila melanogaster (Fruit fly)
- Bothrops moojeni (Brazilian lancehead)
- Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Taxonomy
- A-kinase anchor protein 11 / Homo sapiens Q9UKA4
- Adipocyte plasma membrane-associated protein / Homo sapiens Q9HDC9
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens P30533
- Angiotensin-converting enzyme 2 / Homo sapiens Q9BYF1
- Asporin / Homo sapiens Q9BXN1
- Biglycan / Homo sapiens P21810
- Calumenin / Homo sapiens O43852
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase D / Homo sapiens O75976
- Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens P06731
- Ceramide synthase 2 / Homo sapiens Q96G23
- Clusterin / Homo sapiens P10909
- Coagulation factor V / Homo sapiens P12259
- Collagen alpha-1(VI) chain / Homo sapiens P12109
- Collagen alpha-1(XII) chain / Homo sapiens Q99715
- Corticosteroid-binding globulin / Homo sapiens P08185
- Decorin / Homo sapiens P07585
- Desmoglein-2 / Homo sapiens Q14126
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens P04844
- Ephrin type-a receptor 2 / Homo sapiens P29317
- Fibroblast growth factor receptor 2 / Homo sapiens P21802
- Fibronectin / Homo sapiens P02751
- Gamma-glutamyl hydrolase / Homo sapiens Q92820
- Glandular kallikrein 1 / Homo sapiens P06870
- Hypoxia up-regulated protein 1 / Homo sapiens Q9Y4L1
- IgG1-NK08-V/F genotype / Homo sapiens P01857
- IgG1-NK09-V/F genotype / Homo sapiens P01857
- IgG1-NK11-F/F genotype / Homo sapiens P01857
- IgG1-NK12-V/F genotype / Homo sapiens P01857
- IgG1-NK13-V/F genotype / Homo sapiens P01857
- Immunoglobulin alpha (non secretory) / Homo sapiens P01877 P01876
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens P0DOX2
- Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens P0DOX2
- Immunoglobulin epsilon chain c region / Homo sapiens P01854
- Immunoglobulin gamma / Homo sapiens P01859 P01861 P01860 P01857
- Immunoglobulin gamma-1 heavy chain / Homo sapiens P0DOX5
- Immunoglobulin heavy constant alpha 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens P01876
- Immunoglobulin heavy constant alpha 2 / Homo sapiens P01877
- Immunoglobulin heavy constant delta / Homo sapiens P01880
- Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens P01854
- Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens P01854
- Immunoglobulin heavy constant gamma 1 / Homo sapiens P01857
- Immunoglobulin heavy constant gamma 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens P01859
- Immunoglobulin heavy constant gamma 3 / Homo sapiens P01860
- Immunoglobulin heavy constant gamma 4 / Homo sapiens P01861
- Immunoglobulin heavy constant mu / Homo sapiens P01871
- Immunoglobulin J chain / Homo sapiens P01591
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens Q14624
- Lactotransferrin / Homo sapiens P02788
- Laminin subunit gamma-1 / Homo sapiens P11047
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens Q14767
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens P11279
- Major prion protein / Homo sapiens P04156
- Metalloproteinase inhibitor 1 / Homo sapiens P01033
- Mucin-2 / Homo sapiens Q02817
- Neural cell adhesion molecule L1 / Homo sapiens P32004
- Periostin / Homo sapiens Q15063
- Polymeric immunoglobulin receptor / Homo sapiens P01833
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens P13674
- Prosaposin / Homo sapiens P07602
- Prostaglandin-h2 d-isomerase / Homo sapiens P41222
- Prostate-specific antigen (psa-1) / Homo sapiens P07288
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens P07288
- Reticulocalbin-1 / Homo sapiens Q15293
- Reticulocalbin-3 / Homo sapiens Q96D15
- Serotransferrin / Homo sapiens P02787
- Serpin h1 / Homo sapiens P50454
- Sialic acid-binding Ig-like lectin 5 / Homo sapiens O15389
- Solute carrier family 12 member 6 / Homo sapiens Q9UHW9
- Thrombospondin-1 / Homo sapiens P07996
- Thyroglobulin / Homo sapiens P01266
- Tissue-type plasminogen activator / Homo sapiens P00750
- Transmembrane protein 2 / Homo sapiens Q9UHN6
- Uncharacterized protein from Blood Serum / Homo sapiens
- Uncharacterized protein from Meconium / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens P25311
- Acetylcholinesterase / Bos taurus P23795
- Collagen alpha-1(IV) chain / Bos taurus Q7SIB2
- Collagen alpha-2 (IV) chain / Bos taurus Q7SIB3
- Corticotropin - lipotropin, npp peptide / Bos taurus P01190
- Immunoglobulin gamma / Bos taurus
- Thyrotropin-aplha and beta chains / Bos taurus P01217 P01223
- Uncharacterized protein from Zona Pellucida / Bos taurus
- Zona pellucida sperm-binding protein 2 / Bos taurus Q9BH10
- Immunoglobulin gamma / Canis lupus familiaris
- Immunoglobulin gamma / Felis catus
- Major prion protein / Mesocricetus auratus P04273
- BTB/POZ domain-containing protein 17 / Mus musculus Q9DB72
- Cadherin-9 / Mus musculus P70407
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus Q9Z218
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus Q01097
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus Q8BLQ9-2
- Neural cell adhesion molecule 2 / Mus musculus O35136
- Neural cell adhesion molecule L1 / Mus musculus P11627
- Neuronal pentraxin-1 / Mus musculus Q62443
- Noelin / Mus musculus O88998
- Phospholipase D3 / Mus musculus O35405
- Plexin-B1 / Mus musculus Q8CJH3
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus P14094
- Tenascin-r / Mus musculus Q8BYI9
- Tetraspanin-2 / Mus musculus Q922J6
- Thy-1 membrane glycoprotein / Mus musculus P01831
- Uncharacterized protein from Brainstem / Mus musculus
- Uncharacterized protein from Cerebellum / Mus musculus
- Uncharacterized protein from Telencephalon / Mus musculus
- Uncharacterized protein from Telencephalon / Mus musculus
- Zona pellucida sperm-binding protein matrix / Mus musculus P20239 Q62005 P10761
- Immunoglobulin gamma / Oryctolagus cuniculus
- Immunoglobulin gamma / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries Q712V9
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries Q712V9
- Low density lipoprotein receptor-related protein 2 / Rattus norvegicus P98158
- Major seminal plasma glycoprotein psp-i / Sus scrofa P35495
- Major seminal plasma glycoprotein psp-ii / Sus scrofa P35496
- Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Immunoglobulin y / Coturnix coturnix japonica
- Immunoglobulin gamma / Gallus gallus
- Immunoglobulin y / Gallus gallus
- Uncharacterized protein / Gallus gallus
- Relaxin-like protein agf / Dasyatis sabina P81191
- Uncharacterized protein / Dirofilaria immitus
- Tsl-1 antigens / Trichinella spiralis
- Uncharacterized protein / Trichinella spiralis
- Batroxobin / Bothrops moojeni
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) P0DTC2
Protein
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Brainstem (UBERON_0002298)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Colonic Mucosa (UBERON_0000317)
- Colostrum (UBERON_0001914)
- Embryo (UBERON_0000922)
- Epithelium of Stomach (UBERON_0001276)
- Glomerular Basement Membrane (UBERON_0005777)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Kidney (UBERON_0002113) HEK293-EBNA (CVCL_6974)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- Mammary Gland (UBERON_0001911)
- Marshall's Gland (UBERON_0011149)
- Meconium (UBERON_0007109)
- Milk (UBERON_0001913)
- Neurohypophysis (UBERON_0002198)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
- Pituitary Gland (UBERON_0000007)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Spleen (UBERON_0002106)
- Telencephalon (UBERON_0001893)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Zona Pellucida (UBERON_0000086)
- CHO (CVCL_0213)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- HEK293T (CVCL_0063)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
Source
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[HexNAc(b1-4)][Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc"
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-3)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(b1-?)Man(a1-3)[HexNAc(b1-?)Man(a1-6)][HexNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
- N-Linked / Complex / Structure 2802
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / Structure 9460
- N-Linked / Complex / Structure 9566
- N-Linked / Complex / Structure 9792
- N-Linked / Complex / Structure 9951
- N-Linked / Complex / Structure 10064
- N-Linked / Complex / Structure 10244
- N-Linked / Complex / Structure 10627
- N-Linked / Hybrid / Structure 9595
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)][HexNAc(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-3)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-6)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 2 / Fuc(a1-2)Gal(b1-4)GlcNAc(b1-6)[GlcNAc(a1-4)Gal(b1-4)GlcNAc(b1-3)]Gal(b1-3)[GlcNAc(b1-6)]GalNAc
- O-Linked / Core 3 / Fuc(a1-2)[GalNAc(a1-3)]Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)Gal(b1-4)GlcNAc(b1-3)GalNAc
Reported structure
- Hex:3 HexNAc:5 dHex:1 (avg mass : 1666.5605 )
Composition
- Arthritis, Rheumatoid (DOID:7148)
- Asymptomatic myositis (DOID:633)
- Cancer, breast (DOID:1612)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Diverticulosis (DOID:7475)
- Gastritis (DOID:4029)
- Gaucher Disease (DOID:1926)
- Melanoma (DOID:1909)
- Mixed phenotype acute leukemia (DOID:9953)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Myositis (DOID:633)
- Oral squamous cell carcinoma (DOID:0050866)
- Prostate cancer (DOID:10283)
- Scrapie (DOID:5434)
- Sjogren's Syndrome (DOID:12894)
- Systemic lupus erythematosus (DOID:9074)
Disease
- High-throughput glycopeptide profiling of prostate-specific antigen from seminal plasma by MALDI-MS. (2021 - Wei Wang, Anna Kałuża, Jan Nouta, Simone Nicolardi, Mirosława Ferens-Sieczkowska, Manfred Wuhrer, Guinevere S M Lageveen-Kammeijer, Noortje de Haan) / Status : Reviewed
- Site-specific analysis of N-glycans from different sheep prion strains (2021 - Natali Nakić ,Thanh Hoa Tran ,Mislav Novokmet,Olivier Andreoletti,Gordan Lauc,Giuseppe Legname) / Status : Reviewed
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Glycoproteome remodeling in MLL-rearranged B-cell precursor acute lymphoblastic leukemia. (2021 - Oliveira T, Zhang M, Joo EJ, Abdel-Azim H, Chen CW, Yang L, Chou CH, Qin X, Chen J, Alagesan K, Almeida A, Jacob F, Packer NH, von Itzstein M, Heisterkamp N, Kolarich D) / Status : Reviewed
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
- Site-specific N-glycosylation Characterization of Recombinant SARS-CoV-2 Spike Proteins using High-Resolution Mass Spectrometry (2020 - Yong Zhang, Wanjun Zhao, Yonghong Mao, Shisheng Wang, Yi Zhong, Tao Su, Meng Gong, Xiaofeng Lu, Jingqiu Cheng, Hao Yang) / Status : Reviewed
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes (2020 - Jing Zhu, Yu-Hsien Lin, Kelly A Dingess, Marko Mank, Bernd Stahl, Albert J R Heck) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Tongue Cancer Patients Can be Distinguished from Healthy Controls by Specific N-Glycopeptides Found in Serum. (2018 - Mayank Saraswat, Antti Mäkitie, Tiialotta Tohmola, Amy Dickinson, Shruti Saraswat, Sakari Joenväärä, Suvi Renkonen) / Status : Reviewed
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- Dynamic Developmental Elaboration of N-Linked Glycan Complexity in the Drosophila melanogaster Embryo (2007 - Kazuhiro Aoki, Mindy Perlman, Jae-Min Lim, Rebecca Cantu, Lance Wells, Michael Tiemeyer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Extension of the in-gel release method for structural analysis of neutral and sialylated N-linked glycans to the analysis of sulfated glycans: application to the glycans from bovine thyroid-stimulating hormone (2001 - Wheeler, Harvey) / Status : Reviewed
- A comparative study of the asparagine-linked oligosaccharides on siglec-5, siglec-7 and siglec-8, expressed in a CHO cell line, and their contribution to ligand recognition (2001 - Freeman, Birrell, D Alessio, Erickson-Miller, Kikly, Camilleri) / Status : Reviewed
- Hierarchy of post-translational modifications involved in the circulatory longevity of glycoproteins. Demonstration of concerted contributions of glycan sialylation and subunit assembly to the pharmacokinetic behavior of bovine acetylcholinesterase. (2000 - Kronman C, Chitlaru T, Elhanany E, Velan B, Shafferman A) / Status : Reviewed
- Phosphorylcholine-containing N-glycans of Trichinella spiralis: identification of multiantennary lacdiNAc structures. (2000 - Morelle W, Haslam S, Olivier V, Appleton J, Morris H, Dell A) / Status : Reviewed
- Characterization of the N-linked glycans of adult Trichinella spiralis. (2000 - Morelle W, Haslam S, Morris H, Dell A) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Identification of a glycosylated relaxin-like molecule from the male Atlantic stingray, Dasyatis sabina. (1997 - Bullesbach E, Schwabe C, Lacy E) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Structural characterization of the N-linked carbohydrate chains of the zona pellucida glycoproteins from bovine ovarian and fertilized eggs. (1996 - Katsumata T, Noguchi S, Yonezawa N, Tanokura M, Nakano M) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- The Lewis x epitope is a major non-reducing structure in the sulphated N-glycans attached to Asn-65 of bovine pro-opiomelanocortin. (1993 - Siciliano R, Morris H, McDowell R, Azadi P, Rogers M, Bennett H, Dell A) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
- Characterization of the primary structure and the microheterogeneity of the carbohydrate chains of porcine blood-group H substance by 500-MHz 1H-NMR spectroscopy. (1982 - van Halbeek H, Dorland L, Vliegenthart J, Kochetkov N, Arbatsky N, Derevitskaya V) / Status : Reviewed
Reference
- A-kinase anchor protein 11 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase D / Homo sapiens
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Coagulation factor V / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Fibroblast growth factor receptor 2 / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
- Hypoxia up-regulated protein 1 / Homo sapiens
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Asn-227
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major prion protein / Homo sapiens
- Metalloproteinase inhibitor 1 / Homo sapiens
-
Mucin-2 / Homo sapiens
- Undefined site
- Neural cell adhesion molecule L1 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
-
Prosaposin / Homo sapiens
- Undefined site
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen (psa-1) / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
- Serpin h1 / Homo sapiens
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
- Solute carrier family 12 member 6 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Transmembrane protein 2 / Homo sapiens
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
- Zinc-alpha-2-glycoprotein / Homo sapiens
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Major prion protein / Mesocricetus auratus
- Undefined site
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-9 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Noelin / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-B1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
-
Tenascin-r / Mus musculus
- Undefined site
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
-
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
-
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
- Relaxin-like protein agf / Dasyatis sabina
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
Batroxobin / Bothrops moojeni
- Undefined site
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
Reported glycosite
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- YVNMSNHHR (9aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- KNNSDISSTRGFPSVLRGGKY (21aa)
- NNSDISSTR (9aa)
- WFSAGLASNSSWLR (14aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- FSNVTWF (7aa)
- NKSVLLGR (8aa)
- NK (2aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DGVHLGPNNR (10aa)
- HYTNSSQDVTVPCR (14aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- VLTLANFTTK (10aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- DMSDGFISNITIQR (14aa)
- NVETNNSTVLIEGKKIESLR (20aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- YHKNNKSWMESEF (13aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- FKLDWLGNCSGLNDDSYGYR (20aa)
- AGPNGTIFVADAYK (14aa)
- VYSSANNCTFE (11aa)
- TKPREEQFNSTFR (13aa)
- REEQFNSTFRV (11aa)
- EEQFNSTF (8aa)
- EEQFNSTFR (9aa)
- KTKPREEQFNSTFRV (15aa)
- EEQFNSTYR (9aa)
- EEQYNSTYR (9aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
- EEQYNSTY (8aa)
- KTKPREEQYNSTYRV (15aa)
- EEQYNSTYR (10aa)
- INATDADEPNTINSK (15aa)
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
- VNTLEEGKGGPKNDTEER (18aa)
- GENFTETDVK (10aa)
- NFTMNEK (7aa)
- TPLTANITK (9aa)
- NDGMNITVLR (10aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
- EEQYNSTFR (9aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- NGTITDAVDCALDPLSE (17aa)
- VIYQNHNK (8aa)
- FFHVNGSAFLPR (12aa)
- FPNIT (5aa)
- RFPNIT (6aa)
- FPNITNLCPFGE (12aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVM (14aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
- GEVFNATRF (9aa)
- VFNATR (6aa)
- GEVFNATR (8aa)
- NATRF (5aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- NMTVPSK (7aa)
- DECWCPANSTGK (12aa)
- NYTDCTSEGR (10aa)
- VSINQTEPPK (10aa)
- VFSIHSENGSIFTLKPLDR (19aa)
- IISENKTDEEPGYIKK (16aa)
- LLLPAKNTTHLK (12aa)
- VPGNVTAVIGETIK (14aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- NVTIMANLK (9aa)
- ANEYPNITR (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- GAPGINGTK (9aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- LYQDVNCT (8aa)
- NNSYECDIPI (10aa)
- YSNNSIAIPT (10aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- NVTAQICIDK (10aa)
- NATLAEQAK (9aa)
- AEPPINASASDQGEK (15aa)
- NLSMTITR (8aa)
- VPAQEKNF (8aa)
- KNFTTAPAICHDGK (14aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
- GINAS (5aa)
- NISQDLEK (8aa)
- NLQVYNATSNSLTVK (15aa)
Mass spectrometry observed peptide
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Pituitary Gland (UBERON_0000007)
-
Thyrotropin-aplha and beta chains / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Acetylcholinesterase / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Venom (UBERON_0007113)
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Melanoma (DOID:1909)
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Neurohypophysis (UBERON_0002198)
- Corticotropin - lipotropin, npp peptide / Bos taurus
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Ovary (UBERON_0000992) CHO E1a (CVCL_VU65)
-
Sialic acid-binding Ig-like lectin 5 / Homo sapiens
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Spleen (UBERON_0002106)
- Zona Pellucida (UBERON_0000086)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- Gaucher Disease (DOID:1926)
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Localization of N-linked carbohydrate chains in glycoprotein ZPA of the bovine egg zona pellucida. (2002 - Ikeda K, Yonezawa N, Naoi K, Katsumata T, Hamano S, Nakano M) / Status : Reviewed
- Structural study of the oligosaccharide moieties of sphingolipid activator proteins, saposins A, C and D obtained from the spleen of a Gaucher patient. (1993 - Ito K, Takahashi N, Takahashi A, Shimada I, Arata Y, O'Brien J, Kishimoto Y) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
-
Prosaposin / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein 2 / Bos taurus
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Embryo (UBERON_0000922)
- Zona Pellucida (UBERON_0000086)
- HEK293 (CVCL_0045)
- Adipose-derived stem cells (ADSCs) (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Fibroblast (CL_0000057)
- COVID-19 (DOID:0080600)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- Glycomic studies of Drosophila melanogaster embryos. (2006 - Simon J North, Kate Koles, Caleb Hembd, Howard R Morris, Anne Dell, Vladislav M Panin, Stuart M Haslam) / Status : Reviewed
- Neutral oligosaccharide structures linked to asparagines of porcine zona pellucida glycoproteins. (1991 - Mori E, Takasaki S, Hedrick J, Wardrip N, Mori T, Kobata A) / Status : Reviewed
- Increased UDP-GlcNAc: alpha-mannoside beta(1----4) N-acetylglucosaminyltransferase activity during chick embryo development. (1990 - Ogier-Denis E, Bauvy C, Moutsita R, Aubery M, Codogno P) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Uncharacterized porcine zona pellucida glycoprotein / Sus scrofa
- Undefined site
-
Uncharacterized protein / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Ovary (UBERON_0000992) CHO (CVCL_0213)
- Site-specific characterization of glycoprotein carbohydrates by exoglycosidase digestion and laser desorption mass spectrometry. (1994 - Sutton C, O'Neill J, Cottrell J) / Status : Reviewed
- Characterization of the N-linked oligosaccharides in glycoproteins synthesized by microfilariae of Dirofilaria immitis. (1993 - Kang S, Cummings RD, McCall JW) / Status : Reviewed
- Metalloproteinase inhibitor 1 / Homo sapiens
-
Uncharacterized protein / Dirofilaria immitus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Bone Marrow (UBERON_0002371)
- Brain (UBERON_0000955)
- Brainstem (UBERON_0002298)
- Cerebellum (UBERON_0002037)
- Colon (UBERON_0001155)
- Glomerular Basement Membrane (UBERON_0005777)
- Meconium (UBERON_0007109)
- Telencephalon (UBERON_0001893)
- HEK293 (CVCL_0045)
- LS174T (CVCL_1384)
- Adipocytes (CL_0000136)
- Differentiated Adipose-derived stem cells (dADSCs) (CL_0000136)
- Cerebrospinal Fluid Secretion (GO_0033326)
- Microsome (GO_0005792)
- Yolk (GO_0060417)
- Arthritis, Rheumatoid (DOID:7148)
- Colon adenocarcinoma (DOID:234)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Multiple myeloma (DOID:9538)
- Myeloma (DOID:0070004)
- Myeloma, Multiple with an accompanying Hypogammaglobulinaemia
- Scrapie (DOID:5434)
- Sjogren's Syndrome (DOID:12894)
- Carcinoembryonic antigen glycosylation (2021 - Kolarich D) / Status : Reviewed
- Toward robust N-glycomics of various tissue samples that may contain glycans with unknown or unexpected structures. (2021 - Suzuki N, Abe T, Hanzawa K, Natsuka S) / Status : Reviewed
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Bisecting GlcNAc Protein N-Glycosylation Is Characteristic of Human Adipogenesis. (2020 - Katherine Wongtrakul-Kish, Benjamin R Herbert, Nicolle H Packer) / Status : Reviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Comparison of separation techniques for the elucidation of IgG N-glycans pooled from healthy mammalian species (2014 - Barbara Adamczyk, Tharmala Tharmalingam-Jaikaran, Michael Schomberg, Ákos Szekrényes, Ronan M.Kelly, Niclas G.Karlsson, Andràs Guttman, Pauline M.Rudd) / Status : Reviewed
- Site-specific N-glycosylation of chicken serum IgG. (2004 - Suzuki N, Lee YC) / Status : Reviewed
- Structural studies on IgG oligosaccharides of patients with primary Sjogren's syndrome. (2002 - Kuroda Y, Nakata M, Makino A, Matsumoto A, Ohashi K, Itahashi K, Takeuchi F, Goto M, Kojima N, Mizuochi T) / Status : Reviewed
- Characterization of the N-linked oligosaccharides of megalin (gp330) from rat kidney. (2000 - Morelle W, Haslam S, Ziak M, Roth J, Morris H, Dell A) / Status : Reviewed
- Glycosylation of a CNS-specific extracellular matrix glycoprotein, tenascin-R, is dominated by O-linked sialylated glycans and "brain-type" neutral N-glycans. (1999 - Zamze S, Harvey D, Pesheva P, Mattu T, Schachner M, Dwek R, Wing D) / Status : Reviewed
- Identification of neutral and sialyl N-linked oligosaccharide structures from human serum glycoproteins using three kinds of high-performance liquid chromatography. (1995 - Nakagawa H, Kawamura Y, Kato K, Shimada I, Arata Y, Takahashi N) / Status : Reviewed
- First evidence of human meconium glycoasparagines. (1995 - Cuvillier O, Alonso C, Wieruszeski J, Brassart C, Strecker G, Bouquelet S, Michalski J) / Status : Reviewed
- 'Brain-type' N-glycosylation of asialo-transferrin from human cerebrospinal fluid. (1995 - Hoffmann A, Nimtz M, Getzlaff R, Conradt H) / Status : Reviewed
- Structures of N-linked sugar chains expressed mainly in mouse brain. (1993 - Shimizu H, Ochiai K, Ikenaka K, Mikoshiba K, Hase S) / Status : Reviewed
- Structures of asparagine linked oligosaccharides of immunoglobulins (IgY) isolated from egg-yolk of Japanese quail. (1993 - Matsuura F, Ohta M, Murakami K, Matsuki Y) / Status : Reviewed
- Structures of asparagine-linked oligosaccharides from hen egg-yolk antibody (IgY). Occurrence of unusual glucosylated oligo-mannose type oligosaccharides in a mature glycoprotein. (1991 - Ohta M, Hamako J, Yamamoto S, Hatta H, Kim M, Yamamoto T, Oka S, Mizuochi T, Matsuura F) / Status : Reviewed
- Bovine glomerular basement membrane. Location and structure of the asparagine-linked oligosaccharide units and their potential role in the assembly of the 7 S collagen IV tetramer. (1991 - Langeveld J, Noelken M, Hrd K, Todd P, Vliegenthart J, Rouse J, Hudson B) / Status : Reviewed
- Structural heterogeneity of sugar chains in immunoglobulin G. Conformation of immunoglobulin G molecule and substrate specificities of glycosyltransferases. (1990 - Fujii S, Nishiura T, Nishikawa A, Miura R, Taniguchi N) / Status : Reviewed
- A comparative study of the N-linked oligosaccharide structures of human IgG subclass proteins. (1990 - Jefferis R, Lund J, Mizutani H, Nakagawa H, Kawazoe Y, Arata Y, Takahashi N) / Status : Reviewed
- Diversity of oligosaccharide structures linked to asparagines of the scrapie prion protein. (1989 - Endo T, Groth D, Prusiner SB, Kobata A) / Status : Reviewed
- Structural analysis of N-linked oligosaccharides by a combination of glycopeptidase, exoglycosidases, and high-performance liquid chromatography. (1987 - Tomiya N, Kurono M, Ishihara H, Tejima S, Endo S, Arata Y, Takahashi N) / Status : Reviewed
- Comparative structural study of the N-linked oligosaccharides of human normal and pathological immunoglobulin G. (1987 - Takahashi N, Ishii I, Ishihara H, Mori M, Tejima S, Jefferis R, Endo S, Arata Y) / Status : Reviewed
- Structures of the sugar chains of rabbit immunoglobulin G: occurrence of asparagine-linked sugar chains in Fab fragment. (1985 - Taniguchi T, Mizuochi T, Beale M, Dwek R, Rademacher T, Kobata A) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Carcinoembryonic antigen-related cell adhesion molecule 5 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin alpha-2 heavy chain (secretory) - heavy chain 3 / Homo sapiens
- Undefined site
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
-
Immunoglobulin gamma-1 heavy chain / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 1 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant delta / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant epsilon - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Undefined site
- Asn-180
-
Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Undefined site
- Asn-176
-
Immunoglobulin heavy constant gamma 2 - heavy chain 2 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 2 - heavy chain 1 / Homo sapiens
- Undefined site
-
Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
-
Serotransferrin / Homo sapiens
- Undefined site
-
Uncharacterized protein from Blood Serum / Homo sapiens
- Undefined site
-
Uncharacterized protein from Meconium / Homo sapiens
- Undefined site
-
Collagen alpha-1(IV) chain / Bos taurus
- Undefined site
-
Collagen alpha-2 (IV) chain / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Bos taurus
- Undefined site
-
Immunoglobulin gamma / Canis lupus familiaris
- Undefined site
-
Immunoglobulin gamma / Felis catus
- Undefined site
-
Major prion protein / Mesocricetus auratus
- Undefined site
-
Tenascin-r / Mus musculus
- Undefined site
-
Uncharacterized protein from Brainstem / Mus musculus
- Undefined site
-
Uncharacterized protein from Cerebellum / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Uncharacterized protein from Telencephalon / Mus musculus
- Undefined site
-
Immunoglobulin gamma / Oryctolagus cuniculus
- Undefined site
-
Immunoglobulin gamma / Ovis aries
- Undefined site
-
Low density lipoprotein receptor-related protein 2 / Rattus norvegicus
- Undefined site
-
Immunoglobulin y / Coturnix coturnix japonica
- Undefined site
-
Immunoglobulin gamma / Gallus gallus
- Undefined site
-
Immunoglobulin y / Gallus gallus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- COVID-19 (DOID:0080600)
- Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor (2020 - Peng Zhao, Jeremy L. Praissman, Oliver C. Grant, Yongfei Cai, Tianshu Xiao, Katelyn E. Rosenbalm, Kazuhiro Aoki, Benjamin P. Kellman, Robert Bridger, Dan H. Barouch, Melinda A. Brindley, Nathan E. Lewis, Michael Tiemeyer, Bing Chen, Robert J. Woods, Lance Wells) / Status : Reviewed
- Structural analysis of murine zona pellucida glycans. Evidence for the expression of core 2-type O-glycans and the Sd(a) antigen. (2000 - Easton RL, Patankar MS, Lattanzio FA, Leaven TH, Morris HR, Clark GF, Dell A) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
-
Zona pellucida sperm-binding protein matrix / Mus musculus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Tsl-1 antigens / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Zona Pellucida (UBERON_0000086)
-
Uncharacterized protein from Zona Pellucida / Bos taurus
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Marshall's Gland (UBERON_0011149)
- Relaxin-like protein agf / Dasyatis sabina
-
- N-Linked / Complex
(avg mass : 1666.5605)
-
Uncharacterized protein / Trichinella spiralis
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Blood Serum (UBERON_0001977) Mature NK T cell (CL_0000814)
- Blood Serum (UBERON_0001977)
- Kidney (UBERON_0002113) HEK293 (CVCL_0045)
- Primary Human Natural Killer Cells Retain Proinflammatory IgG1 at the Cell Surface and Express CD16a Glycoforms with Donor-dependent Variability. (2019 - Patel KR, Nott JD, Barb AW) / Status : Unreviewed
- Site-specific glycan microheterogeneity of inter-alpha-trypsin inhibitor heavy chain H4 (2014 - Chandler KB, Brnakova Z, Sanda M, Wang S, Stalnaker SH, Bridger R, Zhao P, Wells L, Edwards NJ, Goldman R.) / Status : Reviewed
- IgG1-NK08-V/F genotype / Homo sapiens
- IgG1-NK09-V/F genotype / Homo sapiens
- IgG1-NK11-F/F genotype / Homo sapiens
- IgG1-NK12-V/F genotype / Homo sapiens
- IgG1-NK13-V/F genotype / Homo sapiens
- Inter-alpha-trypsin inhibitor heavy chain h4 / Homo sapiens
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Colostrum (UBERON_0001914)
- Kidney (UBERON_0002113) HEK293T (CVCL_0063)
- HEK293T (CVCL_0063)
- Asymptomatic myositis (DOID:633)
- Control/Healthy
- Gastritis (DOID:4029)
- Myositis (DOID:633)
- Systemic lupus erythematosus (DOID:9074)
- Hinge-Region O-Glycosylation of Human Immunoglobulin G3 (IgG3) (2015 - Rosina Plomp, Gillian Dekkers, Yoann Rombouts, Remco Visser, Carolien A.M.Koeleman, Guinevere S.M.Kammeijer, Bas C.Jansen, Theo Rispens, Paul J.Hensbergen, Gestur Vidarsson, Manfred Wuhrer) / Status : Reviewed
- The serum immunoglobulin G glycosylation signature of gastric cancer (2015 - L. Renee Ruhaak, Donald A. Barkauskas, Javier Torres, Cara L. Cooke, Lauren D. Wu, Carol Stroble, Sureyya Ozcan, Cynthia C. Williams, Margarita Camorlinga, David M. Rocke, Carlito B. Lebrilla, Jay V. Solnick,) / Status : Reviewed
- A single glycan on IgE is indispensable for initiation of anaphylaxis (2015 - Kai-Ting C. Shade, Barbara Platzer, Nathaniel Washburn, Vinidhra Mani, Yannic C. Bartsch, Michelle Conroy, Jose D. Pagan, Carlos Bosques, Thorsten R. Mempel, Edda Fiebiger, Robert M. Anthony) / Status : Reviewed
- Site-specific characterization of cell membrane N-glycosylation with integrated hydrophilic interaction chromatography solid phase extraction and LC-MS/MS (2014 - Chen R, Seebun D, Ye M, Zou H, Figeys D) / Status : Reviewed
- Absolute Quantitation of Immunoglobulin G and Its Glycoforms Using Multiple Reaction Monitoring (2013 - Qiuting Hong, Carlito B. Lebrilla, Suzanne Miyamoto, L. Renee Ruhaak) / Status : Reviewed
- Loci Associated with N-Glycosylation of Human Immunoglobulin G Show Pleiotropy with Autoimmune Diseases and Haematological Cancers (2013 - Gordan Lauc, Jennifer E. Huffman, Maja Pučić, Lina Zgaga, Barbara Adamczyk, Ana Mužinić, Mislav Novokmet, Ozren Polašek, Olga Gornik, Jasminka Krištić, Toma Keser, Veronique Vitart, Blanca Scheijen, Hae-Won Uh, Mariam Molokhia, Alan Leslie Patrick, Paul McKeigue,Ivana Kolčić, Ivan Krešimir Lukić, Olivia Swann, Frank N. van Leeuwen, L. Renee Ruhaak, Jeanine J. Houwing-Duistermaat, P. Eline Slagboom, Marian Beekman, Anton J. M. de Craen, André M. Deelder, Qiang Zeng, Wei Wang, Nicholas D. Hastie, Ulf Gyllensten, James F. Wilson, Manfred Wuhrer, Alan F. Wright, Pauline M. Rudd, Caroline Hayward, Yurii Aulchenko, Harry Campbell, Igor Rudan) / Status : Reviewed
- Mass Spectrometric Determination of IgG Subclass-Specific Glycosylation Profiles in Siblings Discordant for Myositis Syndromes (2011 - Irina Perdivara, Shyamal D. Peddada, Frederick W. Miller, Kenneth B. Tomer, Leesa J. Deterding) / Status : Reviewed
- GlycoSpectrumScan: Fishing Glycopeptides from MS Spectra of Protease Digests of Human Colostrum sIgA (2010 - Nandan Deshpande, Pia H. Jensen, Nicolle H. Packer, Daniel Kolarich) / Status : Reviewed
- Human Serum IgM Glycosylation: IDENTIFICATION OF GLYCOFORMS THAT CAN BIND TO MANNAN-BINDING LECTIN (2005 - James N.Arnold, Mark R.Wormald, David M.Suter, Catherine M.Radcliffe, David J.Harvey, Raymond A.Dwek, Pauline M.Rudd, Robert B.Sim) / Status : Reviewed
- Adipocyte plasma membrane-associated protein / Homo sapiens
-
Immunoglobulin alpha (non secretory) / Homo sapiens
- Undefined site
- Immunoglobulin epsilon chain c region / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
-
Immunoglobulin heavy constant mu / Homo sapiens
- Undefined site
- EEQFNSTFR (9aa)
- EEQYNSTYR (9aa)
- EEQYNSTYR (10aa)
- TPLTANITK (9aa)
- LAGKPTHVNVSVVMAEVDGTCY (22aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Seminal Fluid (UBERON_0006530)
- Skin of Body (UBERON_0002097) HMCB (CVCL_3317)
- Urine (UBERON_0001088)
- Venom (UBERON_0007113)
- Melanoma (DOID:1909)
- Structural characterization of the oligosaccharide chains of native and crystallized boar seminal plasma spermadhesin PSP-I and PSP-II glycoforms. (1999 - Nimtz M, Grabenhorst E, Conradt H, Sanz L, Calvete J) / Status : Reviewed
- The glycosylation of Bowes melanoma tissue plasminogen activator: lectin mapping, reaction with anti-L2/HNK-1 antibodies and the presence of sulphated/glucuronic acid containing glycans. (1996 - Jaques A, Opdenakker G, Rademacher T, Dwek R, Zamze S) / Status : Reviewed
- Carbohydrate structure analysis of batroxobin, a thrombin-like serine protease from Bothrops moojeni venom. (1995 - Lochnit G, Geyer R) / Status : Reviewed
- Structural elucidation of a variety of GalNAc-containing N-linked oligosaccharides from human urinary kallidinogenase. (1993 - Tomiya N, Awaya J, Kurono M, Hanzawa H, Shimada I, Arata Y, Yoshida T, Takahashi N) / Status : Reviewed
-
Glandular kallikrein 1 / Homo sapiens
- Undefined site
-
Tissue-type plasminogen activator / Homo sapiens
- Undefined site
- Major seminal plasma glycoprotein psp-i / Sus scrofa
- Major seminal plasma glycoprotein psp-ii / Sus scrofa
-
Batroxobin / Bothrops moojeni
- Undefined site
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Milk (UBERON_0001913)
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Immunoglobulin J chain / Homo sapiens
- KNNSDISSTRGFPSVLRGGKY (21aa)
- RIIVPLNNRENISDPTSPLRT (21aa)
- RENISDPTSPLRT (13aa)
- REEQFNSTFRV (11aa)
- KTKPREEQFNSTFRV (15aa)
- KTKPREEQYNSTYRV (15aa)
- RGLTFQQNASSMCVPDQDTAIRV (23aa)
- KTIDRLAGKPTHVNVSVVMAEVDGTCY- (28aa)
- RLAGKPTHVNVSVVMAEVDGTCY- (24aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Seminal Fluid (UBERON_0006530)
- Prostate-specific antigen (psa-1) / Homo sapiens
- NK (2aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- COVID-19 (DOID:0080600)
- Structural and functional characterization of SARS-CoV-2 RBD domains produced in mammalian cells (2021 - Christoph Gstöttner, Tao Zhang, Anja Resemann, Sophia Ruben, Stuart Pengelley, Detlev Suckau, Tim Welsink, Manfred Wuhrer, Elena Domínguez-Vega) / Status : Reviewed
- Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2. (2020 - Asif Shajahan, Stephanie Archer-Hartmann, Nitin T. Supekar, Anne S. Gleinich, Christian Heiss, and Parastoo Azadi) / Status : Reviewed
- Comprehensive N- and O-glycosylation mapping of human coagulation factor V. (2020 - Ma C, Liu D, Li D, Zhang J, Xu XQ, Zhu H, Wan XF, Miao CH, Konkle BA, Onigman P, Xiao W, Li L) / Status : Reviewed
-
Angiotensin-converting enzyme 2 / Homo sapiens
- Undefined site
- Coagulation factor V / Homo sapiens
- Recombinant Spike glycoprotein (CHO) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) - RBD domain / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- FPNIT (5aa)
- GEVFNATR (8aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Brain (UBERON_0000955)
- Scrapie (DOID:5434)
- Major prion protein (VRQ/VRQ polymorphism) 21K slow variant / Ovis aries
- Major prion protein (VRQ/VRQ polymorphism) CH1641 variant / Ovis aries
- YPNQVYYRPVDQYSNQNNFVHDCVNITVK (29aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293 (CVCL_0045)
- COVID-19 (DOID:0080600)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- TQSLLIVNNATNVVIK (16aa)
- VYSSANNCTFE (11aa)
- NGTITDAVDCALDPLSE (17aa)
- FPNITNLCPFGE (12aa)
- VFNATR (6aa)
-
- N-Linked / Complex
(avg mass : 1666.5605)
- HEK293T (CVCL_0063)
- Immunoglobulin epsilon chain c region / Homo sapiens
-
- N-Linked / Complex
(avg mass : 1666.5605)
- Bone Marrow (UBERON_0002371)
-
- N-Linked / Hybrid
(avg mass : 1666.5605)
- Embryo (UBERON_0000922)
-
- N-Linked / Undefined core
(avg mass : 1666.5605)
- Blood Serum (UBERON_0001977)
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- TKPREEQFNSTFR (13aa)
- TKPREEQYNSTYR (13aa)
- P01857 Asn-180     IgG1-NK11-F/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK08-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK13-V/F genotype / Homo sapiens
- P01857 Asn-180     Immunoglobulin heavy constant gamma 1 / Homo sapiens
- P01857 Asn-180     IgG1-NK12-V/F genotype / Homo sapiens
- P01857 Asn-180     IgG1-NK09-V/F genotype / Homo sapiens
-
- O-Linked / Core 2
(avg mass : 1666.5605)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 2
(avg mass : 1666.5605)
-
Uncharacterized protein from Epithelium of Stomach / Sus scrofa
- Undefined site
-
- O-Linked / Core 3
(avg mass : 1666.5605)
- Colonic Mucosa (UBERON_0000317)
- Diverticulosis (DOID:7475)
- Oligosaccharide structures of human colonic mucin. (1985 - Podolsky D) / Status : Reviewed
-
Mucin-2 / Homo sapiens
- Undefined site
-
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
- Blood Plasma (UBERON_0001969)
- Blood Serum (UBERON_0001977)
- Brain (UBERON_0000955)
- Mammary Gland (UBERON_0001911)
- Seminal Fluid (UBERON_0006530)
- Urine (UBERON_0001088)
- FreeStyle 293-F (CVCL_D603)
- HEK293 (CVCL_0045)
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GalNAc(?1-?)GlcNAc(?1-?)Man(a1-?)[GlcNAc(?1-?)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]ManNAc
- N-Linked / Complex / GalNAc(b1-4)GlcNAc(b1-2)Man(a1-?)[HexNAc(b1-4)][Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(?1-2)Man(a1-3)[GlcNAc(?1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ GlcNAc"
- N-Linked / Complex / GlcNAc(?1-?)Man(a1-3)[GlcNAc(?1-?)Man(a1-6)][GlcNAc(?1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-6)[GlcNAc(b1-2)Man(a1-3)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)[GlcNAc(b1-6)]Man(a1-?)[GlcNAc(b1-2)Man(a1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-?)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)][GlcNAc(b1-4)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(?1-6)]GlcNAc+"+ GlcNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-2)Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 2 x HexNAc(b1-?)"
- N-Linked / Complex / GlcNAc(b1-3)[GlcNAc(b1-4)]Man(a1-3)[GlcNAc(b1-2)Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc
- N-Linked / Complex / HexNAc(b1-?)Man(a1-3)[HexNAc(b1-?)Man(a1-6)][HexNAc(b1-?)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-?)]GlcNAc
- N-Linked / Complex / Man(a1-3)[Man(a1-6)]Man(b1-4)GlcNAc(b1-4)[Fuc(a1-6)]GlcNAc+"+ 3 x HexNAc"
- N-Linked / Complex / Structure 2802
- N-Linked / Complex / Structure 2888
- N-Linked / Complex / Structure 9460
- N-Linked / Complex / Structure 9566
- N-Linked / Complex / Structure 9792
- N-Linked / Complex / Structure 9951
- N-Linked / Complex / Structure 10064
- N-Linked / Complex / Structure 10244
- N-Linked / Complex / Structure 10627
- N-Linked / Hybrid / Structure 9595
- N-Linked / Undefined core / HexNAc(??-?)Hex(??-?)[HexNAc(??-?)Hex(??-?)][HexNAc(??-?)]Hex(??-?)HexNAc(??-?)[Fuc(??-?)]HexNAc
- Cancer, breast (DOID:1612)
- Control/Healthy
- COVID-19 (DOID:0080600)
- Prostate cancer (DOID:10283)
- Deducing the N- and O- glycosylation profile of the spike protein of novel coronavirus SARS-CoV-2 (2020 - Asif Shajahan, Nitin T. Supekar, Anne S. Gleinich, Parastoo Azadi) / Status : Reviewed
- Site-specific glycan analysis of the SARS-CoV-2 spike (2020 - Yasunori Watanabe, Joel D. Allen, Daniel Wrapp, Jason S. McLellan, Max Crispin) / Status : Unreviewed
- Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis (2019 - Nicholas M. Riley, Alexander S. Hebert, Michael S. Westphall & Joshua J. Coon ) / Status : Unreviewed
- A novel, ultrasensitive approach for quantitative carbohydrate composition and linkage analysis using LC-ESI ion trap tandem mass spectrometry (2019 - Kathirvel Alagesan, Daniel Varon Silva, Peter H Seeberger, Daniel Kolarich) / Status : Reviewed
- Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and α-1B-Glycoprotein (2018 - Shisheng Sun, Yingwei Hu, Li Jia, Shadi Toghi Eshghi, Yang Liu, Punit Shah, Hui Zhang) / Status : Unreviewed
- Reanalysis of global proteomic and phosphoproteomic data identified a large number of glycopeptides (2018 - Yingwei Hu, Punit Shah, David J. Clark, Minghui Ao, Hui Zhang) / Status : Unreviewed
- Distinct urinary glycoprotein signatures in prostate cancer patients (2018 - Rebeca Kawahara, Fabio Ortega, Livia Rosa-Fernandes, Vanessa Guimarães, Daniel Quina, Willian Nahas, Veit Schwämmle, Miguel Srougi, Katia R.M. Leite, Morten Thaysen-Andersen, Martin R. Larsen and Giuseppe Palmisano) / Status : Unreviewed
- Selective glycopeptide profiling by acetone enrichment and LC/MS (2014 - Takakura D, Harazono A, Hashii N, Kawasaki N) / Status : Reviewed
- Immunoglobulin G (IgG) Fab Glycosylation Analysis Using a New Mass Spectrometric High-throughput Profiling Method Reveals Pregnancy-associated Changes (2014 - Albert Bondt, Yoann Rombouts, Maurice H.J.Selman, Paul J.Hensbergen, Karli R.Reiding, Johanna M.W.Hazes, Radboud J.E.M.Dolhain, Manfred Wuhrer) / Status : Reviewed
- Glycoproteomics: Identifying the Glycosylation of Prostate Specific Antigen at Normal and High Isoelectric Points by LC-MS/MS (2014 - Song E, Mayampurath A, Yu CY, Tang H, Mechref Y) / Status : Reviewed
- Efficient and accurate glycopeptide identification pipeline for high-throughput site-specific N-glycosylation analysis (2014 - Liu M, Zhang Y, Chen Y, Yan G, Shen C, Cao J, Zhou X, Liu X, Zhang L, Shen H, Lu H, He F, Yang P) / Status : Reviewed
- Simultaneous glycosylation analysis of human serum glycoproteins by high-performance liquid chromatography/tandem mass spectrometry (2008 - Harazono A, Kawasaki N, Itoh S, Hashii N, Matsuishi-Nakajima Y, Kawanishi T, Yamaguchi T) / Status : Reviewed
- A-kinase anchor protein 11 / Homo sapiens
- Adipocyte plasma membrane-associated protein / Homo sapiens
- Alpha-2-macroglobulin receptor-associated protein / Homo sapiens
- Asporin / Homo sapiens
- Biglycan / Homo sapiens
- Calumenin / Homo sapiens
- Calumenin, isoform CRA_a / Homo sapiens
- Carboxypeptidase D / Homo sapiens
- Ceramide synthase 2 / Homo sapiens
- Clusterin / Homo sapiens
- Collagen alpha-1(VI) chain / Homo sapiens
- Collagen alpha-1(XII) chain / Homo sapiens
- Corticosteroid-binding globulin / Homo sapiens
- Decorin / Homo sapiens
- Desmoglein-2 / Homo sapiens
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 / Homo sapiens
- Ephrin type-a receptor 2 / Homo sapiens
- Fibroblast growth factor receptor 2 / Homo sapiens
- Fibronectin / Homo sapiens
- Gamma-glutamyl hydrolase / Homo sapiens
- Hypoxia up-regulated protein 1 / Homo sapiens
-
Immunoglobulin gamma / Homo sapiens
- Undefined site
- Immunoglobulin heavy constant alpha 1 / Homo sapiens
- Immunoglobulin heavy constant alpha 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 1 / Homo sapiens
- Immunoglobulin heavy constant gamma 2 / Homo sapiens
- Immunoglobulin heavy constant gamma 3 / Homo sapiens
- Immunoglobulin heavy constant gamma 4 / Homo sapiens
- Immunoglobulin heavy constant mu / Homo sapiens
- Lactotransferrin / Homo sapiens
- Laminin subunit gamma-1 / Homo sapiens
- Latent-transforming growth factor beta-binding protein 2 / Homo sapiens
- Lysosome-associated membrane glycoprotein 1 / Homo sapiens
- Major prion protein / Homo sapiens
- Neural cell adhesion molecule L1 / Homo sapiens
- Periostin / Homo sapiens
- Polymeric immunoglobulin receptor / Homo sapiens
- Prolyl 4-hydroxylase subunit alpha-1 / Homo sapiens
- Prostaglandin-h2 d-isomerase / Homo sapiens
- Prostate-specific antigen - high Pi isoform (psah) / Homo sapiens
- Reticulocalbin-1 / Homo sapiens
- Reticulocalbin-3 / Homo sapiens
- Serpin h1 / Homo sapiens
- Solute carrier family 12 member 6 / Homo sapiens
- Thrombospondin-1 / Homo sapiens
- Thyroglobulin / Homo sapiens
- Transmembrane protein 2 / Homo sapiens
- Zinc-alpha-2-glycoprotein / Homo sapiens
- BTB/POZ domain-containing protein 17 / Mus musculus
- Cadherin-9 / Mus musculus
- Dipeptidyl aminopeptidase-like protein 6 / Mus musculus
- Glutamate receptor ionotropic, NMDA 2B / Mus musculus
- Isoform 2 of Cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule 2 / Mus musculus
- Neural cell adhesion molecule L1 / Mus musculus
- Neuronal pentraxin-1 / Mus musculus
- Noelin / Mus musculus
- Phospholipase D3 / Mus musculus
- Plexin-B1 / Mus musculus
- Sodium/potassium-transporting ATPase subunit beta-1 / Mus musculus
- Tetraspanin-2 / Mus musculus
- Thy-1 membrane glycoprotein / Mus musculus
- Recombinant Spike glycoprotein (FreeStyle 293-F) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- Recombinant Spike glycoprotein (HEK293) / Severe acute respiratory syndrome coronavirus 2 (2019-nCoV)
- QCVNLTTR (8aa)
- IWIPVNITWADIEDRDGR (18aa)
- YVNMSNHHR (9aa)
- SPLPAAFTANGTHLQHLAR (19aa)
- NNSDISSTR (9aa)
- WFSAGLASNSSWLR (14aa)
- VVRPDSEIGERPPEDNQSFQYDHEAFIGK (29aa)
- VVRPDSELGERPPEDNQSFQYDHEAFLGKEDSK (33aa)
- FSNVTWF (7aa)
- NKSVLLGR (8aa)
- HAIHVSGTNGTKRF (14aa)
- FHAIHVSGTNGTKRF (15aa)
- SVVAPATDGGLNLTSTFLR (19aa)
- DGVHLGPNNR (10aa)
- HYTNSSQDVTVPCR (14aa)
- HYTNSSQDVTVPCRVPPPPPCCHPR (25aa)
- VLTLANFTTK (10aa)
- ELPGVCNETMMALWEECKPCLK (22aa)
- SNIDPSNVDSIFYAAQASQAISGCEISISNETK (33aa)
- DMSDGFISNITIQR (14aa)
- NVETNNSTVLIEGKKIESLR (20aa)
- SISNSTAR (8aa)
- TQSLLIVNNATNVVIK (16aa)
- FGCEIENNR (9aa)
- NVTYGTYIDDPDPDDGFNYK (20aa)
- NATYGYVIDDPDPDDGFNYK (20aa)
- ARGNGTLITFHSAFQCCGK (19aa)
- NATYGHYAPGEEFHDVEDAETYKK (24aa)
- YHKNNKSWMESEF (13aa)
- TAGWNVPIGTIRPFINWTGPPEPIEAAVAR (30aa)
- FKLDWLGNCSGLNDDSYGYR (20aa)
- AGPNGTIFVADAYK (14aa)
- TKPREEQFNSTFR (13aa)
- EEQFNSTF (8aa)
- EEQFNSTFR (9aa)
- EEQFNSTYR (9aa)
- EEQYNSTYR (9aa)
- EEQYNSTY (8aa)
- INATDADEPNTINSK (15aa)
- VNTLEEGKGGPKNDTEER (18aa)
- GENFTETDVK (10aa)
- NFTMNEK (7aa)
- TPLTANITK (9aa)
- NDGMNITVLR (10aa)
- GITFQQNASSMCVPDQDTAIR (21aa)
- IADTNITSIPQGIPPSITEIHIDGNK (26aa)
- VDHESLNATPQVAMQVLEIHYTPSVK (26aa)
- EEQYNSTFR (9aa)
- GINIT (5aa)
- DLPQGFSALEPLVDLPIGINITR (23aa)
- LLFPTNSSSR (10aa)
- KDNTTVTR (8aa)
- IGISFNSISAVDNGSIANTPHIR (23aa)
- VIDLWDLAQSANLTDK (16aa)
- MIENGSISFIPTIR (14aa)
- ITDIENGSIANIPR (14aa)
- KYNENGTIT (9aa)
- FLLKYNENGTIT (12aa)
- YNENGTITDAVDCALDPLSETK (22aa)
- VIYQNHNK (8aa)
- FFHVNGSAFLPR (12aa)
- RFPNIT (6aa)
- LAGKPTHVNVSVVMAEVDGTC (21aa)
- LAGKPTHVNVSVVM (14aa)
- IAGKPTHVNVSVVMAEVDGTCY (22aa)
- GEVFNATRF (9aa)
- NATRF (5aa)
- MINTSSIIEQINEQFNWVSR (20aa)
- VSCPIMPCSNATVPDGECCPR (21aa)
- IANITQGEDQYYIR (14aa)
- SFLLSLAALHDNHTHSDIQVK (21aa)
- NMTVPSK (7aa)
- DECWCPANSTGK (12aa)
- NYTDCTSEGR (10aa)
- VSINQTEPPK (10aa)
- VFSIHSENGSIFTLKPLDR (19aa)
- IISENKTDEEPGYIKK (16aa)
- LLLPAKNTTHLK (12aa)
- VPGNVTAVIGETIK (14aa)
- ALYAWNNGHQTLYNVTLFHVIR (22aa)
- TAGWNIPMGIIFNQTGSCK (19aa)
- NVTIMANLK (9aa)
- ANEYPNITR (9aa)
- DQCIVDDITYNVNDTFHK (18aa)
- GAPGINGTK (9aa)
- EVNDTLLVNELK (12aa)
- GGVSVITPGTNTSNQVAVLY (20aa)
- LYQDVNCT (8aa)
- NNSYECDIPI (10aa)
- YSNNSIAIPT (10aa)
- FGGFNFS (7aa)
- TPPIKDFGGFNFSQILPDPSKPSK (24aa)
- TPPIKDFGGFNFSQILPDPSKPSKR (25aa)
- NVTAQICIDK (10aa)
- NATLAEQAK (9aa)
- AEPPINASASDQGEK (15aa)
- NLSMTITR (8aa)
- VPAQEKNF (8aa)
- KNFTTAPAICHDGK (14aa)
- NGTHWFV (7aa)
- NGTHWFVT (8aa)
- IGIVNNT (7aa)
- GINASVV (7aa)
- GINAS (5aa)
- NISQDLEK (8aa)
- NLQVYNATSNSLTVK (15aa)
Source
Suggested structure
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- Hex:3 HexNAc:5 dHex:1 / N-Linked
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- O-Linked / Core 3
(avg mass : 1666.5605)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1666.5605)
Reported glycosite
- O-Linked / Core 2
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Undefined core
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Hybrid
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reference
Reported glycosite
Mass spectrometry observed peptide
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Disease
Reference
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Disease
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)
Source
Reported glycosite
- N-Linked / Complex
(avg mass : 1666.5605)